ELF>@s@8 @@@@* * 0 0 0 ++LVC4DD888@@xxxDDStd888@@Ptd 22QtdRtd++P$P$/lib64/ld-linux-x86-64.so.20GNU GNUluseIxBOWGNU40 !JhdAPDB D@ I(@@i"bHHB 0Iqh @( @& D  DJ  0@ A@b L@0D@DB@E % +XT@@D$ @ A%  0@@ bBh @B `!‚ XqI B$H`(0"B@@` P(B'8@ s0 "B($$D@P 2(P$ BDXHABp @B82  BX  & DD( 0DCDtH`hh6 @!% P @ @bBN@@(D.:P JA0 !P0 ``"P1  @L 0A4( BD@"P@D XDBAh " 2@@%<0$$!tR`    B@ɪ@ `1C@P@@   @M2@NR L1B  ?aDa!APP YϚH  @ 1!hDfP"JL( F D`" `0 `J %&! @4@"V "b`@CD$@ F9$@ y@ A@@P @ B @$8 @@F D!  @@ 0   @ob . (@\`! H @Ja0 @ @ A@ E  %( C 3 "H  @  @C $P"P P  (@D($B  H"< 5A"  &P"!`%`A @`  #FA!I`@ , ̨ @A&I ,"# . HT X @@ BR2`P Je$@@Z  !'@ #D"PA   T8@! (("Q"()@ A)pV@E@@( 4"SW T$ Q&1 @@ (I "H F @BP$H" 20  "" $r`d  @ 0E @@  PEH@$" @` "5@ BPRYD(6I  468:<?@ABFIJKNOQVY[]_`fghijkmosvx|}  #(*,.2469:>@BDFHKLOQUVZ[\^bcdgijkmqtuwyz~  "&)*+-.0236789;=>?ACDFJLOPRSUVWXY[^_`bdgilnpsuv{|  !"%&',/25689>CEGHILNOSVZ\_`cfijlnruxy|}~   !#$&')+-/12468:;=@EFGHJLPQRSVX[]`abdejoqtuyz{}   !%'(*-13789:<=?ACFILNORTUY\abdefijknopstuwyz{|~    !#$),-.023467:<>ABDFHJLOSTUYZ[\`cfkmoptuwy|~P-q5A#*n2BT^+a0TriG%@E$ǁ + Tl0zxQ;i% ˊ\p}mPMp@]7e2 l[ "Wݾ-z?X…bK^i$(FyUO#BYW .ZVn[D98UtĊ^/j掿4/fV&_,l߀]?w87$&c.|/h;yDB]yv هC N=3Vnd.K 7.buN؀PNܸs܍SL "Exx`{688Kv՘\06w[s NG$Yjp7>.+Z@o`I{?‚YkEuO C1J`N^ߌ]`لՀg@VØDeV;%64i ߁RVǞ E%=O%3BQŎ 6D8!VqL_[[{^MD*G643cGu%n&ޕWbI{MyxF )"H,XN;¯p[|=[bjǏ٬ԋ9{"5't.Fk+T.|3qs:*]2FLSsMo:uY6Ϛ@͗WfEȟ K{5T|9kP# oSypKanj{1T=0īmB["[9%Q$:6SWPg"XWᅛ5$ ]>o^ x%h^k_՜Y)~ dkMUan`O *kYJut3,2=~>YSU--_e)MKQY.?h1 7(Y1oB K4^Sǹ/Wy僝k_1DXMjW{I> HG su-ѫ#^ry?HKfpRDA4ϾJP3bʚHchC ɌUB $|).3-lqxWC:Eʊ蠒J!2h5AYL/'Tw52lr-(u95ю0s-=UY}=:qJ>*oG"hj0VWrWOKOkD';74(\$~dщjh49 sHu-X1$@,8_&u&f]9ZD\?P z҂:ӱ{bc&<//uC|Z^PĖʇگ5s$v cR5UZT"B-r/fOBA Wxb ,{:up{ضqKIKķʞӡ.Afn ~ 'aW)ϾJhFq粥Qp`m˧+ԲVޥ,Q`s0&űJ} c`ךݣkI\ Ҋ_jPZ//U#ki{@ ّ҇;j&ԩH*^3Ne rJbfh%kZ Zo9Orn`HD Ba'd"ȕB8&*c[Zb:ѿ#sFr+v֞M_34 Xcv1t4 *1d+;g3tڰ9U>ON}F̙7-+(=Is0EUP=}3es2Cf-j]";Fő׭am#a6\5#@. +WDGж߼2^-K"s Y<#6(Y?\jdrSj|gbr qsӢ:+uiJ3h=s`="JW,WrG",x8{EXJ;Y`y`;i bꋑ/ P! -=)ŀe)W,Ha_@2_8ua6H[y,w*̬*`/OdW_SB?ߗ?'AVȌ+ldu$jl&-wFݙ:VU-&FXIl$MG>.χd1xVaNhQ+s1b36E@Z6'.cJaw-l&T {*ֲ\f)=3H쑐<+j~[v8y᳎%2!!tRK. J(Ԁ _ȝl>_2.5ר|* '0$ ʵsHԵ%ʗId  vwTf?pX}@ ~JDbP1r+*AG Ũ5MkT8*CܰzlR 2y 3._#iÄ1˴Z9GKtM ÏC,r5|]iPȬ*7,z}MA_p[쫟s\X1˞k PA66@5hXN'U+IH8)hIkK^U+pt,RP!zyK. : wXϻa@h4@Уq)Rta獔VaGa2s >"?9v]7l`]47*WufQ|S"xR16#w>xI AoƵWW8; ZmAX\Kង$oEL#5z`?-G $mymnk_DLc_+wlU-m׃Q}j.Q!-m_/(.yoˌy^bAYt@@6Q m F}籿V2V6WI7F.pcj {l8V'hrFj1'wlҜDp!1 ^qjO}3'^ O7z&46_V1]oMOIÛuT =giD#T!/F$MEKtpU`R-*3 y`7~\ BkU ]&rqs:CbISw݊JFoy߄t-}K)x Ma s@6=`<Pܑ®F%pTB٦ria9ڸPȗ&(Kn;olhۓ2cazwCkZ%2Rwt:q(SPq8oWfk74SRÕ9V$R'&6K!I٨JK DY"qpYe")' |g0'&CykJqҵ㣼,4=%-ip3p ߏžP0X3ͰQ~0''k2G$YiPoJڻ~s 37SHjMHvnrJ*+?֚WL~G/"E7Ml-D3TQCIFf{ٛ{ `T;U_aW߆M!gqU"4" 5bőM10"`_ ؊66is>x| H0xNtvX{b>Xm>]rܿM4 gbLE5rէS K޼)G)ssJN+*Q`CE~r6z(t= "O} ?~bv~У%\fKRYIB8 Tx}9EKY^7ަ zɦQ/8R~R3?x/e\B##BͩC$ɛN ı}*~rH vyd5Lyȹaz;nNӂ&n7{<8W2eKw=e&ހ'F@{?MȵFPj 2(,wEbH1^H0^0, ~[uiAR85LTlbrYmdr:ŁODB ,61j<ύˎ[e.&O.Q>HfiCғs$Bw2`1:t)pjUF*WGr<pU/֬lj\WlXE; i?B4Ű ,Ș1DfCT}I.) JuU؍jKxVG|\D-΢:ǮD h}=a· {}/eˬ~5g~eP`lUa;W@Î(y1t͢+@ySoN1,MS:B'LC,+S3G[vǾkql;4EQ䫐Lyʁ@6ۇXhfΗ[ٳj9K_bà 3fUaGث+i{J+A`(^sHz=۱ =wf:~{gbxYtn<\vͱhw JBǯ6d]v~ YVWJL7頇Z)1z0 A;H!)lZ E+푈 "n 2Б3XL>>oGWi5V\o1NٝΞÑ6JĹ@ d[n'w2ݿfo$>l2)~4jYc['"L *"$w=4 b 2{nAQp\ȂDN%~ˡodԋ TU nbZeJ+}M&Zh<Ah OGn-AB"d P_I g VGX ~6H  g dDqb~S  !. myCdT J* 4iU &*`\b'n mJu2  Q  3   oa  ~&g{$ /E;  ?E ^JF L5Sp5K9.f  pN`E  7 mF, "` z  kI1  & )  (  lw\ X   u f n MTl [zh u C WF  +  U9;;;G0\-E., wo; jer  1 7 I"v Y,7K> FQ PyU @ @) P E {6%* +:2 PA uY1ؒ9FB.Y 0 E3T   tT'[B8Pp/W \ @V5 k'4 @TFp.V jK [ A Щ t'  PB)!GWZQ pZo E2r xj7 <;SA$d pQKo#11d U PEh /e< Г y2 O ) >? {Ho (5_*W[ :! `6P A" @' ` q ;O ` [Rb PC)4 & O 2*S 5sU \F]M X (Z^ Gxc@ G $ \ N pX- >N #0D ^P(\+8 7 /7 _3 j UY1.- v8 'oJA 9l4I Z 1cfg@G 0 W p r Ab 0`  eghX0F ` lq/uH l KSr  c ; ! O; =H`K_ *8 _ b # JO @s! "7  p C80XL &) 0qX7 0x@ =|& 5* i|B 0xd im P" LB 0) qB {I ;n `^w#Y 0@K] @ )R"u>q 4" ` [e0 ,Cu^P 3zi AqD, ,*=mHXV {SO3 >EA_X\" @2 0 d6T  TD4 > g/ PUGE: P=t= ` pc H pM &PiPk1R ' 3; 0 Dj p% 1 Б Y0. PVAp E ` *r! `L)o pED@U AcnHWxo  6 kA< `|'xs y1W_ p4 Btw) Dp1N `bc.% pV%/ `h3; R\ 3K `U Ac* PI {[p S8  G U4=e ViP, X>`(?J / P 1r pjp%F^,  E ykVs( 7;` y{FX14 ȣ5 Db(0NI @Da PCf `Ja#`{ 6 W8 `\< @ 50W( ; P F.o ; Lh @?PLW PU/ S@ YC!Sh9(D 0I ` 1 ]Nkg p/Oj  02 JQ &x? >O<PSB p\ v?r s1ZTZ aZ$ Q_(1 P44 Jq $ &MY  K@ R 0)n !Se &1->>k @. v  0 > & %F 0(J ,LN(PrT `._d0A [K pt1k @  - < c wDWo أ~K  s pN1 2g @H ;8 (Y zICT p hoDJ 0> An ]Qn C, `qC 0ODd{ -@RV $ y_ pHg _C"02/ P ,aD1LWR ! T! @V @G/mL  P jhT;>[ m3 ]- :AHd h?x a 0(moh^ ~:  ^U <Y` r9C Eg P  @ /e`\ 0 G ZMF5 `xP$ Ѐ|7D#2XS S, "W2 @8mPn ; 9 @Xa @ + ..@`(M % ?S L,6-_@a(L2 'a> N p+3 $7 V;-L 1 q ^ IW p: V^ B59 XV)@() К q* y_ A@  ]\ Q 0 M_lXI `Z$ PaDW 4 GT N 0 =U< /"5 0A cC "L@1 R9R P ,  Rg, @t > PyIC IMTX }h p q-e: 1x; zj^ E.I , .i$PNo ErX @.8 %'4W^u p M#j eG ml @ УO:`K \V zh\ |\ 0 \X1d " p& ( lkE P%E s8 @[C  @Q @Cp @n% ', ?qMH u `( '.- `37 @u( '> IF  [ 'M 0Mn s peb =B'M KVa(Ol @s9 pPG X p <\e Ј; Ћ3B. ` 93 p  P b  f [* '?> R |6: z5 `BQ3 9`L Y6_ ##d d= W hp @nY Lr3Zb POo U KFk  q P xm b'  FD>18 п * `,g+ B@ $;. ` }l {!% X z4`1c ' T4\  ;mc YAk k? 0_G p$P  :XwLa(t `'(= 05 ~= &! pN* 0UX P p$ * QlR p&k p!( B ;8WYq@} P] P#)!F (Bb @+< PaL Y =Q= C7 @H, A ` hbF( "( P&# 'GU @oJ @A% c(c ;N O `Ys] 71O p0g D#1, %0 pO[ 0"O ! W\xQ+4B00gP =Z @D?M P j 0b p PT' 0 WB; tWB `\q< F " %0_Ddp, py%2T" : B+\ 0b3 p AP1S C PSO |kWc,W7W:`m 0 J ;f  #6`= `tS &e GC `f= p #  H  + l @!1 PMuW4 `Jln p3{+Te4PL i& D Gxi[C AT QE" ~(  M0h_ 2f @  U [ YT P"H ?c8+ [~  r 0Q QU pAoE8 Q_L cN Y K^ Ќ|Q  T@ ^ic3  ~I _BL 0'3@zN[4# )2Y( 5 ` v"@  6M. PLM EDiV 9jD0W % & *D6 P Tp  @B M%a 6D @4'h H[M UKk ), 1z. >g PGc M<p `a 9 GD@ Ъ RTc `Y_n1 p 135Tx"8}:@Q`\sq p(* \6 _@zPdXhT g 0rr hA 0D6 + P"BH YDJ3 dFT9+ p K`.`(6   }!Q@2  Q [  Е  0 6L ~mk 0_D xo7Fm T= А vAW ` = AKa #Ng пU`2P >SP2`IE % y1,`QA@2< . e E9) %Om" =9 2Y PZ^ YSa ;4 [ 5Q Pne1  Q Im !L !{ - D @-zk\  `#Ph a !V\a Pv%h QF @ k/@ p^A DD @T%r &" P0C ;B^p.g &bi@M5 \;P0@ T(cB PR P J5 `"- 09 a+\1 AE 0 +X"#|W%& P^/ N  i &%9 3%L Iw[ 8T?u@ H, ^zJ. 03i 5K% b O aP 8an;Tg_0kp 0 t# F `$ e8- pVVE |+JZ+ [~ (  0Rp:./> PI  [d /V .e Qm)LW=U D9Qp;\ W /m x_D014 `) 0T h 7Q @C` O :_WL b( 0%O @S,  0xYSQ< Pi@/I @  PF$]43' &nJ @n KL P"  (W kZ  XX  iC  :1 p? X^ @#  Pg  6I.Q0G @ i(W3](6 P a *b |eX: @p  P( %V NV ({a^(,.W/ 8 L Y& AH?] z ; :ax#K PPcWU#  ;BN P 4 _K) -1 0(_0\,H/[ T @T_Y P5Ps  f @ r` @ S4 !) p!W,9= [r5b g/I*T0p 0   ;0 P= 0> `_N&# KY yp  !UP2EX '>% @)I 0Z aT 0 ( 3 H' @+ )LBD |3p , `F&]& .M M) &+* dH\vZ Xj !86 [H p x xWh! 0*< pg! = !S  P ~s8 9 d+ 5  tc S  % `O P[ 0 1  \0f`'GxFO+@0B\e@.T-( `n `:HF>` D  | 8Fn P1H v `;,N l oH ВL # wjM Hdj@W 0}^ @B i?3  J ) eC8ZA p M8X[ , v-e ,Bi  m'\\E &Z j qp `l H ! ,P6Y0 BM] x/+ U7 @ ;G  M4j 'tF FpP6E e  ] m@_(S0! I5 :-S `s!qp ,`Wl {}/ @.QD pxBhWm pe# pTJ '8k pCR T[0 Py1htX9 @8Z: >V8F PWW[ a6 |2 $% pASLeq @ ]QT[xTH  Wp D8:sx9V `b 5N . .2 p(BhY 'Uj 0_? 8+ P6 I7 K @^!n pCB @{V pY/wf  iT\" U P9 P;DH 'zo,\/0 [x> S =-X Onf/a](R ' $ A_XXM LF(Kf ?@^(o p8 *, P{X @Ab 4$ pT:+l2 dDL0+ ` @}p !oP PZs 0K W`[ Crd](, O84X(W4? 0ee_(+E F $ 11 H P I : p [ Г 8 +r@b( &s b (   Jim @ 7 0:GQO ?{^E` .T "r  $\ 0&-R  CU("2U @ [] _) p I p !< Y # Wj Ѐ4@/B pSWyr P :& 1W/b.. B M@P(pX(FV0! @# E &dl 0FXE  iWH70/$ {*Z DtF zl6 ` #( &dQ8yA  V gI /B^PX1 x7^(X< )G &W. c pO&( >}0LX @U7gvE\N^r )5c 4 0g5 7E^( ^2CZ `L #-DmOa(c Q{gsfP/ - > s;?l`. Qf% 98 D^Q$T `,]= Z bJ ` ! 0(n. iEM U%e L<1X `4~h? Rk :-:1b kG ЃcX-\ \AO , @ f@@Y  @zS P_cxC0  @ ~? P.0TxWI\ " WD 0n @WP Э 3 ] .$b Sy\ l eD, - _ F?T.R WZ &t 3 2# {TP 0edre ` <7 gpo =p Ёyj PB[g @f-$ P B,U :df =' p7nR :W6W Q$I Q k l  G!<FX >; jy=|PI1 p 2< ja? ,  u|5|Tq A" C //  + &E `OG `!5Y 0   $ 3MK pl2 P:- P,` wh X'qpW P P _ P !EP /B P%24 +[KDfT S :S ` H; !.`{` @aA 1 q  !fmQ ` i ? AJ b^n p p !P@](KN @5b(= e' "`0w' @)n 0A# IA d T bw0. 0ElX l. 0Q,X[r @).Z-v * .`([R Q @WVZ 0 C` A, H/ U7' @G AQl  |e h  @  ,Xl Yfa `Sth `C8 4&  Z `,fO XqK 56. @sW 7<d N\2 Yk8/3PSrj pBUr 57 H'` q W M h D` P3C ?o Pg> z)c\5N X /$. 66 7a g IȤ`PTm  C6 6s @,8R C0fS _] @d l,^ P#m $  HS 2 B/K (d\& $ y. B F ,>Nb(% Vr 0A Y'n D?& p6H p^\ @@p P&]  e P m ; :R`/jX @7f Jyl @)TJd h G& 0E=g %\O?j pCV\0c %g0 T+J *$ [&T4 0!GQ  \s y2=p0E &'K-B1Z 3b \] W0 `\/i p P й7]x ' . p iHk3 P'xi +P- 0YV p@,8I= "YG [Ol0H г&+ P* [%_(Zp+s%giZ 0  1 ` 9R `F `[ch?P/ Q ?LWTd 5w`WHPX9q 0IX' ,: ЌGw2u=( B2 @> 0X.] 6~g P, 3 ^< @i[W% a1! P[,Q]1 NT/ zaIJ E @$0.n >#-  ] ^ pR ![X ,58G $ e 4T/ d? `9pM &\ '[k @ Q m P p- pS.-\ 0|'^ pv6QlP.* Z; 1YP/#0 g Yh 8/l -|d 0k | ?:D2s`TC L[ `B0b dW QfDo- I46 %H h B @6YS^(T !55 M; R ' | O X f $ g 0Al|Q?$T%/a p& B0h,iT3K A$(, V%pT9 T# p HCB ^LVX 1w " >i 0n %]8 @G _u<hX  P CK 3h p I< G? Li pk d `Lj wLp `  0? TCQv! `AI @+?  ] P!"^ V+f P-40&3 v~h2  . _Pe/ p>`a b !A 6У ` h_ITM_deregisterTMCloneTable__gmon_start___ITM_registerTMCloneTableusing_historyrl_make_bare_keymaprl_redraw_prompt_last_linerl_readline_staterl_function_of_keyseq_lenhistory_lines_written_to_filerl_completion_mark_symlink_dirsrl_vi_start_insertinghistory_lengthrl_copy_texthistory_getxmallocrl_prep_term_functionrl_delete_textemacs_standard_keymaprl_add_undorl_invoking_keyseqsrl_bind_keyseq_in_maphistory_tokenizerl_filename_quoting_desiredsh_unset_nodelay_moderl_tab_inserttilde_additional_suffixesrl_explicit_argrl_parse_and_bindrl_crlfrl_set_signalsrl_executing_keyseqremove_historyrl_vi_bWordhistory_expandrl_named_functionhistory_search_delimiter_charsrl_completer_word_break_charactersrl_terminal_namerl_endhistory_lines_read_from_filerl_cleanup_after_signalemacs_meta_keymaphistory_get_timerl_function_of_keyseqrl_translate_keyseqsh_get_env_valuerl_tilde_expandrl_attempted_completion_overrl_dispatchingrl_read_init_filevi_movement_keymaprl_filename_dequoting_functionwhere_historyrl_completion_typerl_directory_completion_hookrl_funmap_namestilde_expansion_preexpansion_hookrl_editing_moderl_last_funcsh_single_quoterl_filename_quoting_functionhistory_quotes_inhibit_expansionsh_set_lines_and_columnshistory_baserl_forward_wordrl_char_is_quoted_prl_completion_quote_characterxfreerl_donerl_emacs_editing_moderl_initializerl_bind_key_in_maprl_unbind_function_in_maprl_completion_entry_functionrl_add_defunrl_completion_suppress_quoterl_instreamrl_num_chars_to_readrl_set_keymaphistory_subst_charrl_filename_stat_hookrl_completion_append_characterrl_push_macro_inputrl_ignore_some_completions_functionrl_variable_bindwrite_historyrl_unbind_key_in_maphistory_inhibit_expansion_functionrl_generic_bindunstifle_historyrl_attempted_completion_functionrl_forced_update_displayrl_completion_invoking_keyrl_bind_key_if_unbound_in_mapsh_get_home_dirrl_sort_completion_matchesxreallocrl_filename_rewrite_hookrl_variable_dumperrl_outstreamrl_list_funmap_namesrl_end_undo_grouphistory_is_stifledrl_signal_event_hookrl_bind_keyseqrl_completion_moderl_completer_quote_charactersprevious_historyrl_filename_completion_desiredemacs_ctlx_keymapfree_history_entryrl_insertrl_read_keyhistory_write_timestampsrl_get_keymap_by_namerl_begin_undo_grouprl_filename_completion_functiontilde_additional_prefixeshistory_comment_charhistory_quoting_staterl_complete_internalrl_special_prefixesrl_line_bufferrl_on_new_linerl_username_completion_functionrl_newlinerl_completerl_vi_editing_moderl_function_dumperrl_get_keymaprl_insert_textvi_insertion_keymaprl_variable_valuerl_readline_namerl_completion_matchesrl_startup_hookhistory_truncate_filerl_redisplayread_historyrl_basic_word_break_charactersrl_pointrl_clear_visible_linerl_menu_completion_entry_functionrl_macro_dumperrl_yank_last_arghistory_set_posreplace_history_entryrl_reset_terminalrl_vi_end_wordremove_history_rangerl_markrl_set_screen_sizerl_kill_text_rl_find_next_mbcharrl_completion_found_quoteread_history_rangerl_deprep_term_functionhistory_max_entrieshistory_expansion_charrl_key_sequence_lengthrl_vi_insertion_moderl_filename_quote_charactersrl_clear_signalsrl_directory_rewrite_hookrl_menu_completerl_dingrl_get_termcaprl_completion_suppress_appenddlclosedlsymdlopendlerrorstrcasestrsocketmkdtempfflushstrcpyfchmod__printf_chksetgrentfnmatchreaddirpathconfsetlocalembrtowctowlowerfopengai_strerrorstrsignalstrncmpdcngettextsetserventstrrchr__longjmp_chkregexecdcgettextwcrtombgetpwuid__fdelt_chkclosedirstrncpysigprocmaskregfreegetgrent__stack_chk_failunlinkputchariswprintstrtoldtowupperabortstrpbrkgetpidkillimaxdivstrdupstrftimeiswalnummkstempiswlower__ctype_get_mb_cur_maxendpwentstrtolisattystrchrnulstrtoumaxfgetsgetppidwcschriswctype__mbrlensetitimersigemptysetgetaddrinfomemsetlocaleconvstrstr__errno_locationtcsetattrchdirconfstrendgrentmbsnrtowcsmbtowcttynamedup2clearerrfstatunsetenvwctob__fprintf_chksigaddsetiswupperputenvwcswidth__sigsetjmpstdoutfputcmktempgetrusagefputsstrnlenlseeksetresgidmemcpyfclosepselecttcsetpgrp__memmove_chkwcscmp__vsnprintf_chkkillpgstrcatumaskstrcasecmpsetpgidgetpeernamembsinit__strncpy_chkgetgidtzsetnl_langinfoopendir__libc_current_sigrtmax__ctype_b_locsetresuidregcompstderrwcwidthsigdelsetioctlgroup_member__snprintf_chkgetgroupsgetuidreadlinkgetegidsetrlimit__fpurgestrncasecmpfilenogethostnamegetcwdfwriteiconv_closegettimeofdaysigactiongeteuid__memcpy_chksigismemberlocaltimestrchr__vfprintf_chkstrtoimaxiconvfdopenqsorticonv_opentcgetattr__ctype_toupper_loc__strcpy_chk__ctype_tolower_loc__cxa_finalize__libc_current_sigrtminfreeaddrinfosetvbufwcscollfcntl__sprintf_chkwcsdupgetrlimitgetdtablesizewmemchrmemmoveendserventbindtextdomaingetrandomfaccessat__asprintf_chktcgetpgrp__libc_start_mainferrorstpcpywcslenstrcollwcsncmpsysconfgetserventwctomb__environlibreadline.so.8libdl.so.2libc.so.6sigwinch_sighandlersh_modcaseparse_shelloptsstrvec_searchparse_stringprotected_mode__libc_csu_finisearch_for_commandxdupmbstowcsshell_glob_filenamesourcenest_maxuitosclean_itemlistutf8_mbsmbchardeclare_doccount_all_jobscommand_word_completion_functionxwcsrtombswcsnwidtharray_dequote_escapesfind_variablecoproc_activedefault_columnsrunning_trapbreak_docjobs_docutf8_mblendirspellcoproc_fdrestorefmtulongshopt_setoptarray_dispose_elementset_shelloptspop_argslastpipe_optno_exit_on_failed_execshould_ignore_glob_matchesduplicate_buffered_streambashline_resetgetifsexecuting_builtinall_digitstempvar_listcompletions_to_stringlistget_current_prompt_leveldiscard_last_procsub_childpat_substadd_or_supercede_exported_varshow_name_attributestop_level_maskbash_initialize_historyunbind_variable_norefthe_printed_commandadd_unwind_protectvar_lookupfd_ispipesave_proc_statusno_symbolic_linksstrvec_from_word_listexecute_array_commandexpand_string_unsplit_to_stringreset_mail_timerthe_printed_command_except_trapset_default_localemake_while_commandassoc_patsubexecuting_line_numberlocalvar_unsetcheck_dev_ttyreset_shell_optionsbuffered_ungetcharyynerrscleanup_the_pipelineu32tocescwmatchlenread_tty_cleanupdispose_function_def_contentsrestricted_shellterminate_immediatelyhash_doczwritearray_shiftsignal_is_trappedbash_tilde_expandulimit_builtinlogout_docget_dirstack_from_stringzmapfdselect_docwdcachegather_here_documentswaiting_for_childprint_rlimtypedstacktrim_pathnamerun_debug_trapclose_fd_bitmapbreak_builtinlocalvar_inheritfind_variable_for_assignmentsv_histtimefmtclose_buffered_streambash_getcwd_errstrbreakinghistory_lines_in_fileglob_starconvert_var_to_arraybash_copyrightsubshell_envpremember_mail_datesfg_docbuiltin_errorbuiltin_addressremove_backslashesfree_mail_filesparser_errormake_variable_valueSBcommand_errstrcoproc_fdchkmailstatexpand_words_no_varsu32cconvit_arrayvarsglob_patscan_wcreader_looplocal_exported_variablessh_syntabsizcoproc_flushmake_commandlocal_builtinhostname_list_initializedfind_path_fileassoc_insertfile_existszcatfdsv_execignorecaller_docexpand_words_shellexpwhich_set_flagsifs_firstcstrcreplacecaller_builtinbind_keyseq_to_unix_commandexecute_variable_commandassoc_to_kvpairbuiltin_warningexit_immediately_on_errorfind_string_in_alistpush_contextjssigint_sighandlerprimary_promptredirection_expandhash_builtinshell_initializedsh_contains_quotesset_compatibility_optstt_setnocanonfg_percent_docbash_logoutclose_buffered_fdttrestoreifs_cmapdisown_builtinfind_or_make_array_variableglob_patscanarray_remove_quoted_nullssh_statcontinue_builtinglob_ignore_casestrlist_resizecoproc_setvarsbgpidsfind_variable_norefdisable_priv_modefalarmarray_rshiftnext_pending_trapshell_version_stringxbcopystrlist_flushposix_readline_initializeprint_arith_commandtest_commandsuspend_builtinfnx_tofswait_intr_flagundo_partial_redirectsis_basic_tableassoc_expand_oncecoproc_fdsaveexpand_prompt_stringgrouping_braces_docxtrace_resetqueue_sigchld_trapexpand_and_quote_assoc_wordset_sigint_handlerno_empty_command_completionbase_pathnamealloc_word_descdefault_buffered_inputset_trap_stateaddtimevalmake_coproc_commandarray_expand_indexalias_expand_wordsecondary_promptunbind_unix_commandarray_modcaselist_stopped_jobsstring_list_dollar_starpop_var_contextenable_hostname_completionpush_scopemaybe_make_export_envarray_shift_elementcopy_function_def_contentspush_streamevalnest_maxget_minus_o_optsecho_builtinsh_optoptbuffered_getcharreturn_EOFcurrent_fds_to_closebg_doczgetlineexit_builtinlet_docskip_to_delimsignal_is_specialnotify_and_cleanupmake_wordbuiltin_docdot_found_in_searchtermsig_sighandlerlocale_mb_cur_maxread_commandflush_temporary_envttfd_cbreakbuild_versionexit_docsaved_command_line_countcurrent_command_line_countcopy_command_edataexpand_word_unsplitdo_word_assignmentfind_shell_builtinmake_bare_wordsetup_glob_ignoreread_secondary_lineshell_eof_tokendircomplete_expand_relpathcurrent_readline_lineinitialize_readlinecopy_function_defpopd_docsh_quote_reusableyyerrorget_locale_varunset_bash_inputreturn_catch_valueprint_unix_command_mapassoc_dequote_escapesyyparsewait_for_jobsv_strict_posixarray_patsubmake_if_commandit_runningexportable_function_nameshow_localname_attributesdispose_partial_redirectstimes_doclegal_alias_namesh_regmatchtrapped_signal_receivedarray_expand_oncecurrent_command_first_line_saveddispose_function_defsh_setclexecall_visible_functionsfirst_pending_trapsubshell_levelparse_bashoptsbash_badsub_errmsgcomplete_builtinlist_stringungetc_with_restartexpand_and_quote_kvpair_wordseedrand32set_signal_handleralready_making_childrenlast_made_pidzreadintrword_splitprocsub_waitallfind_special_builtinsh_optindwait_for_background_pidswordexp_onlyget_original_tty_job_signalssh_eaccessimportable_function_nameshell_compatibility_levelsv_shcompatquote_string_for_globbingsv_mailwith_input_from_stringforce_execute_filelcurrentmake_local_array_variablebind_int_variableset_login_shellpushed_string_listifs_varfind_user_commandsh_realpathfmtumaxarray_to_assignpcomp_curcmdnohup_jobset_maxchildset_working_directorylast_command_exit_signalshell_is_restrictedmake_function_deftimes_builtinshell_ttysh_backslash_quotestrlist_printsave_bash_inputfind_global_variable_last_namerefset_signalmaybe_set_sigchld_trapinitialize_shell_optionshash_disposeget_name_for_errorlocale_decpointfind_index_in_alistdouble_quotes_inhibit_history_expansionreadonly_builtinassign_array_elementdescribe_pidunwind_protect_memget_working_directoryset_if_notfail_glob_expansionlocaletransassign_array_from_stringdivtimevalfind_procsub_childsv_optindsh_getopt_save_istatereturn_docsv_opterrterminate_stopped_jobsdircomplete_expandset_default_locale_varssv_funcnestsv_comp_wordbreakscommand_string_indexsh_backslash_quote_for_double_quotespcomp_curcsttnocanonsh_nojobsuntil_docset_pwdfind_function_defphash_removeoptimize_forku32resetgen_compspec_completionsbuiltin_bind_variableuwcachesource_builtinkill_all_local_variablesnamed_function_stringtt_setonecharprocsub_pruneset_pipestatus_arrayget_numeric_arginternal_warninghash_copyexpand_string_to_stringtt_setcbreaklist_minus_o_optsfind_tempenv_variablesubshell_top_levelfind_shell_variablesh_erangepop_contextrestore_sigmaskno_longjmp_on_fatal_errorwith_input_from_streamexpand_stringassoc_to_assignreturn_catchit_jobsarray_quotenetopenstring_list_dollar_atit_keywordsarray_disposemaybe_set_error_trapoptimize_shell_functionglob_vectorchange_flagsv_childmaxtrap_docit_helptopicsunset_builtinparser_in_command_positioninitialize_shell_builtinsdequote_listfind_variable_tempenvinit_bash_argvbind_functionunbind_funcglob_asciirangeexpand_word_leave_quotedset_signal_ignoredbashline_reinitializebuiltin_helpprint_commandparse_symbolic_modextrace_fpinitialize_signalsstring_rest_of_argssignal_is_pendingsignal_namesps2_promptEOF_Reachedsv_terminalmake_new_array_variablesourcenestword_token_alistcheck_identifiersuppress_debug_trap_verbosemake_until_commandcommand_connectbash_add_historyget_current_flagsttfd_noechothe_printed_command_sizeunquoted_glob_pattern_preset_shopt_optionspush_var_contextmake_cond_commandsccs_versionsh_syntaxtabprog_completesprogramming_errorsave_pipestatus_arraysubstringjob_exit_signalnew_var_contexthash_stringfind_in_pathunlink_fifo_listhistory_lines_this_sessionsh_physpathjob_exit_statusprogcomp_removesh_mktmpfdsource_searches_cwdclear_string_list_expanderset_job_controlget_word_from_stringprint_var_valuemap_overline_number_for_err_trapset_sigchld_handlerset_jobs_list_frozenreinit_special_variablesfc_execute_fileunbind_function_deflogout_builtinprint_shift_errorfifos_pendingps0_promptcopy_fifo_listexport_builtinopen_buffered_streamhup_on_exitcoproc_listreset_signal_handlersit_userspush_argsstrvec_mcreateinitialize_shell_variablesset_impossible_sigchld_trapskipsubscripttempenv_assign_errorecho_docphash_flusharray_from_word_listarray_copywait_docextract_arithmetic_substyy_input_namekill_current_pipelineeval_builtindircomplete_spellingu32toutf16wcdequote_pathnamediscard_pipelinefind_variable_nameref_for_createconvert_var_to_assochist_verifyinternal_wstrmatchfind_variable_no_invisiblemaybe_execute_filestrvec_strcmprestart_job_controlconf_standard_pathfilter_stringlistreap_procsubscompspec_copycompgen_docmakunboundphash_searchthis_shell_functionhistory_expansion_inhibitedinterrupt_immediatelyarray_removedequote_wordminus_o_option_valuesync_buffered_streampwd_builtinabsolute_programhistexp_flagprogcomp_disposettfd_onecharrun_trap_cleanupget_group_arraydecode_prompt_stringnameref_transform_namemail_warningifs_is_nullarith_for_docxtrace_initstatic_shell_builtinsset_current_prompt_levelmake_bare_simple_commandsh_double_quotesubshell_argvzresetcurrent_readline_line_indexeof_encounteredumatchlenclear_dollar_varsassoc_quote_escapesdot_docread_but_dont_executephash_createsource_fileline_isblankhash_sizeloop_levelcdable_varsprivileged_modeifs_valuemaybe_set_debug_trapbuiltin_usagecheck_signals_and_trapsexecutable_fileexpand_assignment_string_to_stringbind_var_to_intshell_nameremove_aliasset_directory_hookall_array_variablesgive_terminal_tojust_one_commandtrap_saved_exit_valuearray_create_elementwait_for_any_jobcommand_errorallow_null_glob_expansiontrue_docgetcoprocbypidassign_array_var_from_word_listmake_new_assoc_variabledebugging_login_shellget_new_window_sizesh_mktmpfppipefail_optwith_input_from_stdinpush_tokenbuiltin_builtinwant_pending_commandps1_promptinterrupt_statesigterm_sighandlerreturn_builtinrestore_funcarray_statedisplay_signal_listxtrace_fdcopy_word_liststring_list_internalcompspec_createttsaveredirection_errorrestore_pgrp_pipeset_var_attributecomplete_docread_docdispose_variablevariable_contextrun_sigchld_trapstrlist_createcoproc_wclose__data_startstrlist_to_word_listmake_group_commandset_minus_o_optionexecute_shell_functionwait_signal_receivedset_bash_input_fdhash_walkclear_hostname_listwait_builtinset_buffered_streamstrvec_to_word_listrun_unwind_framedispose_commandclear_fifointernal_strmatchextract_colon_unitpromptvarscompspec_disposeprocsub_searchstrlist_walkkill_docsh_notbuiltinplace_keywords_in_envexpand_string_assignmentassoc_quoteshellstartdo_redirectionssh_invalidoptnameextract_command_substdisallow_filename_globbinginitialize_job_signalsprint_timevalcolon_doctimeval_to_cpuexec_argv0it_hostnamescoproc_initset_pipestatus_from_exitmatch_pattern_wcharkill_pidtest_builtinhist_last_line_addedfree_pushed_string_inputadjust_shell_levelupdate_export_env_inplacesv_ifspop_dollar_varsmaybe_set_return_trapxtrace_setcoproc_closeallfunction_trace_modeinvalid_envsh_opterrit_commandsxparse_dolparenrestore_original_signalssh_coprocbrace_expansionexpand_wordssub_append_stringttgetattransicstrunbind_namerefquote_globbing_charsinit_yy_iodo_assignmentreset_mail_fileszreadcshopt_docdump_po_stringsrunning_in_backgroundshift_docparse_and_execute_cleanupsubshell_exitzreadgetmaxgroupslast_random_valuereset_terminating_signalsword_list_remove_quoted_nullsposix_initializefind_variable_last_namerefbind_docenable_doccompopt_builtinset_original_signalglob_dirscanbash_history_disableposparam_countsubshell_environmentprintf_docdispose_fd_bitmapwithout_job_controlinternal_informget_array_valuestrip_trailing_ifs_whitespacemaybe_call_trap_handlerunlink_all_fifosshell_start_timeprompt_string_pointertypeset_docexec_builtinforced_interactivemalloc_trace_at_exitphash_insertsource_uses_pathindirection_level_stringnum_posix_optionslist_all_jobsenable_builtin_IO_stdin_usedstrvec_lenstream_listsh_mktmpdirsh_un_double_quotealrmbufasynchronous_notificationdelete_all_contextsset_locale_varpatch_levelsignal_namemake_funcname_visibleabsolute_pathnameappend_processget_all_original_signalslast_asynchronous_pidpcomp_curtxtassoc_to_word_listyychargetopts_docit_aliasesarray_variable_namearray_to_kvpairlocal_docprint_array_assignmentcoproc_pidchkset_dollar_vars_unchangedsh_validfdstring_to_rlimtypestrvec_mresizecommand_substitutemaybe_make_restrictedfunction_docerr_unboundvarit_directoriessh_badjobreset_completer_word_break_charsarray_quote_escapesunbind_argscoproc_closelist_rest_of_argsbash_directory_completion_matchesexpand_arith_stringcurrent_readline_promptliteral_historystrsubinteractive_shellwhile_doceof_encountered_limitclean_simple_commandsbrandarith_docsh_closepipearray_assign_listasync_redirect_stdinerrexit_flagsh_invalididcheck_hashed_filenamessh_exitstrlist_appendsys_errordispose_redirectsprogrammable_completionskvpair_assignment_pmake_command_stringunfreeze_jobs_listset_procsub_statusifs_firstcharsuspend_docdispose_word_descassoc_replacesave_parser_statemake_absolutecurrent_prompt_stringarray_walkmake_arith_for_commandglob_always_skip_dot_and_dotdotread_tty_modifiedgetmaxchildbash_tilde_find_wordsh_badpidstrvec_copysh_getoptarray_to_word_listsh_mbsnlenassoc_flushcase_docfsleeptrap_to_sighandlermapfile_builtinshow_local_var_attributesget_variable_valuedump_translatable_stringswait_sigint_cleanupuinttostransiexpandsignal_in_progressdispose_wordsget_shopt_optionscompgen_builtinassoc_removetimeval_to_secsdollar_dollar_pidget_dollar_var_valuevalidate_inherited_valueno_line_editingcurrent_tokenbinary_testassoc_keys_to_word_listset_default_lang__libc_csu_initneed_here_docfind_variable_notempenvinternal_errorparser_save_aliasjobs_builtinfile_isdirrun_pending_trapsifs_firstc_lencompopt_docbash_execute_unix_commandfull_pathnamesetup_ignore_patternslist_one_jobtype_builtinmatch_ignore_casepop_scopeansic_wshouldquotemaybe_append_historybash_re_editassoc_disposeshow_all_var_attributesseedrandmake_default_mailpathdelete_all_jobscurrent_command_subst_pidhave_unwind_protectssigalrm_seennum_fifosit_disabledsh_invalidoptprocsub_deleteget_string_valueeval_docbash_history_reinitget_original_signaldisown_docstrvec_createexec_docget_exitstatsave_input_line_stateinit_job_statsmark_modified_varshistory_reeditingsave_bash_argvvalid_array_referencecurrent_userfalse_builtincdspellingstring_list_pos_paramsall_exported_variablesput_command_name_into_envget_urandom32sh_invalidsigsetup_history_ignorearray_insertttnoechobind_builtinquote_rhscurrent_command_numberdirs_builtinfalse_docenable_history_listarray_keys_to_word_listit_builtinscommand_execution_stringset_or_show_attributesbind_variable_valueassoc_remove_quoted_nullscurrent_builtincond_expand_wordrun_return_trapposixly_correctdelete_varglobal_variablesit_functionsfind_global_variablereport_errorsh_openpipexstrmatchutf8_mbscmpprint_func_listcheck_bash_inputunwind_protect_tag_on_stackarray_dequoteremove_quoted_escapesmake_select_commandsigwinch_receivedremove_quoted_ifsttattrset_ppidtime_to_check_mailxpg_echoxtrace_print_word_listfile_iswdirerror_trace_modeprogcomp_aliasit_servicestrap_listlist_running_jobslet_builtintype_docexport_docsh_neednumargexec_redirection_undo_listprogcomp_searchprintable_filenamesv_history_controlsh_getopt_dispose_istateglobal_commandwlcacheassoc_to_stringjobs_m_flagpop_streamit_signalswcsmatchcmd_initshow_func_attributescoproc_checkfdstrvec_sortmk_msgstrwextglob_pattern_pttonecharfind_aliasalias_expandzreadretrypath_dot_or_dotdotbind_array_variableulimit_docreset_internal_getoptremember_on_historyglob_error_returnprogcomp_flushutf8_mbschrsh_makepathprogcomp_insertstrvec_posixcmpdispose_saved_dollar_varsinitialize_job_controlautocdrestore_pipelineit_variablescolon_builtinerr_readonlyxtrace_print_assignmentbash_delete_history_rangefc_builtinmerge_function_temporary_envinteractive_commentsxtrace_fdchkrun_interrupt_trapmake_simple_commandfile_statuslocale_shiftstatesfind_variable_namereflist_reversesv_xtracefdpretty_print_loopstring_quote_removalbash_licensenohup_all_jobsreading_shell_scriptperform_hostname_completionclear_unwind_protect_listjump_to_top_levelquote_compound_array_listany_signals_trappedxtrace_print_for_command_headterminate_current_pipelineset_tty_statecomsub_ignore_return__bss_startxtrace_print_arith_cmdu32tocharxtrace_print_select_command_headunalias_docarray_variable_partfind_global_variable_norefsetup_async_signalsshow_shell_versionfuncnest_maxstream_on_stackset_current_flagstilde_initializeit_enabledbg_builtinhistory_numberpre_process_linereadonly_doclist_optarginitialize_trapscopy_redirectssv_histcharsumask_builtinmake_pattern_listshopt_builtinno_optionstteightbitcurrent_command_line_commentbuiltin_ignoring_errexitlist_optoptdelete_all_aliasesif_doctest_bracket_docrestore_parser_statereturn_catch_flagpcomp_lineclose_pgrp_pipemake_array_variable_valuesh_getopt_alloc_istatecommand_oriented_historyget_current_user_inforeap_dead_jobssave_token_statepcomp_set_readline_variablespwd_docsh_mktmpnamebegin_unwind_framestrlist_removerelease_statussv_histsizeisnetconnsplit_at_delimsarray_createmake_builtin_argvset_var_read_onlyarray_unshift_elementinitialize_bashoptsexecute_command_internalterminating_signaltime_docgetcoprocbynamemultimevalinitialize_bash_inputumask_docmake_subshell_commandcd_docclose_new_fifosu32toutf8strlist_prefix_suffixsv_globignorefind_reserved_wordsv_tzfind_token_in_alistlast_history_linenchars_availparse_and_executeprint_var_listreadarray_docansic_quotearray_to_argvread_from_stdingnu_error_formatsh_chkwritemaybe_save_shell_historystrvec_flushttsetattrmake_here_documentcoproc_disposeshell_script_filenamehistory_docxtrace_print_cond_termget_current_optionsprocsub_waitpidhashing_enabledttfd_nocanonclear_fifo_listparser_remaining_inputsave_pgrp_pipedont_save_function_defscheck_signalsbuiltin_address_internalcoproc_rclosecheck_selfrefutf8_mbsnlenfc_docignore_signalshift_builtinstrvec_resizeshift_argsget_random_numberbash_history_enablemake_case_commandnameref_invalid_valueevalexparray_keyspolite_directory_formatdirs_docdeclare_builtinexecutingfd_is_bash_inputcopy_redirectfree_trap_stringsvalid_nameref_valueset_posix_optionsinvalidate_cached_quoted_dollar_atset_signal_hard_ignoredecho_input_at_readmove_to_high_fdstrlist_disposemake_arith_commandnoglob_dot_filenamessetifsstupidly_hack_special_variablesshell_function_defsshow_var_attributesmatch_pattern_charclear_shell_input_linethis_shell_builtinload_historycheck_add_historycontinuingstdin_redirectsfg_builtinprint_assoc_assignmentsubst_assign_varlisttermsig_handlerforce_fignoreexit_shellsh_badoptsv_hostfilearray_to_stringindirection_levelhash_bucketlast_command_subst_pidstrlist_sortsave_pipelinelast_shell_builtinit_exportscontinue_docparse_and_execute_levelstrip_trailinginitialize_itemlistextended_quotebuiltin_unbind_variableis_directoryloptenddispose_used_env_varsmapfile_docassoc_dequotevar_attribute_stringcopy_wordtest_unopreset_readahead_tokenstrvec_removeparser_expanding_aliasarray_needs_makingit_filesparse_commandterminal_pgrpcheck_binary_filerun_unwind_protectslegal_numbersh_setlinebufmake_word_from_tokenit_stoppedreset_parserbrace_expandchar_is_quotedlocaleexpandfrom_return_trapprintf_builtinforce_append_historyunset_sigwinch_handlerremember_argsutf8_mbstrlensigterm_receivedset_bashoptsprogcomp_createprint_cond_commandexpand_compound_array_assignmenttt_seteightbitcoproc_docset_current_optionssh_wrerrorinit_mail_datesrun_exit_trapcan_optimize_connectiongetopts_builtindispose_wordtest_binopsh_contains_shell_metastop_level_cleanupdispose_var_contextcurrent_host_namedispose_cond_nodethis_command_namelocale_utf8localecoproc_unsetvarssh_restrictedhere_doc_first_linemake_word_flagsend_job_controlunbind_array_elementbashline_set_event_hookassoc_modcasesignal_is_hard_ignoredset_itemlist_dirtystrlist_from_word_listit_groupsread_builtinget_directory_stacklist_opttypedecode_signalnoclobberuser_command_matchesassign_array_var_from_stringyylvalmitosinput_availdo_assignment_no_expandchkexportsubshell_argcexpand_string_unsplituwp_initbash_brace_completionsv_localeset_dirstack_elementzsyncfdrunning_under_emacspushd_docbind_global_variableall_variables_matching_prefixsh_optarg_getenvit_setoptswait_intr_buftvlist_indevalstringerr_badarraysubexecute_commandbash_delete_last_historysame_filetest_docmake_local_variableassign_compound_array_listcheck_jobs_at_exitset_exit_statusread_octalpidstat_tabledelete_all_variablesassigning_in_environmentunclosed_pairunalias_builtinprogcomp_walkset_langttcbreakget_job_specskip_to_histexpthrow_to_top_levelsetup_exec_ignoredescribe_commandassoc_referenceextract_array_assignment_listsourcelevelsource_docmake_redirectionsort_variablessh_mkdoublequotedget_job_by_piddifftimevalstrvec_disposepcomp_indset_dollar_vars_changedhangup_all_jobsfind_flagpretty_print_modeexecuting_listshould_suppress_forkignore_tty_job_signalsuconvertevalnestverbose_flagglob_char_ppush_dollar_varsunbound_vars_is_errorcheck_window_sizebash_clear_historypipeline_pgrpother_token_alistbash_input_fd_changedinitialize_aliasesprint_var_functionexecuting_command_builtinbash_readline_initializedsh_needarghist_last_line_pushedhave_devfdunset_docpushd_builtinsv_ignoreeofmake_for_commandfile_errorget_alias_valueno_argsde_backslashoriginal_pgrpxtrace_print_case_command_headinitialize_flagsecho_command_at_executeurandom_closelist_lengthalias_expand_allremove_unwind_protectarray_flushnumber_of_argsexpanding_redirdelete_jobtrap_builtinhelp_builtinget_job_by_nameudequote_pathnamesh_ttyerroroptflagscommand_docdebugging_modebash_servicename_completion_functionclear_pending_trapsbashline_reset_event_hookrestore_input_line_statethe_current_maintainerrun_error_trapget_hostname_listextended_globsv_pathcoproc_allocprint_simple_commandrestore_token_statemake_cond_nodeansic_shouldquotemake_word_listspnameget_tty_stateconditional_doclegal_identifiervariable_help_docstop_making_childrenwait_forprocsub_addnew_fd_bitmapthe_current_working_directorystop_pipelinestart_pipelineassoc_subrangesv_histignoreextract_process_substsave_posix_optionsfd_to_buffered_streammaybe_add_historyit_shoptslast_command_exit_valuearray_sliceparser_will_promptall_shell_variablescheck_unbind_variablesh_canonpathgetopts_resetexecutable_or_directoryhistory_builtinshell_pgrpparse_string_to_word_listget_group_listfind_functionstrlist_mergebash_dequote_textunary_testhistory_delimiting_charsarray_subrangeall_visible_variablescoproc_fdcloseoptimize_subshell_commandinherit_errexitsh_getopt_restore_istateprog_completion_enabledpcomp_set_compspec_optionscomplete_fullquoteprogcomp_sizemake_childstartup_stateget_posix_optionsbash_groupname_completion_functionstrlist_copysh_notfoundzreadcintrall_shell_functionsreset_shell_flagsmake_local_assoc_variablecoproc_reapdefault_tty_job_signalsshell_execvestart_jobsignal_is_ignoredxmbsrtowcsnum_shell_builtinscd_builtinpopd_builtintt_setnoechoglobal_error_listwith_input_from_buffered_streamstdin_redirttfd_eightbitwait_for_single_pidfree_buffered_streamsh_invalidnumifs_is_setinitialize_terminating_signalsassign_in_envdist_versionbind_assoc_variablemap_over_funcsconnect_async_listsh_readonlyprocsub_clearmerge_temporary_envfnx_fromfsbash_delete_histentzreadnfind_variable_nameref_for_assignmentit_bindingssh_getopt_restore_stateunlink_fiforestore_default_signalbash_default_completionparser_restore_aliasrestore_pipestatus_arrayexpand_aliasesbash_argv_initializedadd_aliaskill_builtinline_number_basedispose_exec_redirectsdequote_stringshopt_listoptdiscard_unwind_frameGLIBC_2.2.5GLIBC_2.25GLIBC_2.11GLIBC_2.14GLIBC_2.8GLIBC_2.33GLIBC_2.15GLIBC_2.4GLIBC_2.3.4GLIBC_2.3        ui s  s s sii sstii tti tii $tui s+++`R +b +b +c +c ,c (,8,H,X,h,Wx,h,,l,,T,\,,|,t-p-V(-8-LH-`X-dh-P-hz -0z -8{ - z -y -A| - - - -؏ -( . .x . 0.Р @.p P.X `. p. . . .P . . .( . . / /0 /p 0/ @/0 P/ `/ p/ / / / /@ / /P /P / 0 0p 0 00 @0 P0p `0 p0 0 0 0# 0 ) 0x+ 0. 0/ 00 14 1(5 15 01H8 @1? P1@ `1D p1H 1pJ 1J 18Q 1S 1S 1@T 1T 10V 20\ 2] 2p_ 02x` @2Pa P2h `20i 2 2ȏ 2Տ 2 2 2 2 3ڏ 3 03 P3$ X3 p36 x3 3F 3Q 3[ 3e 3_ 3z 4 4 04 84͏ P4 p4 x4 4Ð 40 44 4 4 5 5Ș 5Ϙ 05ט `5 x5n 5 5 5 5) 5 6x 6O 86E P6; h6 6 6 6%{ 6r 6 6 7 (73x @7 X7Ai p7 7b 7 7̚ 7ؚ 7ޚ 7 7 7 7 8 82 8 8~ 8 (8o 08 @8x P8`81 p881 881 88y 881 8hP91 9 91 09@91 P9`92 p992 992 992 9hP9@{ 9\:ӓ :t :, 0:`:Wh:up:x:D:Z: : :>1 ;` ; ; @;7 h;@ ;J ;R ; ;[; <r] < < 0<] @<WX<r <z < < < = 0=xTH= p= = = = =H>2 >(> 8>Ȍ `>ӓ >} >` > >ӌ ?Z ?L?a ?tT0? 8?4XH? P?8X`?Ǒ h?Wx?ё ?P?ۑ ?(W? ?[? ?\? ? ?[? ? ?[@ @ @[@ @ (@[0@ 8@ @@[H@ P@& X@[`@ h@/ p@,\@B @T@ @L @T@U @Q@] @pX@f @@u AA` A~ A|Q(A 0AxP@A HADXA `A0\pA xAuA AxQA AAʒ ATAՒ ATA A|TB B4\BP B BT0B 8BDHB PBWXB `B' hB@xB0 BTB8 BdBI B`B1 B\B BX BFBa BTCy C\ C (C8C @CDPC XCh^hC pCXC C|PC CXC C͓ CZCۓ CuC CdXH I IhJ J K KE KL M@N0k N NPPhP0 P)7 P,7 P/7 P27 PN7 PG7 P57 P87 Q;7 Q?7 Q>7 0QB7 @QF7 PQJ7 `QM7 pQ QQ7 Q:6 Qn] QK7 QH7 QT Q\ Qw R<7 R*l RT 0Rg @R/h PRT7 R6 R6 R6 R6 R\7 R2~ R6 R_7 Sc7 Sj7 Sp7 0Sv7 @S6 PS1 `S; pSÏ S\ Sw S֚ Sy7 Sw S|7 S0 S0 `T] hTpT] xTTe^ TPT^ TPTo^ TT] TTO^ TT|] TpTz^ T T] TU^ U U] U U^ (U0U[ 8U@Uh] HUPU^ XU`U^ hUpU^ xUU^ UU^ UU^ UU^ UU^ UPU] UPU^ UPU\ UVX VVtz V@ V0 (Vp0Vt 8V@V^ HVPV^ XV`V^ hVpV_ xVVp6 V@DV_ VVr] VW@)Wt Wt Wt W$t W,t W3t W;t WCt XJt XQt XYt Xat Xit (Xqt 0Xyt 8Xt @Xt HXt PXt XXt `Xt hXt pXt xXt Xt Xt Xt Xt Xt Xt Xt Xu X u Xu X!u X*u X5u X@u XKu XVu Yau Ylu Ywu Yu Yu (Yu 0Yu 8Yu @Yu HYu PYu XYu `Yu hYu pYv xYv Yv Y'v Y2v Y=v YHv YSv Y^v Yiv Ytv Y}v Y\ Yv ZO^ \] \p@\ \o^ \ \ ^]^a_@_H_Pa_a_``[H```_`0[a]Hap]aZaZbYHb_bP]b]g g g (g08g`2@gHk Pg'u XgPhgP2pg/u gBy g g@2ghk gLu gg02gRu g\u gg 2heu h h@(h20hl @hru HhXh2`hyu ph^ xhh1hu hu hh1hu h hh1h iu ii1 iu 0iu 8iHi1Piu `i hixi1i(l iu ii1iPl iu ii1il iu i jp1jl j (j8j`1@ju Pju Xj hjP1pjl j6 jj@1ju ju j j01jm jY j j 1k0m k k (k10kv @k Hk Xk1`kv pk xk k0kpm kW k@# k0kv kW k$ k0k)v l̑ l% l0 lm 0ly 8l@. Hl0Pl;v `l hl; xl0lm l i lE l0l@n lUv l@H l0lxn l\v l0K mp0mn m6 (mP 8m`0@mav Pmsv Xm0k hmP0pmn mi m m@0mxv mnz mp m00mho m\ m m 0no nO np (n00no @nv Hn Xn0`no pnv xn n/nv nv n n/nv nb n n/nv o o o/ ov 0ov 8o Ho/Pov `o-l ho xo/ov ov op o/ov oh o@ o/o0p ob o pp/pw p#w (p 8p`/@pXp Pp*w Xpp hpP/pp0w pGw p p@/pLw p_7 p0/pp peU p /qp qc7 (q/0qp @qÏ Xq/`qiw pq2~ q.qq q6 q.qXq qj7 q.qq rp7 r. rq 0r|7 Hr.Prr `r; xr.r(r r|w r.rw rw r.rw rw sp.sw sw 8s`.@sw Psw hsP.ps`r sw s0b s@.sw sx s^ s0.sx sۘ sY s .tx t3x t (t.0tr @t9x Ht Xt.`tr pt xt( t-tr t@x t, t-ts tHx t 1 t-t(t uPx uQ u- uXt 0uXx 8uQ Hu-Put u\ ul v| v v 0v @v Pv̞ `v pv8 v v v v` v v v$ v w0 w w< 0wH @wT Pwd `wt pw w w w wğ wԟ w w w x x x, 0x< @xH PxX `xd pxt x x xh x xأ x x@ xh y y y( 0yP @y Py `yx py̠ y y y y y y, y@ yP z` zx z 0z @z Pzȡ `z pz zإ z z@ zp z z z( zx { { {8 0{h @{ P{ `{ p{H { {Щ { { {$ { { | | | 0|# @|-^ P|' `|- p|0 |: |L |= |T7 |@ |C |P |S }] }` } 0}p @}s P}w `}{ p} } } } } } } } } ~ ~[ ~ 0~ @~ P~ `~ p~Gt ~~ ~ ~ɛ ~؛ ~ ~ ~ ~  # 5 0> @H PN `U p\ b g n   x g }    0 2 @ P ` p    ǜ ٜ Ѐ    # 8 0C @U P` `m px      EFFFF F(F0F8F @F HF PF XF `FhFpFxFFFFFFFFFFFFFFFF F!G"G#G$G% G&(G'0G(8G)@G*HG+PG,XG-`G.hG/pG0xG1G2G3G4G5G6G7G8G9G:G;G<G=G>G?G@GAHBHCHDHEh\E HF(HG0HH8HI@HJHHKPHLXHM`HNhHOpHPxHQHRHSHTHUHVHWHXHYHZH[H\H]H^H_H`IaIbIc Id(Ie0If8Ig@IhHIiPIjXIk`IlhImpInxIoIpIqIrIsItIuIvIwIxIyIzI{I|I}I~JJJJ J(J0J8J@JHJPJXJ`JpJxJJJJJJJJJJJJJJJJKKKK(K0K8K@KHKPKXK`KhKpKxKKKKKKKKKKKKKKKLLLL L(L0L8L@LHLPLXL`LhLpLxLLLLLLLLLLLLLLLLMMM M(M0M8M@MHMPMXM`MhMpMxMMMMMMMMMMMMMMMMMNNNN N(N0N8NHNPNXN`NhNpNxNNNN N N N N NNNNNNNOOOO O(O0O8O@OHOPOXO `O!hO"pO#xO$O%O&O'O(O)O*O+O,O-O.O/O0O1O2O3a8 08@!HPX|`px{0SВؒ=D^ K0:8@`hpHDȣУأ_3 u (,Y0k4@H*L`h p{KȤ (u0@5P`HHJ HtHH$H% %  %( % % % % % % % % % % AWAVAUATUSH8|$ H=Q Ht$1HT$ dH%(H$(1wN uHgE9g=H t>[N H53 1EG H5}/ H1gӂPM grG ;N tWH=N HtD H=N HtD H=N HtD HN HN HN N I N G N _J uN 9 fN lN u 19^N ‰ H=. g H  H= 3M t,  D$ H HD$H HD$ D$8L$ - D$89~L$8H = HX HU H H I D$43 QM  } u H38-u HH* H- 1M HP H- HP x r     8 :   @    $X gNH- H=  HL gIKH= g,<grg1H=7N  ?K  HD$ H HD$HHDHgyH ;-H 8suPhuu xu: H=w H HtA H- HC Hxg HHB H8 HY H-y1H= eD H H D$8D$9D$ DHcD$H HL$HL$H,H}-DeD$(HA-L52 dE1HL- @M.I AMAEA8uLHD uMcH2 ILxHL$HT$D$HLH^ H@HD$D$9D$ D$= D$8p= thg/1OH E#D$(H]AH@됀x}H) H jH) l$8 L5}. H\$ Hw H 9l$ HcLt6<-At'A-A-qH= =  l$8tЉ 1= H=C( @g= F  = t =K = t)HcD$8HL$HH HD$8D$8= H H= 4= t = =_ 1H= u+]H1HHx-H8@Hgg9 H= M< H   aggE=F  D$8H=H D$<b D$,E t-E= gXD$,2 D$4D$4D$< D$8H=& g@SH=& g3S=  H=r u=0 D%   u&H= Rt$8T$ 1H|$aD$8D$4  = T1D %3 =e # u H= g gH H=  tuH=n  = D-ig|$(G1H5% < HH1gxH= 1o78-u HH" P Bxc W= D$8;D$ t = Ot$8T$ H|$D$8H-9$ 1H5S| HgC Hg=R D$8;D$ t =C H= > T: H= g> 7: n=N > D ~ 4 u N N = iG I  )߃13: uH-.# 1H5H{ Hg8HgE_ -  D$,1g Ņ=g  uY=X tu = = u.=y vgoD$,I  tb= u֋O PF uH=*" g H묃=T u = = g=  tz= tq]  s  u=H= t@H=j D< g̨t = =, =' N u  [ PR H=-! g HH=5! g苕HkpHcD$8H|$PHljT$8T$ t$8H D$8)1H5! r8 DDH1gtH= 1S H=E! g<= u4H=B! g!H=8! gH=! gH= g=/ t@H= g;H= gH=? gaH= gvH= g\H=X gBH=# g+H=,? g1H5N# 7 LH1grL5n ML6 Hxg*|LH>5 1IH1< LAą6H=9 [4 L-, ML6 Hxg{LH4 H= H Ht4 H HgH=a gIHt@(LpH=G gIHt@(LxH=0 gIHt@(LhHLgMt,g:fHcgLIHgLL3 H LgoD.4 ÅuY1DH6 HtCL$PDL7 ƅtLgl11D5 Dg&< A1!4 = = Hv2  = =Q< g= H5 =1< g;= t'D$4  u=3 u => = =, += 9 = ]g}= t[H5 H= gP*p= H=} D$<;D$ u O H=} 6 ggS)#L3 HxgxLH1 1 8IALg pgv1@ǃ~\9 H=Q_ gH= HgH= IgHHH5 E1+: HAĀ}ez tr}dtMl j Et)}eu#H5 H 1 u < B =H5W H4 u H5= H4  É iMt&H5 LAf9 H9A}tt'}e t` }et, H56m L4 Aą뼺H5 H%0 uW H5 H3  LgE'"LgHHtDL(/ 1H16 AąI*4 ̾ 8 E'W/ Hgmg2~7 III= =CD u 7D B,D    < . Ht$@DD(H7 uD$X%=@t>D+Hg m<1H5 00 HH1gmgL HglgMgǍgas 1< t.gM1D]0 D<1 z7 gtʺH5) 1/ H1gNn g=h 1I^HHPTL H  H="1 H=h Hh H9tH- Ht H=h H5h H)HH?HHHtHe5 HtfD=5 u3UH=5 Ht H=V6 5 c ]f.ff.@gH=A u A 1grӼ 1;  k 1  %  @HR AVAUATAUHSL- H5 1- HH LML- H13 H5o 1- HH. H w H LH13 HKHuH5A 1L- HHH. H5\ 1,- HH(. HK H;HL-_ @H{0H0H?suL/ uLk L, Hxg&rLH:+ [IHI- IHMDIA}-t]L- HtH5h 1c, HLH12 L * EuH[]A\A]A^g1H5 I, LHHL 1<2 L% H5L 1+ HLH12 L% 1H5a + LHH11 H5 1+ HH11 H - H5| 1L+ HH1y1 H5 1%+ [H]HA\1A]A^%J1 f.9AWE1AVE1AUAATAHcUAD$S)HHHlH&fDgH1Hg IIH9t(H;MugrH1HgIIH9uMEt6Lg輙= LgF<DH[]A\A]A^A_IFH(H<* HxgzoHH( H= Hȸ Ht' IFH(H) Hxg;oHHO( I>H` g=W ^I>g5 FDJLgd5 &fS H=  gx& - # grgKY [úH5 1) H1gg Ht?uUg7HHt8u H]%& ]þHgHgH<-uGHE1 jD$ gD$ HA\grtfDL% LgHpHxHc@(Wu@K?BLgH4O)LH= gHI)AUATUSHg[ H uvE111ۋ1) uU3) u; Ԭ n' l' HD$HH|$g/HD$fAt1DH=/ g`H=S % tgF=. u5T H- HD$H  H t,H=C Ht gIHt 8L # H|$  g( u @ ,x Z -3 H A\@gDg荜g* H5[g0 D EHD$HtH|$g.HD$g^gD=R% g f1gH= g-Hp HD$tf.g6H5i H( H=Y  7ff.UH} D$  D$tGfDHg&HHthi D$D$ H4 g, ul1H=s#  uIu@H-  Ht HuT$u L D$fH]DH1]Ҩ tH ͨ Ht Hc@<H٨ Htt HH¨ Ðf.H HJH @zH 1H + z HH)He @ tV=+ )~MHcv H _ H5p H9rfDHH9 t t1-t=fD ;5x&H@HHuJHHu+1{t+wxH@1= |f.1-qff.@/!`;+xH@Hrg1=+ t${v1= u܋ -ÁH_^x Hs@f.USHHc Ht6fDHHH}Htk HEHt`HU HuH H[]fDUH- Hw Hxg[HH HHU t*HHHT(HD(H)fHH9t: t= HH5 1g'XH]% ff.fUSHH= Ht-fDHcy HH8zt Ha " KY$ %gʖH-w1H=p L gH= HP HHD H  giutHg#H- H H HHÍpHcg~ZHcӃH Hc Hs H=h =B gkH5g薾H;' H@=B# 1gDgrD H[]DH[]@H5 H= Ht OfDfSHgdtH9* t H9 t[f.&' tU1҉H5 gHt ]1H5 goHu Fn~HO HtH(HF HxgXH]H% {H HkH5 H]diKHc=ݢ ]rfDHɢ H'H]WkfDAVHAUATUSHuN= D EL% Mt A$H5 1E HH5PT = 1g]T5# uC t=" $[] A\= A]A^Bf. tԡ f.HHL%ɤ Mt A$u3= ,H5m1q H'fH y HcHcA44@u*ȃHA4DHA4Nv@ tDpKHcL-H݅A4@tLgHtA9t3HcAfAJŀv u HA9uDEtDLgmHHtX%uO@gUHA$EEH51: = HH1gVRH D EHgwu#H5DEjfH11gHH HA1DAUATUSH(H= dH%(HD$1H?H AH=H=  1H H-ڢ HgTHҢ oI9vH= LH)H HD$dH+%(H([]A\A]ÐHy AH=gH9y= | NE1t@HD$HD$:]HJ4/HL$1L) HHH1HumH *HSL9)# HH=! HkH/y:L?yHHL)gt7tEHcЃt*H u&HD$IHD$1rfIݸcI1VfD IH~H Il$I?H=@HD$fH= @HD$dH+%(uH= H(L[]A\A]%  + ff.ATAUH8SHgRHٟ D`HPH @4HP H HXHP( P0HtzH @4HKH H- 1Ht%}t}t}t HC []H: H7 A\ ffDH HH ff.fHH= Ht H=c  HGOHמ HG(HĞ HG H G0 ЃtЃ HH HGHt`' HfDf.HH=  Ht H H H H Hff.@AUMATIUHSHHH=  Htz Ht"H HxgOHH HH-l L-m L%n Ho H[]A\A]@HA H\HHDf.= t%Hؙ HufHHtxuÐLə H H5H= f.H HtHc <ff.fIHH5H=fIHH5nH=wfU@SHgN(H=1 HHpgT= HC8tK H C0H HH  t  H[]=Ҙ x1g&HC8UH-p Ht[HEHM UHu(H} LEHC =o t5E0H}4 Ht= H]%3 f ]@=B x( Hu8tD  Ey gtfD DǺ1DI = Hu8DH Hu fHHt9xuD1@HgM  P P P HfHt#c GV GI G  {ff.Hٖ 1Ht 1HzH8gqLH2 H' @HPH @4HP H H@HP(ՙ H֙ P0HT Hə H H5 H) @4Hff.fH= tff.@H Ht"@HPH9u HtH@HHuÐHA HtH) DH! Ht#H xH; sH@H`A Ë    ޕ =ؕ  D  ک ~fSH fD H;5 H g*| r HC%Q` V t [ff DH   t ͗  H={   tH= Ht'v H˗ H H H=V HtC H@   B  HHc] PO Hd HH|$H5 H|$H9 fDH9 H[]f. HH9 []=! (tƁuHfD= t=E fgڼt9H H5 Hc t uH@HH t tHi2|nH HDff.H Ht1H; ff.@H H HEH| HHj fAWAVAUATI0USHdH%(H$1HD$0gEED$A$HŅL AMAI\$d@HcD$Ht$PHcH9AAPI߉T$DlHcD$D E7I_EEA!uA\uEoAUDVH=HcH@H0H9sHHt$gDHHcD$AZPT$DHcD$Gf.A!UL1LHcg^IL{HHL$HT$LgI_HHcD$DE7 EE fo i L5֍ H׍ )ȍ   1ҾHD=o $gHI LgVLIg $D=; ѣ L5j Hk H$dH+%(HL[]A\A]A^A_A{Z@L$gBL$\IƈH@IELA!gBfD(IHgGkHI EfDHH|$,m D$/Hgp$AgNBIA3A)<$y$AFA#@Lt$ L H=g}LLt$0 HAd[AtATA@AAD$ED$0LW HxgALH IDl$gqAIAatAetL$Ar DAIAFcL5؊ L HxgALH1 IAhZ  L gILIB g@IAvHD W. 1L H HI H= L$gHH]LZ HƄAWLgxHL9tL: Lg L - Zg)I+ !IL5c M`Ly Hxg?LH Ig]HcgTZIDl$g|?L$IƋ*  =L5 #Dʈ@HL1HcgYI-  L9% $tL9% t1L9% ) $Hc<$gYIH=C L5W g  AHHtg軻IHg L@Lg>=ч I A= AF AFmH=ʇ g\IƋ u L}gnI:fDR j= tZA\IF$AAFAFtOHSDIH[0<H9uIƄ$L#eA\fDILl$ I_L LG HH$2 Hxgp=H $IAGL„uHHt<}uA8D+uA%XA@fELt$0LD$L¾L H|$Ilj$c EdD$0  LWgIIHLB $.H HH=ggD$Ht D88A/\/L IH!H IwLH H5 H0 L HL  Hxg;LH Ig;IA[$H¹ IAH3L $gL5 H L $HL $dHL $G$A fH SEtAAHcD<A HcHD t  H[]A\A]A^A_@=r gr  g ǃ L HcӉcH=;  H1[]A\A]A^A_H Ht?Hxt8 uaHD$Hǃa g>HD$H[]A\A]A^A_= I5 ;Ȁ )H5n H=ƃ  H=n 3 fD= tf5 ATuJ  t 9 |RmHf 1A\Hc HHM N @> D* L%) H5cH: LD1 H=;m HL1( ~ [   H tHQ Ht HxtA\fA\fAWAVAUAATUSH!   D= E}L f MuHN 1AuH=~ H Hu  = <\1@H!Ή5 H A; 3 H < HvHi |5} H )~ t_~   ~ HHyHq L r HPADHQ H)H} H@4H%~ H H _H<\m} 1L%} fB b@ D l| lb| A$NfD18} AƋ _ AEA<$u˅u  H$ HcAH H 8H= D HEtZHt^?=| Hc8| tH%| |H= HHt8;DH2DT{ H| H^ H| EA$H{ Ht HxoeDgzD5z A$EtBz t8H5 i H=~  H=h + A$WH=5 2 EDH5~ H=~ HHt"Ht~ Hg0Hp~ HHcHAu(A<$u +~ (D0A @1A\@!f.gD=r gCHH9ef.HH9sH5} g70H} H3v} =:z :HD[]A\A]A^A_fgJD= gtHcy t#Hy T''t 1""D‰3 gt8H=| 3 HH9Oy H| HH H| HH| H=| HH 7@A4W ry 0=H4AtH4  5y  Hcx tH5x T'" A x zfDry efV 111g@Dg蚏"D=" gĕHtsHytl x w H=V{ L1 HJ{ H/{ bH{ -8x 1qfH w lgi5H=z Hbf.w ‘ =z ItXHz Hz IHw HJH9=Kw A HrH;5{ ADH={ HWz AD> E{;tD Aw Ef&A\=z w JH=d Hپ1H!  H=y HOv Ht Hx:A@*A A\H54z g,Hwy L y H!z HHD$H=U0 H$ HD$H$HFy IHv :Hu Hz4Hx (HPHpHx gk+Hx Hx I3DH=x EA 8D/AWAVAUATUSHx|$1Ht$HdH%(HD$h1Hsx HtH _x H^u (ge D$PD$'D$#L$#"{s A2t= EAA2@A@1g&*D$Iċit D$D$$D$TD$HD$1|$'t 1A @à AƀtC)u>|$u7AHcD$DHcHA| t);D$(# AƄADA |$# 1)NfDHqD H5v (HD$hdH+%(HL$H|$HxE1[)](A\A]A^A_cADAH|$EA D$A΀1r s Hr Ht HxAƄDD}E9HcA,At D5DHV ׃Hu HvH5\v |EAD% t$ H{u HH5v |DLcDU4M A4DT$@HL$8LD$0h LD$0HL$8IDT$@IBt#Ht H^ H5u |L |$t]At #4 A@  Ht HH5Cu |H  |DH D4A{ At#uAtD\$$E A@u tt |$H uHt H AD$ u <}Du #I )A@u((u#Hs H HCt | E9t$CAޅH \H HIs HvHs |Hco o H=o H9 D4E|o A'u E" HL$`E1ډމDT$0-Ko IH9p I9EDT$0T$`DՅD9 HcL\$0LL L\$0l$`L $fL$AED$Pg HD$Ht H HcAHD$H(HD$hdH+%(HxL[]A\A]A^A_|$D$AwoH|$ D$ RDDULc DT$Aǃ4Aπ e HH5e |D$DDLD$8LD)DT$0Fl(@Icg|LD$8DT$0ISD5gb DT$0HL$`AHcT$fD97AG4D$ED)L\$0LFl*@IcgL\$0ID l$Ht$`1DT$0DT$0HPH8d HH d HHqD H5d E<J HL$(t$Lg豟1IHggHL$(HHD$ H|$D$(t9D$(t+D$(tHL$0T$y HL$0T$D$(A8AHL$L HL$DT$@H5HL$8LD$0r LD$0HL$8DT$@rD$ADODT$XH5=HL$@LD$8H|$0 LD$8HL$@DT$XtH|$0DT$@H5 HL$8LD$0l*` DE` xLD)Fl(@IcgI{DT$@H5 HL$8LD$0 LD$0HL$8DT$@EAA@ELD)Fl(@IcgLcT$0IDT$XH5'HL$@LD$8H|$0 H|$0LD$8HL$@DT$XuoED$AAED)DT$0LFl(@Icg DT$0IDT$LD)Fl(@IcgLcT$IDT$@H5HL$8LD$0H|$Xc LD$0HL$8DT$@H|$XH5QLL%T^  HL$H|$L HL$VJ%D$(,LI; mD$ u` HHL <$"RD$1D$@A@E1gD$Iŋ4\ D$HD$D$1<$'t 1@@à AA &Em#AǃD @*\ |$'Mc@ƃ - @H^ H L_ A|t$9;t$  @{H^ HvL6_ A|QEL$D$E9HC\DT$AA@\DHI^ HvL^ A|tE|$ E A~-H^ HL^ A|,DL$0H=3DT$(D\$ @ D\$ DT$(HDL$0H] HD$afD$1D=qZ |$'AA u A;\$ wH@] H> l$EL$E9|EDȺL$0LD)LT$(E9DL$ LEt@IcgL$0LT$(DL$ IŋD$C\AۅPvDT$A@\dE|$%A~H\ HvOL ] A|u@,D^I A AgH>\ H@D$@D=W Et,=m )~#D$@tD$DDu 'BfL$ 9L$HX ^H[ HvLb\ A|>HcX X H= X H9 DAW A'u EvDD$HL$PډމDL$(D\$ -W IHX I9 D\$ DL$(E D$PvDD9? IcDL$ LLV DL$ DL$PDL$ L DL$ f؃&D < H {I H)H5J |)1A& @ H CI H}*H5I |k*H(I H -F F H I A)"A(!uHI"HI | 7"HS H5gI |A A-tH =$HH H H5&I | =E E H=E gHE H1H H?H5H |-A\ *fE A(A|HG HvH5qH |A|t *D BI?98 (HL$HE1D)(C ;-C HHD H9/ D$HD H=D AD9|')%5D HcgHD HEfMcB7(IcHHe Dt$HH D$ D$Eμ A$D@Ń<@A[EX=ZF 5C h .P !/ Ic΃<H $L C ] H BD$C 1m@T$D$6Lc$T$(A߃[@, HE HtL E M#D-C IcL C H$H Bt#H vE HH5 F | AB LAP$EfA9|-D)Ѓ%5B HcgHB HH$AIcH$D1, HD HH D HHqD H5D EIcA`H $A"@@ HH @D$D$$A 1L A fAM߃YHzA$D@Ń<@A=@E@ =C @ t..!<@IcL A H$H BLH [C 11HH5NC HHHADlH$C H $\$A uB H B Hȁ$rHvHC | Ht$PLgf=HD$PHcH9,? A)@HB HvH5,C |gD$軿Lc$(H WB H-H5B HQ|H 8B HsH B  > HcgHco> IH@HA HH5xB |}@A'A"tZL A IH5:B IyB|A$HqA HH=YA D8A$H?A HvH5A Hx|t> AFH=> 9|-D)Ѓ%5x> HcgHp> HAFIcD$AH$$D$ fD>> D1D$L > 1D$$= f.AnDD$L%= HcgLHIcHHH$֯ H$H=HHD5,= HL$( ggHA ELcD$E9 H ? HvH5@ |ODD$LcD$(uIH? HH5F@ HJ|H? Ht2H |? L <  EHn? HtH Z? Hh< L < 4< {H$L < HhbXUG18H > HtH> H B< fL !< T$IcH$AvH z> HvH? |dD%+> L ; ; AB tA sA;; Au; t; A9{A V; tDFt A9}AK : Au A9-  A9] Ay] Ay| AHD$XdH+%(~HhD[]A\A]A^A_DHc9 9 I?B9 (Ht$HDD$9 q-9 D$HHl: H9D$Hi: H=j: AD9|/)D$%5A: HcgHD$H5: HIcA^AHD,McHcF7H \$HH AD$D$ _D$$9 L 9 fA# 7 t  H< HvH5< | 8  1#u1%8 8 %8 A 'f.H; HvH5$< |D$HL$HA{<E1][D D$HH8 H9?FHc7 7 I?B9 (HL$HE1D)(]7 -Q7 HH?8 H9tD$H@8 H=A8 AD9|')%58 Hcg#H8 HIcEfD,AFH([ 6 HcgHc6 IH@IcL 7 7 1H$HIcHcq6 o6 D%6 I?p9 DDDHL$HEDD׃66 D$u-&6 HH7 H9iD$HD$PA' DLD$L1HgHI t$L1LgxBLH D$L6 D$LBD0H=6 9|')%56 HcgH6 HIcHHU Dt$LH D$D$$I DD$L+g\LcD$@+H 8 HH5:9 |IcH$H BL 5 11fDIc΍L 5 H $覍L 5 AA}{DD$H `3 D5 Et D$$;3 gqA~HHcgH-65 CHHH DL$ EtKDD$$EtK|$0tH$|)u Kf5b4 H g_=7 tqDC=7 594 DCt0u.!L<%  3 vJ.b!L4 <+ 1LgH-3 H^@T \3 @H=3 }{vC16 @ǁ= ==u-   2 HH3 ]3  Agf.DƒSA4DCH^ A4DCD=u1 d2 >5 og2 t D$$H55 HvH5 |RDd$$D d$ B4 ljD$lAH5 L= H*H^2 Dl$IoAHfHuHAH[ D:.uH uIcċ1 Dl$HA|E]{ }1 Q1 -Ay-D^/ EHD$$ D$ D$D950 gmA~HHcgCHH-1 HH H$L0 LŃ踈D$ L 0 D$ .0  D$$k. 0 L$L$ HL$HA ]D[HH90 H9D$H60 H=70 AD9|')%0 HcgH 0 HA^McHHcB7[Hĝ \$HH AD$RL/ D$ . HcgHc. D$IHEA%AEڃuH vHcHAynAyu t* * g A* Ay= AvD-* HA|A!H- |j* L-k* E1H]* K* D$U) D$, }, D$0) @) L$4@* u?)th LH=H) giIċ* twH) H) H) ) )uH=) MHD$L-|) %( d) H=) I9D$0+ MI8tL1geILLD$g/H|$HD$Igl) L-) D$MtHD$81ҸDd$4T$HEt Q( @D;D$|.L$L)%( HcgH( IH$EfIcAD=HD$(LAD(HD$HZHH9 D$HHDDpHAD)e D$D$0~&  T' H' Ht Hx\A9eX' 2G' A9{MAyA5Ay' A{H5hH D$L \' 1G' 3H $~& =01Ld$܃gLD$Mt LgdH=' HbL& LD$ LD$YLDl$H /) HH5) |A;H ( HvH5) |% A(% RDAi(AynAyt% €1& % fA|SKH W( H{ H5( |i H<( HHQ@lH( % *a$ $  % ' 9Hgl=f% H$ %$ AY% )>@ljt/@t*H ' HvH5( |XA-|H H' HwH5' |eH-' HH ' H<'(3H]Hϓ ƒlAy 1AyA& # )AD$D$05# MDl$.=& ( hHvH5& |j߉# BLgZIH@HhHޒ xHHcHcgHH( LAt$HǃkHL$LH5LL$ LL$HL$)%}" A" ! " A{/% HI " D$L-" %" w" g\nD5 $ EuD-7 Eeg8H51Ld$8 |$H1gLD$8HH5 % | ="$ HH5$ |f.[gHD$1ҸA}f! z A|~ |$|ԃ DOf.H! H;AHpƎ HO 蠠ƒ-<6H5# A%HH # |H # H A#  &ƒ&H " HH5[# HAA)|+H " HH" A'=C" w.H|$P.H|$P11A>H @4"   A H! HH! HHHD H ! H! HIyK9  {! F A' | ʀn g&5HO! A*HulFuhA 3A"AxR 5 tu`AAyHHtl1H5q}s =) HH1gH A&H5 }1A, = H1gK1H5E} = H1g&AH  HH HHpTA#H5 Y}A)DH  HH H HfDA$ gY1AHHD$PG2Hg\H@  H|$P g6Y1AHHD$PHgM\H }`$[ f A/TA.Iƒ>uJH  HvfH5? HAA,|H  Ht-Ho A+H b Ht HN Hu A+A,HH@ uN uw t܋ wH_ HtHxu辕 t@wH^ HS H J $ tHfAWL AVAUE1ATAUSHhdH%(H$X1LD$@1H$fD$@LMI  D$H$LD$CiAށ4 O/= =0DsAwgMcH5Bv9uTH݇BpLE#t$foo Lr ACIt$f.HB(Dl$E|$uN! Iu>AhHAXLEI9t;IGIIAA4twHcHft*L\$8H1HT$0L$gKL\$8HT$0L$HL\$I{gPL\$L Hֆ ņ I;L\$g^H=4mHg^^L\$L BHH{IsHtHFIHu1HVICL\$H8g^L\$L HH5HHHuHICI3L\$H8g]L\$L HHI I1I 1I 1IL\$1ɾv H=o H` gJZL\$L NHIL\$1ɾ 5 H=. H g ZL\$L HML\$1ɾ  H=  H gYL\$L łHIsI{L\$Ig7SL\$L HHc H L\$H=Qk ISL$8HT$0gL1HgLL\$L$8HT$0HI{gMNL\$L 1H| hk ZHc_ H$ L\$H=j ISL$8HT$0gL1HgwLL\$L$8HT$0HI{gML\$L H  IsI{L\$ gML\$L lHH  IsI{L\$q gML\$L HH[a MP ?IsI{L\$$ g^ML\$L ҀHH  IsI{L\$ gML\$L HHǂ  Hc I{L\$1Hd ISgKL\$L +Hv be THcY I{L\$1H ISgKL\$L H%  Hc IsH ISHt0H>t*L\$8H1HT$0L$gFL\$8HT$0L$HL\$I{gJL\$L RH  {Hc IsHA ISHt0H>t*L\$8H1HT$0L$g&FL\$8HT$0L$HL\$I{gvJL\$L ~H  Hc H L\$H=ig ISL$8HT$0gH1HgIL\$L$8HT$0HI{gIL\$L I~H  rHcw H< L\$H=f ISL$8HT$0gH1HgHL\$L$8HT$0HI{gtIL\$L }H  Hc H L\$H=gf ISL$8HT$0gG1HgHL\$L$8HT$0HI{gHL\$L G}H ~ pI{L\$&I3?gHHL\$L |HACIL\$1ɾ H= H gKL\$L tHISI;L\$IsgGL\$L tHI;IsL\$1ggGL\$L ktHL\$1ɾ U H=N < H5 gKL\$L #tHcI{IL\$H= H gJL\$L sH%ACIL\$1ɾ H= H gJL\$L sHIL\$1ɾ H= Hu g_JL\$L csHI{IL\$ H=F H7 g!JL\$L %sHeACIL\$1ɾ  H= H gIL\$L rH$IL\$1ɾ  H= H gIL\$L rHI{AL\$ Hx H=y g[IL\$L _rHACL\$1ɾI AH=? 1 H* gIL\$L rHXAL\$1ɾ H=  H gHL\$L qHI{AL\$ H H= gHL\$L qHIsHtHFIHu1HVL\$H==ZgjKL\$L NqHHHHHuHL\$I3H=Yg*KL\$L qHHGL\$I{gJL\$L pHH IKHHAIHu HQHHHuHI{Ћ L\$I3 gIL\$L ypHHcr H L\$H=/Y ISL$8HT$0ga:1Hg:L\$L$8HT$0HI{g+<L\$L pHZr FIr 8Hc=r H L\$H=X ISL$8HT$0g91HgU:L\$L$8HT$0HI{g;L\$L oHq q Hcq IsH} ISHt0H>t*L\$8H1HT$0L$gb6L\$8HT$0L$HL\$I{g";L\$L oHQq =@q /D IH"  E)Dy E1EAbH I LAA@>̀E1 -ICI# H IL\$1ɾI H=B H3 gEL\$L !nHaI{IL\$H= H gDL\$L mH#I{IL\$1H= H gDL\$L mHACIL\$1ɾ H= Hy gcDL\$L gmHACIL\$11Q H=J H; g%DL\$L )mHiIL\$1ɾ H= H gCL\$L lH(IL\$11 H= H gCL\$L lHIsI;L\$g07L\$L lHACIL\$1ɾk H=d HU g?CL\$L ClHIL\$1ɾ* H=# H gBL\$L lHBI{IL\$0H= H gBHHD$aHL$L\$0L kACIL\$01ɾ H= H gpBHHD$saHL$L\$0L bkIL\$01ɾL H=E H6 g BHHD$#aHL$L\$0L kUL\$111g=L\$L jHHA ;u  ;%, L\$111g=L\$L jHAC AA &;u  ;% I HAC AI HqL\$I{;I3gj5L\$L jH^L\$I;gDL\$L iH wH H H  D3IHHH5KN1\ =a HH1gϞH^Z LE1gmLgm/ JfH5NX@1H5JQ\ H1gt1H5M0\ = H1gOq@%@=y1H5OM[ = H1gwH H~ H u LglGH54LHH1H5WLa[ = H1g耝ff.AUATHC= It HA\A]#= It$HLL1A\A]2fL1Hg2IAUATHIċb = t=!tCHLA\A]=9 ItLLL1g)2Iċ =!uHL1A\HA]1fL1Hg1IH1eGT1HfAWAVAUATIUHS1H(D=#f D5f t$gp D- D$ D$ D$  D$PH" Ht%Hxt111LH @4IL3 H5|@H=E@c ] / 2Nl$t ' E1@ uA艞=0tj  *LH= g)Iċ twHk H` H W =0uH HD$R OtH= tjLD$D=d D5|d n D$D-? Y D$ # t %1 L;d$MtAI<$t:H(L1[]A\A]A^A_$fH 8CH(L[]A\A]A^A_fDT$J 1?   T$DaRT$ Mt"LL% gRiLd$L% Ld$g3 u  u ggSHH g0  P P P HC C C H HC( C0b C4b C8[ CD$ uDAgGH$HdH+%(HX[]A\A]A^A_HL|$`I@LLd$0H҃MT$L! H @T$HL$( )H5?D$H H HD$g=] 9=S D$KLpD$L3 HD$ H D$HL$(Q)t0H9v+HAHD$(HHpH9tPH tHL$(HL)H) HcA<)u|Au 1HgZD1uff Hb HtHJ = t %< ؉gH5>1N |$ )H1gg!O U<+th<-t<0< wUgmHHtGHN HxgH]H%M GuH=*XgC!HfD1]@GuH=Xg!HfD: ATUSHH=  H4g轓D% H HHDQ  Ņut=U  ; U fD9~TH9u9t0 ~&HCH H9tHH9Pu>_U []A\Ë;f.A9~9tg説D EHcՃHHHHHtHHH<R T - []A\f.ATIUSHHdH%(HD$1 K HHHJ Uu9H$H9t0 t uHH$ H t t;tt"E1HD$dH+%(u HD[]A\AMtI$L ftD^ Ly Z `H *y D^ H= HtTH1Hy H hZ L= HI4H1HudI H H@x p ]  f.HHHt<1H ox H5Y H=5= HH ׋6@4HHuHDg]ff.HH HtH1H x H5pY H=< HH ׋6@4HHuH HfDgff.1Hw H Y Lq< HI4H1HufHuf< t< uHuE1LfD<-P@ƁuAG@HWE1fDHK HLH0< vLH؅LELH1H(HIdH%(HD$1D$LD$DHIIHHHGu H]A\fH111gASHHt A8$tHE H1]A\DHL\I uHD ATUHDgAut2H/Et@HBHt,0< vH-tAHD]A\H5\P1F HH1g^HD]A\H/1E1H5$PfF HH1g(HD]A\ff.fUHSH/Hgy%I1MtH[]U tH ` % u.TD uˋl tHH[]-DH1[]ff.@U/Hg$I1Mt]DH=g$]HtIH5` IPfDGHt$u <>wIs1f.AUAATIUSHupZL IIDBu_uZ1u.RD2L IIBu_u3HA,t&=t![t/+uA|,=u [t1H[]A\A]fD1DLg[~HA<]u͍BHcA 4+u A|4=Bu벀=tff.HtSUHSHt3mK H}H@HtXuH1[]fDH[]@1DU11B x/AAuD]f]1%B A1%B ff.H1Ҿ1B HUSHbA 1HD I1My1;H[]ÐH1H=L0H xH%@D H=Ɍ E G HHt1G yHff.fATIUHSHH0dH%(H$(1HtLHt_HEH9t&1H$(dH+%(u[H0[]A\DHMH9KuHH|D uHuH$LH\D t B AVAUATAUSHdH%(HD$1jAA Ll$tX1L@ uA9t HPHH[HEfHu[DATIH=+USgHt6HHS= ~%HcLHH; uI4t/uHuH$H9$HH)H)..E.H}HcfEH@ DfDLDHPH/uAHi"; DATISHgu2uHL[A\Lg_tHL[A\HL11[A\E@HUHSHH: D A9Eu\EH<:tqtmIcAqHD)DHHt:uDE9t?HHDD[]] @IcH<:uAIcH@D EȀ9ugH[]ADH1[]1ff.fHH  P tfDUH-CSHCHg H(HXH H@gHH{ H H@H{ Hl gHHhH@H gHH@H+ H[]ff.AUATIUHSH th9=^> StUk t31~$HN HTfD9t,HH9u1[) 1D[Ðf.ATIUSHH HtHt H[]A\= tf~{g H ~81fH,H 2 Hxg|wHH0 I$HL]A\ÐgUwI$HL]A\g5wIAWAVIAUATIHUSHdH%(HD$1H$1 HH1L= 1Mf<'t<`uAL$=@ ~)AuDn@ trxnu4@HcH9s5I4<$t <"ufAL$HcH9r̐HD$dH+%(uUHL[]A\A]A^A_fDI1L,$HI)LH1 HvL,$qfDH_0 DUHSHHH H2HÅ~3H  HcHHXHH[]f.guUHH]H;ff.UHdH%(HD$1Hl$@|$HD$dHHHT$dH+%(uH]/ ff.fUHSHH ~*H  HHHhHH[]fDgtHhHH[]U SHHgt(HX@H@H[]AUAATI UHSHgBt HDhL`Hhg(tHXHH@H[]A\A]@AVI AUAATIUHSgs HLpDhL`HhgsHXHH@[]A\A]A^ff.AVI AUAATIUHSgqs HLpDhL`HhgMsHXHH@[]A\A]A^ff.AWL=AVAUE1ATE1US1H(HGH|$Ht$L0T$ H$fDA< tN< tJL1LgqgHcHLLuE1}t%ELu< uI@1LD}uۃH(g]rHËD$ CMH<$LcH$HCMHD$H|$LkHC g> grHXH H@H([]A\A]A^A_fL1gUIƃu-E1H8t HIL* tCuE1H8tH}IHDH$H$H8tH:H$@H546~H551+ |$ H1gmHD$1H55H@L8q+ |$ HL1gmL) H<$) L ) gH(1[]A\A]A^A_H=WIOH=WwIH=WcH$f.UHSHg,p HHhgpHXH H@H[]f.AUAATIUHSHgoHDhL`HtH}tH1g:HHk goHXHH@H[]A\A]@ATUH SHg[oIHtH}tH1gHIl$LI\$I$AD$[]A\ff.AUI ATIUHSHgn HLhL`HhgnHXHH@H[]A\A]ff.ATIUHSgn HL`HhgonHXHH@[]A\ÐATIUHSg;n HL`HhgnHXHH@[]A\ÐATSH HgmIgm+ ID$PHXLID$I$ H[A\fAUA(ATIUHSHHgmͷ PDhL`HhHX H[]A\A]DSH gAm1HXH@H HtSP[ff.@AT gmIglC ID$PH@H@LID$I$A\f.AUATIUHSHHHHtOI\$` Lk~|HB H HHL(%! HhHCHL[]A\A]HtHHHHuID$HHH HXHL[]A\A]gk gkIgk% ID$PH@H@I$ID$ ` AWAVAUATUSH8GH|$ D$t$,vL|$ 1IG H8gHD$IHH% HÉD$(IG H8# IG Mw(E1@HcHD$AE111fDg1IH 2  \|$E/EtD$(HD$D8(tbLQ% D,HE9|+AJHT$HEDHcIgjHT$HHcHcLIcH' HHT$HL7# uHD$A< vHDHD$ H@ H( H8[]A\A]A^A_DET$(tGHD$D:(uHT$HL" t(A fDEoIA t@HD$A< u_H5I L% gPiHL$ HA(g9iH$fD1H5.# HT$t$,H1g`bHDH59.1|# t$H8[H]1A\A]A^A_0aff.@AVI0AUIATUSHdH%(HD$1ghLpLh H@(h@XHHG.IĉHcHDAD$BHD$dH+%(HL[]A\A]A^@AD$ADAD$ADI]H" HHÀ;-uI}gYu1 AD$xI}HgctH$HcH9uLg31 AD$H$AD$ 4H5-1! H1g\ " ff.@AVAAUAATIUH SggH= L`HHhDpEl$H@gRHt@(uHCHH}1HgHkHt"HQ! HxgfHH HHk gqfHXHH@[]A\A]A^HxHtWi1gHCHaί H+H HDHC;DUHSHge HHh CgeHXH H@H[]ff.ATIUHSg{eHH' HxgeeHHy Lc HCg@eHXHH@[]A\fATIudHWHzHtH?t1gIT$HHzHzHtH?t1gfIT$HLHzA\% f.1ɾH=)gcLA\%U ff.AWAVAUAATIUSHHHGHhHGx;HEIHH!Ht (H@IHHH!Hu HEx;t gc IDhHhL`gcLxHIVAH@HBHH[]A\A]A^A_ gc HDhHXL`g{cHhHEH@H[]A\A]A^A_f  r H_ fDHIHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$HLHD$HD$ H= g $D$0HD$D HD$dH+%(uHF fDHLM Mt@=: ;=8 } HD瀉= HcLg`bH H@?= Hcga H HDAWAVAUATL%)USHHhHt$8HT$@HL$HLD$PLL$XdH%(HD$(1H$$HD$HD$0HD$# xD$uSfD$ALt$LLLHc=" H=# m - L{<%uk@tH@dC@%I@c$/HT$HBHD$D$f.@sur$/HT$HBHD$L2AL& HcY HZ HD$(dH+%(LHh[]A\A]A^A_L1 @H1gT@$/HT$Hc:$Ht$ glzHIALq ŅE}LcIaD$%IALt$7fDHT$Hc:HBHD$sLt$A H %L1AB! [DƒHT$$QfDƒHT$$n  SHcH= 9$)Ѓt5ʽ Hcg_H½ HDž~3Hھ ] HHH1H=5[ [f.Hff.AVL5&AUL-[ ATL%$UH-C8SHu$Ct.#IcLf.1L6Cu1H=% H{[H=1$]1A\A]A^HCH=zZ []A\H0A]1A^H{GH1HCLH01H1H[ @fHCLH01H1H[@H{H=#1aH[ H{H=e#19H[ []A\A]A^ATUSHoGwu5HC HS(@uCHR H5#[HE]H= #1A\1H=1HC HS(@tHg˰H5#H="IHR HEL1[L]A\% DHGH="H01[QfDUSHHo DG HOwGH$HHcHH=N1HC HS(H=,"H0H1[]fDGtH=01HuH="H1[]HH=51[]@G&HuH=!빐GFtH=01SHuH=-"fDHuH="xHUGH1H=! HUG*H1H=!HUGH1H=F!DGcH1H=G!H1[]@G~H1H=j!DG3H1H=!GtH=/1KHuH= HUG2H1H= (DGCH1H=O C@GNtH=.1HuH= DGH1H= @GHuH=fDHuH=Y H[]fH=H1[]L@H=H=H1[]$@HH=1[] @H=xH=xH=HH=H=c@H1H=1fH1H=1f.H1H=1oHk fDH1H=1Of.H1H=e1/f.H1H=E1f.H=,1Hk SfH=,1Off.fʶ HAVL5z1AUE1ATE1USHCPtGf.uCu {HHHtH1LNCPuHg DHHHMImHIHuM uuH-I1LHL-fHC HS(LH01H1HHuõ [L]A\A]A^#fDII-DL% []A\A]A^HC HHt<-t<t1<_<$t0< w"HC`HHrC HCff.AUATIUSHt<;f.HѴ Ht{H-H1L-H@HC HS(LH01H1HHu A$t<;uZA|$uRfH=a gc"] HF H[]A\A]LH=Q 1Jf.H=.1Ht[AUL-(ATL%J UHSHHDHCH;LLHEH01lHHuH[]A\A]fff.@ATUSHyHtn- H9 []A\@gtvHtIH 9tH 1H5]A DH1gLMf.1H5l []HA\1.LDH51D []HA\1LHi Ht Hk fH1H5 HH1KfH=v x"L# Mt6L5 H= p H ? H H 9= tff.AWH=AVAUATUSH8dH%(HD$(1gL% HMJA$Ht}u*HD$(dH+%(:H8L[]A\A]A^A_@+xg(yHg IDžrMtA?uL%8 fD LH H HKAD$D$D$L| L% I$ D9Ȱ J|$HD$LcLE1HD$1D$ALD9-ٚ H~\5~ V9~OtHHt$L H@N ddg#QHD IL1A?t= LHHcL!fD9~HHA?UuL! B@-xgwyHcLT HcHcH|$Lb D$D$@Ll HcgPHd I@HcI_ ff.H ATIUHHDև SHH ug;t:t~H=Ϯ IL1H  [H= ]A\% @uH= IL1HO c ĐH5l H fHg7H߅tPg蚣HHH=5 LH9I!H_O 1 QHm CgN11HgյAWAVAUAATUSHHH HHD H ZHL%(H-D L5L=7AH;ILMEH=T 14 HHt;HCHHt9uH;HLIEH= 1 HHuſ H5 W H= H[]A\A]A^A_% @HHL$g責HL$HtFgH;IHD$HMEL1H= v H|$ 2fDHL$g蕷HL$11HgKfH5< H fDAUATUSHHHGH=iH01>H[Ht9L-dL%&H-C HCH;HLIEH01HHuH[]A\A]ÐH SHHHD H H5 H6 HCH={ HH1L H{[}ff.fAUATUSHHHGH=H01^H[Ht9L-L%&H-?B HCH;HLIEH01$HHuH[]A\A]ÐHѪ SHHHD H H5 HV HCH= HH1l H{[ff.fHGH=H01ff.HA SHHHD H+ nH5 H HC[H= H|H1% ff.AU1ATUSHH=HHt DHCH;ILMEH=צ H1 HHuH=RH  H= H[]A\A]% fAVIAUATUSH_Ht@L- L%t!H-= HCH;HLIEH01tHHuI~t%H=4!1WI~[]A\A]A^fD[]A\A]A^AWAVAUATUSH(dH%(HD$1HY  Ht| Cu<u  H HcHDH= 11H=Ct1H=C= eHCH= Hp1ZHCg HxfDH{tH= 1+H{bHD$dH+%(( H([]A\A]A^A_LkH= H- L=L5; IEH01MeMt(ID$I<$LHIEH01M$$MuH-1L=h8H1Lw= \HA H5 HHD$1OI}Y _ H=: t H=(; $Hc ~H D<&t< t H1 L) 1= H|$H51fH{H55` kH=F 1 Hk5   H}AH=q t H=_: [ q ] H=%71?=Y +=G =M H=- 1- fDHCH=v H-, L5L-9 L`1Mt/ID$I<$LHIEH01M$$MuH=[- 1VfDHk1H= ~HH=B- 1h#LkH= 1H- GL=L589 MeMt'ID$I<$LHIEH01M$$MuH=E1H-/ M}L5L%8 Mt)DIGI?LHIEH01M?MuH=1H-MeL=jL58 Mt/ID$I<$LHIEH01bM$$Mu1H= , L=(5D1L:=T H> H5 HHD$1I}  " H= t H=7 Hc ~H D<&< H=1D1H=HC HxVH= t H=t7 pH=1bDH{ f.H{H5Hk1H=' H}Hcϟ ~H̟ D<&t< tH=,11H=PH} ۟ H= t H=6  ) H= L=e3H}HD$Hc? ~H< D<&t< tH=1IL=!31L8=R H< H5HHD$1H}  H= t H=5  ) Hc ~H D<&t< tH=11L= H|$H51?HkH=L=E2HEH01XLuH; HD$MM S L-bH-$5 DL1=0 MfMt-fID$I<$HVLHDH01M$$Mu1H=0I~ ם  )Ɲ H= tHAFLe(s= XH|$H51UM6M)W )] 1L3=M H|$H51HC  HxHCh ;|J |H|$D$fD$H=1HC Hx@[H= t H=y3 u-~ )fLkH=H-L=L5?3 IEH012MeMDID$I<$LHIEH01M$$Mu[@Hk=ޅ HEH0H=f111H=>g=қ 1H=B  H} g*8 HHE1;H=k H=U2 Qg Y -Z )X M1H=/!=; H5H=8 1L9LeHg H= !&HCHxH.Ϛ "fHD$dH+%(H(H=1 1[]A\A]A^A_& &H|$D$fT$^HCHxH1ɾH=g :H=1DDH= D  H=0 H1EHDD EH=-1HCHxH51 H1HCHx1H=W-s  H=fDK=e 0H|$H51-1=3 H|$H5Q1fDHc ~H D<&t< tH=1H=1L`H@H@HxgH= ,3g> - ) 1H=A,]=w BH5" H=5 1=CH=1*HCHxH[D! Et H=>1  H  Hŗ H Hff.Hb  H HHI H54 1H% fS1HH=B >H{K H=. t H=. Hc ~Hޖ D<&t< tH=>11H=H{  H=Ȗ t H=-  )Ɩ Hco ~Hl D<&t< tH=1y1H=O*k= PH581[H=3 Jf.AWAVAUATIUSHD5F 0  D- H Ht ?H1H=؃D$  H=jە H-)  1Lg$8 IHMH=} t H=k, g-| D5y D-f 1HH=b -H5 H=2 1(D$ L% u A|$ 5LgHL[]A\A]A^A_fg"HH=a@ 1@L`H@H@HxoH= t H=+ - D5 D- M1Ha={ FH5H=1 1ALyMgHL[]A\A]A^A_`fH-'1H  H= 7fDLW It$I|$HP# fDH=o1f.UHH?Ht 0 9. |H]4fDHHEHEHc P H H,]ÐHt;UHHHtH} HtH}HtmH]%+ ff.@ 9 H| V4DHHHGHcd P[ HH H<HAUL- ATIUSHHHg3HtBHHH} 9 }LeIULeHcΑ H ő H,HuH[]A\A]Dff.@Ht{ATAUSH0@MwLH/|t3H} *H Ht4HHEtH}DtH}( D[]A\ff.@HOATUHSHHtRU/H WHcHfDLeI|$I|$L7 [H]A\%* fHEHxH} [H]A\% @LeI|$*I|$ I|$FL LeI|$*I|$ I|$L iLeI|$I|$XLw ;f.LeI|$I|$I|$Ht@ L7 [H]A\%* fLeI|$RI|$HI|$>I|$ dL fDLeI|$L @H}WfHEHx HEHxH} WfDLeI|$I\$H,H{H{HHN Hu@1ɾH=g.ff.SHHCH{jH{Ht[% f.[ff.UHHH}*H}Ht H]% UHHHt H]% UHgH]HU1% ]% ff.H1ҿ%( AWAVAUEATAUHSHH(dH%(HD$1D$_HAIHIgfffffffHHH?H< HH)HHH)HH)ƐHMcIHH?HH)HHH)HH׃0C IHuɸMѐLHcHALumDBIgfffffff@HHLcIHH?HH)L HML)Ƀ0A :HHuApMcM)HcMfL3LcDvHAL2uuIEt HcЃsHcHT$dH+%(utH([]A\A]A^A_@E1I:Dg"McAOB;dILD0A69|A giIHHC MDHxEt = Dg<IŃ-:} | MH LDELLgAAM9t L M9 H{Aąt EAEHD[]A\A]A^A_HSHz| 1g-| IM Ȁ L5@ HCLE1H8g膌AM9sLF efD LLE1HCi DD$ H8g?DD$ DM A1gIH$HC L5 HxEt=i HxDgIdfDH{WAąH{ CAH{/Aąfz@!AE1A EHS{MLgsfD1gIq: L- MHS{E1Lg#UfDE1E1DHC L5l MHxHxgIGfgeI$DHCH5 E1H8gqAbfDE1zAH=1ɾgg1{U1ҾHHg軨Hg1ҾH} g表HgH=:gۛ1Ht@(uH9EtH]% fDHxH9Eu1ҾgQHg訮H]%v ff.ATUHuzt#t( tzH]A\f yH518 HH]1A\@1A x)EnDo `fH]A\%Y 1H5: 1DH1gf.1H5  H1gDHtSUHSH~81H9]~#HE߀<t HEH9]H[]DAWAVAUAATIUSHL$ HHE1L=*fDCHvE t@ wE4HHt8C{Aƅtg.XtދCHwHAHuEL$ @A"um@uhLg"H-+w Hg HgHw u=k v H[]A\A]A^A_@1@g謆gPD4= x<  = x" p _ T$ 1HY D!;v t /v Lg-ux1y 1@gXEx D yt.1H[]A\A]A^A_@ H1[]A\A]A^A_gS1D1[ fDAUATLcHgD IEuH@HLA\A]LgL1IEH HLA\A]Ð5>^ tF Lv u<^w t D^ u(H9v Ht t t u H@@^ fUH-t Ht"HgHgHt ]ff.@H=t Ht$HgZHt Hf.ff.@H=it Ht$HgHOt Hf.ff.@U11H=  u ]fDʼn1 ]% R 8 H51H H]H1 @9= H HEfHy Ht<H8u*HH HO HEHfD1DHHGHGHGHG UHH H5 H  H H  HxgIHH] ] H H SH x ' C {x  CHC[f.H=B x . =, x  H HSH x9t [ C [fSHx9t [Z C[fHG HGHGHG ;=r u"~ 5| v b DU u9 øf.ATUSH dH%(HD$HHt!HH$HD$gu!HD$dH+%(H []A\@H; xHcgKH;Ig迒HHE(@Hc{ g*11H;HHg@H_ Hc{g*1ɾH;HHgH6 LLH H1 Hc{gc*L1HHg袮H L HgMf.tH;gCȐH;g"HHq H9tHtPE(H; HmH HxgHH HHgHHH;gHŋ@( @G Wx69tx69tfG x 9uGDyUHH x9t=}x9tHH]DR EHH]ffDt$ . E t$ ff d x@9t x@9tB x9u 4 H= yUSHHH?Ht_A xHcg} LH SHHH1y HgH;gHH[]% H[]fATUSHHdH%(H$1IH$L L H HL1 C$HH;Ht { x  C {x 1HHHCHCHCHC  H$dH+%(u H[]A\ ff.Ht fDff.@H=Y @e ufDH=9 @6 tDHg=gapg=HCpfAWAVIAUIATUHSHdH%(H$1 ' D HË A1AH~k gfHg]t$AtA t1H1 AŅuD#Hg)D%Rk H$dH+%(qHĨD[]A\A]A^A_fD= gtrAQ1H1e ADžgg趏8 g֡gжgZSg3gg]Hl @ t H@Hl 1g8X=S  yi wi ui ;k ml 'j g8LgTLD`pgTIŅt/KHcHkHLHtHI|LL HR ImIEIcIDIE8-uHIE=m 1H=kQ u #H<u H9[Q H=LQ \ H=j gD%8Q Hmj L-Q L5Q g象gFH=Q 1 f 1H5 I LHH1gL|$ǺL DIƉ$T E^AFHDAI|$#>|$!D$/HT$f.< t< HA9uLgZIHv D#HcA| H51A~2 LHH1g!L LD$L$L DHD$A^ HT$wH<$Dg H5g1I LHA~H1gUA9HcΉL"< HA9x@wLHcgD^IMDHH5N1A~ H|HH1gx$ +rg-1g']fAWIAVIAUEATUD!SH(HGDj Dd$hH\$`Ht$HDL$A@HD$D$h!L$EAH|$g胫Iċ  Mt|$gLg|$L Hxg7LHK DL$1IHE@gqug#eg?L%Te R DD$E|D$ht )=/ H* E1 ID9;~&HCDB<8t HCB8ID9;Dgt$-M  E1 x= Ex D/ Mt Lq H(D[]A\A]A^A_H|$/gНH-1H5Qc Ht$H1g#|$4d D AE1H= gkk tzgWgg/MtkA?~e1 HA9~XIG߀<tv IG_ _ u` A Ã(g誗넉DLgp-H|$:1H=c u =Ba D$tHD$H;l tgD$tGuOH|$T$pHt$-H=  tLgb=_ gVgK1H=_  |$tӃ|$u؅t=` gH-` HtbHѹ HxgHH# A1H‹D$p@PjDL$pH|$ XZ[Q H-DD$`T$pLLHt$ABH=  ff.@AWAVAUATUSHLD$D dH%(H$1EIAAH@D= EbM=b = ]; igy&AF5b L5`_ …tH @IH!H93A6g AFAA HsE@E!A@%HL$DDL~UH^ AH$dH+%( HD[]A\A]A^A_@Rt5: AFf.D=9] AF@= gtd g ^H$dH+%( LD$DDHL[]A\A]A^A_5HL$DDL<\ ANF L$IF@7F }[ g'HH HxgHHմ 1HD$(@HgkD$Bg07T$Au:H|$(׳ LD$DDL 5[ =[ g(ExDL$DE DL$E'D] E:DL$A1g薙$=E iBgv6DL$zAF1|$DL$AŃAgqEDL$1[ fDD É$DL$ LgHHD$ HxgHHt$HZ HHD$(HD$gjDL$ H|$D$ErD$c A> DD!ueDLD$DDD!LÅ!f3@Z T=2Z g茐@C $ w1Hs&I~HtT$L$gT$L$Z [ Y  DŽ$T$BL$g4L$T$]AFT$(L$ I~D$g[L$ T$(D$qHOY H@Y H=Y H*Y HD$ H H\$(HD$HYܽ Vڽ ,AD$X H5HcHL$Bg3L$|$B A  $!Mf$A $H=Z HjY AD$;B W t+=pA t"=w u+WY N‰B L$LV g-Ag4 | L$uKH=X Ht ܯ L$L-qV L$L HxgRLHf L$HX L$ga/=n@ L$tLL$@L$W L$$@@A #%^W $aV A g50$={[ \$@ H\$ H HgHgH|$(t H|$(gH=g+B$(t$XtL$1D$A ^D$V gHW FLD$DDLI1҅DT$XD$T$X;BIF|$Hxt HtOLD$DD1)D$DL$I~Et-D$? B$g0$IFT$HD$`tHtAFt HD$`V HD$`@V? T > < rW t3=g> t*=n u!NV P ? )кN‰> S H|$`gAg0 m uGH=U HtѬ L=jS Mt"L HxgJLH^ IL=U g^,D=k= EtHD$`T$8HPDD!D$0L$0D$\ HM̽ HRJ$ 1 L$P|$\|gDL= U LL HxgLH t$0IHgcL$8@S ;H|$OHD$8ADd$01AH H9]HE߀<t HEDD$I^Et H{-5= O)-&=    H{Ht tO)D$DT$I~Et1*D$DD$I^Et < HIQ D$0C< gƦ=V Ag.  u?H=~S Htk H-Q H HxgHH HFS g*5; tnH{1gҷHHnHgIHgALI HgH=D$g<H=L1g>LcMLt$ k  R I\$Hu&^ rHH~H{1g IHtH@HtH8Ht ?HgHD=l 1LH P E1 g跽HA LgA J= g>X9DD$I^Et : H{D$gc =89 D$r=9 e{P gpQD$I^t : D-: tHC HHXkHQ GR -9 t-=&9 t$=- u+ Q N‰9 H{L$L$@ Lt$D|$ H{ ?&ANj^ ~\ ef T tG H{L- 9 WD$E H{L-8 4D-8 IƋ$f  t D8 EugόM "= gD$Lt$5gEI=Ҭ gtOqg)ILL$H|$@͟ H=g83L$TBE1g1#Ef|$EAD1g]ADL$EqG EtA uA G$H|$@go%$G 1ɾH=^gLD$DDL F 0 $E 0 g$0 V$E  {$G0 ^D$Q '  H{HB1g!L$@_ۉF EANLD$DDLD$/ DL$$D / g$DL$y/ +HC H{L CY/ gH=Igo01H=Lgm2tHCHLM[  C CH߉. g^=8I nAg  _ u?H=E HtÜ L=\C L HxgALHU HE gX5f- ADžtHE Lg`IHt @)HE1LH0gIM0AG(@A<$Iu A|$FLgϬH{ ADžt - ugف u~ ul˭  t  HmH s k=e gKZHgIgDOgD댋=3 gJqHEH8gNUAG(t4I?gA|$SA|$Lg@HELH0gIgD= gGJdHgBg)$D$Lt$- D-^, uD$DDd$01DAD ^C =? x + =) xǝ  H D$P tA L D$hD$pD$\  H\$`D|$8H{A HD$H@ OA^vA H{g-eA HD$0He@ H|$0H=8gT,=}E tD$8 HD$0\$8H@\$tH8=)  gHD$PH =) t=* u =B B 1DŽ$D$t1Ht$0H=Ӭg-o ] m D HT$0HHHuH@HT$xHH$HD$0H@H<%3 =; t"$ T$h uHT$0H:u$L|$0Hl$PIGHHA Τ ̤ HH |H H- H HH HHl$P$L|$0Ht/? H=? $g .$|$h gH? =?  D$8t |$\=! HD$`HHpASD$@Pt$UD$DD$|HT$pH|$PK=( /=( "IGHH1Hg6HHHg!YH H=1ghLHgiH=IgshLHgh1HIgH=pgeH*HD$`|$hH'? Hxt'T$pt$\1grtgHD$0T$pt$\1H5H=gk|Ht`(g$' gWA=9B  AQ\$Aǃ|$u%$tD$XA„t EO1|$ D$XD=% t=`& u =[> u2A D$XE!D$XA|$D$ = g=DA 1goH-Hg*WHg)I HHt 8% g跚L== L HxgLH t$0IHg@LL$8@A_S< EE"$% g\$  T$PgL=< L HxgYLHm t$0IHgK$ZL$8@|$\w;  p; L/B @ M1H|$8LgyHg@(@H|$8g٣I}= t =&$ ugxȟ 2Ɵ Ф D$ t H=YggH18D$1Mt Lg袦D$L$ cg;:H=Y; gHog};X= gA9HD$`HxgHD$0gH;K=՞ gwA,< DŽ$H8gdL=ML9DH|$0Al$8DHHHPAH:-tZHHHH9uL$8t$0Hg补H AEHCH8gt$0L$8L9H눀zpz-uzuHHtHPH:zH|$0Al$8DA͋D$8%D$tV1HD$P(D|$D$L-Ƣ " gH=g$g-Ig9L=Y g?-I~$7 L$L$Lg= g?D|$Lt$H|$0gHgR\I~Mf5 L$I\$HgJL$=~ t = R L$$@! t LG=; :n7 /$6 z9=l; ,HH HPAH:-|$hHŠH=HDH H=7 H g H|$0H ЉH$ 1H$H=ۻgCuHt`(HD$xHt H H|$0g謢H|$Pt$g6 $:6 H=Ag!HJ7 gw7= g=HD$0H@H8g]%8 DŽ$HHHD$0H@L+L$L L$HtLgH;I L+L$=W tL$Lg L$H L$H;g&]HtP(L$@H;Lg݀It$H;g1g`s N D$XD$IF|$D$5 4  g $ i4 D|$ D|$Lt$ \$d t= u =$ %Lg荠H=}g-I D$<\$3DŽ$D$hDd$pDl$\=D EED $ g蓸\$|$\Dn g4= g*;LD$g4LD$gʹ݃=G tD$ttȃ= Z=% / tH=0 tgA띃= tD$tt܁sӃ^HJH9" MLg躚H- H=H- H- g4HL$T$8E1E1Ht$0HL\$hH= 7 H= gHH= U L\$h'L\$hH=d & L\$hLg L:- H/- M9H#- kH- H- H- H, Ht"Hg֖Hg蝙H, H=, Htg耙H, L H|$P= gJ$D$XHD$`HxBD$\#D$p1H=Bg?YHHH|$ Ig9H|$(g9L{ L L{ LL1v LVy Hxg蔾LHw HD$Hg.LL$A[|$$sz |$(iz HEDHx衫|$ Hʼnx D$,ME1x }1w H=1LEv EyxD$y`gj1gm\c usE1AgTH$8dH+%(HHD[]A\A]A^A_y fDDy D${fDgD1H5E1w LH1g苵A\w LL$|$ y |$, y H|$Nu 1L.u L$$T$(HLD$lH=- z H= z `} AWAVAAUATUSHHX Ht$HL$HDD$DDL$@~D% D9 H= `g>H$HHt @(H=`E1g>IHt @(H=_gx>HD$IHt @(H{gHD$HtAt HD$HA@0gZFHD$8D$@!H=|g H H;1g:Ht$8H=ޖ1g1H= 1gH= gC H= g1 H= g H= g H= g 1Ht$H=gwH=3 g H=e g H=' g H H2 gt=Ag)AAgf.L5v Bg*@HD$(Cg<HD$ MtiC(%  uYD$@uFLt HxgLHs H=IH1gjH=L1gXAg-H|$(t; wH|$ tqAg\$@uKH\$ H.t HxglHHr H=IH1gH=L1gCgH  L5HH8g`AHtLpHX H<$HgMLLg}MHcgH\$IHHgVMLq 0g袸H $D\$@HD$0LxL`HX Lh(HHhED E=u ,HD$H8gDD  EHD$DD$@@ o E=# +uj 1H= o }y Hv ~T D%1 9HR H=g-:Ht J 9H,L$@H|$0   H= HXD[]A\A]A^A_E1BgBgH@s CHD$(gCgHs HD$ @g*~nDH=g#U >1g}9g'9f | H|$g8'H@H$,LxBH@HD$UfDt$@EuKLt$(Lp HxgLH"o H=IH1g}H=6L1gkBg@$C(% J #HD$8L$@HfDg2DH  H;g#zfD gx5 Aątt nLD$HH|$1H  脶H AgHu _ fDHt$0H=1gD;HD$H8g{|$@t:HD$@  |$D1gS[Dg|DH=q|11gH/H5#1n DHH1g芬 gDAVL5~AUIATIUHgݳ H gɳfLHE@g1HH=g1g/LE1E1H1LH}AHtk Hk LgEHD]A\A]A^fDAWAVL5i~AUATAUHSLHXL$$Ll$@L$t$LdH%(H$H1p Lt Lo LL11k EL|$D$ Dt$L$$t$IDH(DE1i D|$1g$0  L|$H5`x1g H1gϨg gc1Lke  gDDH=}1gogC11AĉD$,ghKDH=D$(1gB1Ld HtM Iع1HD1g DA{h ZHg AWMAVAAUAATAUHSH(HGOP˃| &4;=tHPHtJH@HtH'q D (q  HEHxp Gp )HgpHEMDDDHx- H([]A\A]A^A_ÐEHx HtOOqp 9op HUR !$-Y H([]A\A]A^A_fDLHM+AAD$ ƒE‰€AQE5 uAADLMDL $ o L $o AQtAQHUHzHtOMDDDH([]A\A]A^A_顫BgK MDDDH] Eu5 \ NtD gNg3 H(1[]A\A]A^A_=r Dg D=n gDBg-MDD$ DH] En $. @ v $T$y ' gMT$$ gb D=m gDODVf.D$ L $g D$ L $DD$ =m g0D$ L $4HgHEHxt HtO% $g $$='m g$H=s1ɾg¦g7 AWAVAUATUSHHXH|$H$t$H$T$ HL$dH%(H$H1b 1H$qg H$^g HUCD$$;D$D$,H-|k H$0Hg5HD$1H`gh ŅEL$L$L$L$H$H$0H5 k g35LH$HDŽ$HDŽ$HDŽ$D$|D$xD$ta L1[f H޿Mf LLLgLHT$t1H$g6HLH$gLLL$HH$gHLHgHT$xL1H$gLH$H$ gcLH$L$IH$g?LLL=pHgyLHT$|1H$gqLLLgL$A@A@ÅD$|LD$@H$HD$8D$xD$`H$HD$XD$tD$DH$HD$HH HD$0g贤IA)HcӉHiQH%)HckdHL$P)Ӎ1HcHiQH%)N0kdL$n)HcHigfffH")֍N0L$m5DcE9AAIcMAD$M|$<%uEGEtMgA%APA@о< wEGMg9O1AluED$IARpAEfAUASDD$@HL$8H$ tD<E9RHcH$ IcLM|$b\ AD$*@LH\$0LH1Hc Ha La[ @HD$D$,H@HxHx5 D$,fDDLD)Fl(@IcgޢI[fDH\$LD$1L$ T$H|$$D$({@H= rg/IH<8H$HdH+%(D$(HX[]A\A]A^A_fSD9EHcHL$ ID$L$$txD$o HDŽ$ HDŽ$HDŽ$HDŽ$HDŽ$(HDŽ$HDŽ$HDŽ$)$D$,.DD$DHL$HH$ IrD<E9DLD)Fl(@IcgBIf.Ƅ$HL$PfDHgfffffffHcHHH?HH)HLHML)L$04HHu1If. A׍JHAuL$dgL>HcL$dAW L$nAGH AGL$mD<H HcƄ E9 tD$,L=AkA@A@L=9kЉT$hLD)El@IcgEGT$hIDD$`HL$XH$ pLGDD$o1H5lY t$oH1g軗LW HY p@A)LcMH=c ^ Y f.Hff.Hff.1G)fDG(%ff.G(AAt%E1=ADff.@W(1с  tD5  9w,uЃG( t 9G,G(E1%  uE1 9G,ADff.W(1u1Dff.f G,fDHH8HH0)u %Z @ff.@H?H6)u%ZZ f.ff.@ATUH0Hg[HIX HxgEHHYV ID$I$LID$ID$ID$ ID$(H]A\ff.fATIUHHH=T HtH;=P t0U HwW Hxg赜HHU H HL]A\ATIUH- SHtEH,W HxgjHH~U HI|$HtT I\$L[]A\fDg-HDATIUH-S SHV HxgHHU I|$HHtHT I\$L[]A\ATIUHHH= HHtT HWV Hxg蕛HHT H }t}t }u9H=Y g裛HHI H`T H HL]A\fDHU HpfAVAUIATUSHHtgvkH-a Ht M u1[ImL]A\A]A^Ð}gHH]a P~E1HJHtJ@LsLKU Hxg艚LHS HHHCHPg)kHHuH` ID9`[ImL]A\A]A^ATI&LA\AVAUIATUSHHtgjH-R Ht M u1[ImL]A\A]A^Ð}gHHR P~E1HJHtI@LsLkT Hxg詙LHR HHHCHgJjHHuH3R ID9`[ImL]A\A]A^ÐATI&LA\AVIAUATIUHH t?H/dT HHuLg>IHtV8tQHg`>tDL[Q LH11gHL]A\A]A^gzH1]A\A]A^@Hg?LQ H1]A\A]A^ATIHHgrLA\@ATI1USgsHHg5I|$Hg&HgdI\$L[]A\ÐATIUHH= tLI|$HttP H-} HR HxgHHQ ID$HL]A\fD^ u=4f gATISHg`+ HcgQI|$HHtO I\$HL[A\ff.ATISH`Q HcgI|$HHtO I\$LAL$(H[A\ff.ATISHHc=_ g蹱I|$HHtNO I\$HL[A\fDATI1SH(dH%(HD$1HKR H<$H+= H= gSI|$HHtN AL$(I\$HD$dH+%(u H(L[A\DQ @AT1IUSH@dH%(HD$81HHl$Q H\$g4 HSLc P1DL$RN HP HxgߕHHN I|$HXZHt&N I\$HD$8dH+%(u H@L[]A\P ATI1SHS Hg5I|$HHtM I\$HL[A\fATIHdH%(HD$1Ht>Hu*1r p HD$dH+%(uHLA\fHgtɋ$O ATIHdH%(HD$1Ht>Hu*1 HD$dH+%(u$HLA\HgWtɋ$hO ATISHgHcgI|$HHtL I\$HL[A\@ATISHg,gخI|$HHtmL I\$LAL$(H[A\ff.@ATIHH dH%(HD$1AD$(tdHT$ 1g/HD$D$ HED$1H= H #O H H HD$dH+%(uH LA\Ht$gD$ 1N ATIHH dH%(HD$1AD$(t HuH[Hu1[H]A\fDH[HsfN BfHq H01HLg”HHxH HJH9J HtHg HJ Hf.HAUL-ATL%UHSH[f.1HLF C(t)HsHt 1gPLH1^F H? H]HuH[]A\A]f.HWHtGUSHt Ht8HguCHSHH5I1[]%E DHguCHSDH{gHH1H5E HH[]%> DH{11g HATUHHG(u$@txH1]A\?fL%~H1LE E(t)HuHt 1gNLH1D H ]A\%> DHH5hS1D H|f.H1]A\>ff.@Ht-SH DHH;HtG)u[ff.fG(t:HwHt1H1gMH5nHH1%D Dff.@S>  t9 u%Dg 94 t, [f.gjL g9 t@HtBATIUSHHk 1LHgHtH@H- Hu H[Hu1[]A\1fDM ATU1Su1: 0 @ HIHuDQDI|$HtV?tQM 1u1u:  @LHtIAT$(t)uE1L[]A\ftuDI[]LA\DATUHS-It%Ht@(%=tQAD$)uL[]A\ÐHtAD$)tI|$guI|$HxL% HHDgħfH5S1,= HH1g{Ad$(ATUHH|IHt@(%=tUAD$)u HL]A\fI|$guI|$H?xL% HHDgf.H5DS1|< HH1g.{Ad$({ATIUSH Ht5DHk 1LHg薎HtHxH- HuH[Hu1[H]A\fDHGHt[]A\fAUIATIU SHKfI|$HtJ?tE +K 1u18 w @>HI9t.I9t)IMt AD$)tuE1HL[]A\A]ImH5N1P; HH1gzD tC,tH;H[]A\A]ff.@HHt@)uHfHH@H1uHt@)u HDHH@ATIUSH Ht5DHk 1LHgHtHxH- HuH[Hu1[H]A\fDG)uHGHt[]A\KHHuɐAWAVAUAATUSHHIĽ AT$(M|$MA?H Ht6fDLs 1LLgHtHxL5 Hu!H[HuHL[]A\A]A^A_fDHGHt HHtLIAT$(^IEtuf.E1ff.USHH@uQ@u HH[]Ð@uVHHtE)tH}gtHEf.FHHt 9E,u븐+HfDATIUSH Ht5DHk 1LHg֊HtHxH- HuH[Hu1[H]A\fDG)uHGHt[]A\;HHuɐHG 1H u1U4  @Ht@)u HfDHHff.SH= HtHxtP(рDщP([HH=K`HH鄀HdH%(HD$17HtHxHguu!11 HD$dH+%(uH@$e7 DHHt HDHff.HHt(C HHfDHHt= uz #HS Hff.U @Ht+HhHt" }u* G> ] ]Hgtɺ 1H8 fH1Ht 1Hx@lj=W g uH&D=2 gH f.AUATIUSHdH%(HD$1NHtHhHHt}u'HD$dH+%(H[]A\A]T' HH7 H$H9t:tILkH5K14 LLH1grHD$dH+%(uQH[]A\A]DʼngntH5F39 HHt g%LkH5H4 ATUHSTHL`MA$; HDPtNAT$.DHt5A|$u-ҍDBЍPw[]tG A\@H5J13 LHH1gq9G 3[]A\At$DppA|$d@΍DApff.HB H u5/ 5 Ht@)u HfDHH$@HvB 1Hq u1E/  @~Ht@)u HfDHHff.B 1u1. f @-ff.fSH 1Hg̈́Ht H H@[ff.SHX 1Hg蝄Ht H H@[ff.Ht;G(Hu @u HH5_~dI191ff.HH= BHtHHt8u1HDHǺ 14 Džxكuff.HH=E@HtH3Ht8u~^ Hf 1H3 Z^ HDHHtHHt8u1H@HǺ 1`3 He@HHtBHHt5d tPt@ td H1 !j ^C #HfDUH'HHt HHƀ}LHu}At-g u  u ]] @g AWAVAUATUSHdH%(HD$1; HHHH8D$Hl$L%2CL-7CL5;Cf ID$E(HUAD$(IT$HU IT$  K AD$(AT$,A}ItBEI|$AL$(L}AsfA}FuA}SuA}uLgrD$ [DAD$(cH}1gye ID$E("@Hs LtIċ@()fgxHC GtGLE1g諔 H}g ID$E(ID$빺H5@1E1( LH1gE1E1UhfDH ATHp IgeAL$(ID$LA\@ATUHSIHt0p(@u't1@@u1 tiLg IAL$(L[]A\ t>@t1HH=?gfAt$(I|$At$(gID$I|$gID$fH ATHp IgwAL$(@ID$LA\ff.@ATUHSIHt0p(@@u't1@u1 tOLgIAL$(@L[]A\ t$tHH=>1geAt$(At$(I|$gUvAL$(@ID$L[]A\fAVAUATIUHSHdH%(HD$1ulG(t`GLt$H1LgCL$IŅtLH1g&T$I|UgOIIf.u{H"y}tKH& HxgPkHHd$ IHD$dH+%(}HL[]A\A]A^Dg kIDG>&H% HxgjHH# IAD$(u 1ƒL1gwLI# UfDHHT$1gHNjD$gbgE1tLIHA}A}A}vL$ HcLcLhIHuL-`A1@giIf+IH8xxH1$ HcLkfH'}t}wILgJiLIH[" I|HM" \AHtP}t}td}IfDLghLIH! I<H! fDLghLIH! bIf.AkA1L5^@A1FA1L-x^/@Lg7hLIHH! WH" IAA1s}uI~AQHp" I]" f.AWIAVAUEATUHSHHHHCDLHIRID$AD$(2 AD$(- HL[]A\A]A^A_fDI|$Htx ID$Il$E1HM%A?AIu HggHABD+B+5 AD$(I\$Xf`Q1AHgsHL`H- MAD$(%==AD$(I|$ sA R@II|$Hth ID$LAjAD$(I\$ @81ɨLHHIL9{H mDA AD$(@H€AT$(At VGEDELHUl1Lg4HI|$Ht ID$AD$(@I|$Ht k AD$(Il$@MQ1Lg\AD$(>I<$gd@ofA t@HQ H9h 2I<$^IHAD$(%I\$1Hg1Hg111Hg*HHD. EuE1 _ ADH IHtX@)tRLH5#51LD$V Ht$H1g]I~Ht Af(IFH LDLYDHHƃg*IHlAD$(DLL"Hf.} }A}AH IDL1HIfDIuHg cHJ<+L fDgb0f8HDDLLbHf.gUb0HfHI|$g2H AD$(fHE1g4H1gH\ LgE1AuIu Hg bHLc HIItgaHI1HIHATIUHHH= tHHtH]A\@+HHuH LHE1HP H]A\YfAWAVAUATUSH(L= HH|$@Ht$T$MHN H@1H|$HgmHt^H HXHtNH{Ht Lt$L HxgX`LHl H{HCHt HCL= MaH-: MMCAG tI_ 1H|$HglHtH HXHtC)u-IW DD$1Ht$H;H([]A\A]A^A_MMILLH9Ht@)MIMmMuAF)tMIݐLLH9HMEMvLEMuAE) I}H01ghI}T$Ht$H([]A\A]A^A_P&I9tSMLH DD$1Ht$H|$HP MHE)H+1H5u,  HH1gWH= H+tBDD$Ht$1HH HP u*H H@mIT$ I}1DD$Ht$1IIT$ DD$1Ht$I} fDATL%,,USLH dH%(HD$1HtH Ht 8HD$1݉- ' THcŃcHigfffD$H")ЍP0T$)Ń0@l$Ht$1L# H(HD$dH+%(H []A\Ht$HgFl$݉-ξ M10 @l$D$@HiQD$H%)ЍP0kdT$H)HcHHl$HHB0D$HHH)Ń0@l$H5.1 1H1gjUW 0OfAUH=ATU_HL%# HhLCHt@)tLhMtA}/D@Ht- }H= *gpHHt$1HL{H(! H H-HHtHxHt g!u11H1H(]A\A]@ u11H5/HgYHg͊1HLV! H(iDL%L)H@) LhMA}/11H56/Lgu&11H5/Lgl@LgHHtHg C H=(g5# HŅHjfATL%h(UH(dH%(HD$1| Ht$ HcgItLHHt`(1HLH(HD$dH+%(uH(]A\V fDUHc SH(dH%(HD$1Hl$ Hgs1H='H1Hc Hgs1H=HHD$dH+%(uH([] fH(H= AtH 1HP H(fHt$H|$T$DD$Ht$H|$ff.AVAUAATIUHSW(ЀG(HG HAua1HI|$Ht ID$ AD$(tAD$( [L]A\A]A^èu[L]A\A]A^D1HLIHAT$ L9tM}L" oDDHD0tRAuI|$Ht Il$,f1HguH t AL$(E1G1I<$Hg!t Ϲ M4$t"1H5% LH1g]Pf1H5) LH1gKOH: vzDAVIAUAATAAUHASDgt?11DHg$1HtP(ӃP(DLHgIKfDHgMHHtP(ӉуH(uC1LH&IMtAD$(ƒE‰€AT$(u([L]A\A]A^@1L1HgIH5(1T HH1gO[L]A\A]A^f.gzE1DUE1HH H dH%(HD$1Hg1HHHT$dH+%(uH ] fDAU1IATUHSHL%Ƿ LgaHL% L`MI|$Ht9 ID$I|$Htg"Ht HgBHAT$( | Il$ЃtЃ €AT$(t  H=' gd/HL[]A\A]fDLL%  Hxg6TLHJ LHgdLH螶HCI:fAVIAUA1ATUHSH Hg`HtHL`H Mt8Au[]A\A]A^fLg#[LH]A\A]A^$FLeHHEgFLLeHH-  HxgZSLHn HHg=cHX[]A\A]A^Ht[Uw(HtH5 H=ЦkIHOHg֐H LHc 1@HI|ugYHD$IHIcM~1HT$"AE8EIIHtIL(EuLI HxgDLHǍCD$ HL$HIGHc\$HuHD$HHL HD$H([]A\A]A^A_HT$LH etfAA AfHD$HD$wff.SH Ht#1HgQHtH$ H@[fD1[ff.H= Ht4HH5gsUH=d g&VHS HfDff.@AWAVAUIATUSHt$1gHcA|(Hc L$ L%b I,$E}L41HH$HI9I,D:}uH$HL uH\ T$H L,H[]A\A]A^A_fDIT:)Nz DHz{D5H H[]A\A]A^A_f.ʥ P9T$ }iD$u9Hc Hk JL,HD H[]A\A]A^A_fDL HxgBLH1 I@pH= 5H gH HG nL HxgALH I1f.HH1HtB(uHÉD$  mD$ H@ tQff.@AUIATUSHcLcHHtw1:HuEJ< gALIH$ I<H L1MH H[]A\A]ztztHq Lg@LIH fDHH=HHt@(HXH=JHHt@(Hx1ҾgHHtqHxHg4t`H<$~3f1ҾHgpHgH$HH$HHgHD$dH+%(u4H[]fDH$fD1cf11 AUIATUSH H=N HtiEeHM 1fLH;HHt=D)uL< uHcH LHHD(H[]A\A]fDH[]A\A]DH %H= r  NAWAVA1AUATE1USHH/HgnHHc Hxg5HH HH؀8=IH; Hr1HLgBH#H HXHH{Ht M H{LcK(C,Ht HCL E1A<$IK|(LD$g5LLHK LD$IHAE=A<$u|AEHKY Eu,n u>H H[]A\A]A^A_DA?PL0 t¹1LHgYHL$I}IPL HL$iA|$AA|$A L IHD+E18+u AHgHVIH2L8A@(@LD$1H|+gELD$IMlLLǺlLH IH5 L!HMg:3IgM=H HtfDH5L tH5L Ng膢CD$HgWD$H[]A\A]A^A_èu|H 1@H諮IH@(ILD$IxgܤLD$MxH|+1g>IfDHg2vfLD$g2LD$ItH|+1IgI>HAVAUATIUSHH[HHs 1Lg@HHtLhMAE(t  AM, 9t5 9u%I}'@0Ht  fDAE(I}IE%= AE(Ht\ IEMeLs L Hxg0LH L1Hg@I}LhH} H [1]A\A]A^@L7 Hxgu0LH H}I H LLsL [1]A\A]A^[]A\A]A^g脾gff.ATIUH- SHt<DH] 1LHg<HtHxHΒ Hu!HmHuH-i [HL]A\fG)t5HtH5A H8[]A\ff.fUHױHt @(u7 u H]MH51 HH1g']1H5 H HH1g['fATUSH Ht8IDHk 1LHg;HtH@H- HuH[Hu[1]A\Ð@)tH5K [L]A\ATUSH- Ht6IDHk 1LHgF;HtHxH-M uH[Hu[1]A\H5 [L]A\-ff.fAWIAVAUATUSHxt$dH%(HD$h1֣Mt:M/Mt2fL ='EHuIM/MuH5ˏ H=& H5rH= H5H=-v  D E 1H5WH=^*1H5 H=,L%]Hg0H5"H="H5DH=oLH=`H5av H=MD>v EtID u HHEHEH=E IH-HH~H(L-bL躮Ht @) H-1H=H#1H(gx1HH===u  H-@u E1HL9IH-@( DAF( A$=AF(GLI Hxg*LH IFfDH5Lx WH=HBP(LӃP(gr4f.H H E1HLIHtEH(%1H5C  Ht$H1g; HD$%A$=ICDs E H-3s }/tH-V H Hd Hxg)HH H1HH=HH- HH@g苩1H=L5HSH Ht9Hk 1LHg6HtHxH-% H[HuHNj LLt$@E1Hp 賟HgjH5 LK( HCH .L HtLxL1HgRLL|$4Hg<Hc= LgCHHgHc= LgBHHgH Hg۽LHgʽH53p K(Ht1H=H=`H@)= t=5p HH=HD1g!H=HH/H g蠽g誾 q L%H= LgALHƩH.  ; tǺ LgAHL%L荩H H=xHt @)H=H=QHtHxHt$(g荘.1L%> LHHtHxH5 gUHm1HHmLuH 11HHH oLH-HH LH 11HHH VH=)HH &H 11HHH=H@ H ܎11HHH H=HH H 11H(H=HHH lHH H l11H(H=HHH@ H 11H(H=HHH HH _H 11H(H=nHHHX A\%5 DDL$ H51 DL$ Iff.fATIHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1=2 1gyHLH$H=hB $HD$HD$ D$0HD$4 H5=B  < u>H51 H= B H1 H=A (  gIHt01H5 H=A LH1 L%eATIHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1fHLH$H= A $HD$HD$ D$0HD$ H5@ N m uHD$dH+%(u*HA\Ë\i u Ni =Hi gҞ ff.UHv 8 HH=~]H1fATIHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$11HLH$H=? $HD$HD$ D$0HD$ H5?  g~ff.ATIHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$16HLH$H=> $HD$HD$ D$0HD$ H5>  HD$dH+%(u HA\ fDATIHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1F1H5 H== H1 HLH$H== $HD$HD$ D$0HD$ H5=  HD$dH+%(u HA\{ ff.ATIHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1&1H5 H=< H1 HLH$H=< $HD$HD$ D$0HD$m H5v<  HD$dH+%(u HA\[ ff.ATIUHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1ɼ (rH=; HjH1 HLH$H=; $HD$HD$ D$0HD$V  H=W; HH1@ HD$dH+%(u H]A\/ ff.@AVAUIATUSHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HIg=EL HÅN50L D5e L E HLHC1UH=A: Iؾ3 ZYH$H=": HLHD$HD$ $D$0HD$ H59 Y f HD$dH+%(H[]A\A]A^A8$2HL LEtsH=t9 AL1HaZ $DH51 I@H=)9 L1H DH51 Iqa g AT1AԺUHHMH 1HcH4` DHH=H1fH5HcH H41% fUH5P H1 HH=H]H1UH5?H1Ⱥ H]H1Zf.UH5$H1 H]H1*f.? $1ÐH@^HЃ1!BHbHff.@USHb Xb Hb HcH,DH}LG(Mt L H}LGMt L H} Hb uHzb H8q Gc H[]uff.AVAUL-Ec ATL%Lc UH-<` SHMufDIA$< t< tMtA}uL-L5ZHt@H51 HMIHLL1gH=a Ƚ H-hIMtA}L%RuL-IMD UHtla 1҅Hg)Ht @(@u H]H=Ea G ff.@AUE1IATUHH SH(dH%(HD$1Hgr111HHgIH HxgOIMHH1HH H }t LHLv Hm HD$dH+%(u H([]A\A]Է @AWAVAUATUSH(4a !~-+C(t'CNL%` [Fb@; Iċ` ,t)t1H5߶ HWE1C}` HAH(L[]A\A]A^A_P` I0` HI@` HI@_ e=_ gH_ 1҃LdPLg+_ HŅu H5o HH=F HH _ ~_ L=k_ H`_ D5I_ L- 8_ D$ H]_ H- H HD$H;_ HD$H H$_ P(D$ L%^ ^ ^ HD$L=^ H^ HD$D5^ H^ H$L-O HP H-Q HR DH=^ H?Hf.H $H- L=@^ D5&^ L- I|DH H ^ gtHŋ] uH5 HtBH= HH ] H=] Hű H=] Ht?tH/1H5ɳ HA1H5 H%DS=[] HuMfD8] Ht6xN 2(N 9XgH.O fo Lfo HPN @8N HHPHN HPHN HPHN HP HN HP(N P0HcM J M H M H HxgLH2 lN HN HrN XN H=N H*N Hϲ HԲ HѲ H fDsIċM ,tH=M Htޡ H=M Ht̡ L HL L HH)DEHDBBuA_A@E1ADPIEHIʼnBu<_t$[AH H=\J Ht H9HL HxgLH E/ J Hŋ$J H J D%J L5J I D$HJ L-I L=I HD$Ht I HD$Hf HD$Hb HD$ H^ HD$( 5I D$HL$AT$I D%vI H I HL$L5oI H HL$L- HD$L-H H3 HD$ H-wH H( HD$(UH H D5 D%TG E1EtD5QG Et AA <$]Hg=fHH1Hg_HH C)HD$0<$]-HgkD;%F  I !, H=F  fH% H* H' H f f_MAD$Mt$<==5(G AM11DHgH=FG <$]~gyHg$5F + gCD1HF F @HHBDPw %EDLD)DD$<@t5<_DE1D^$F AL%E M A>>E #D [11LgHA<]LL|$]L%E E/91Ht 85HD$0H-3 H4 H5 H6 @)E qA??)!u5IE A!>@DŽt5*E A@u@@t;A|$=5gC A AIC Mt$A 'E[K&u5-C A<&|<|5C A1H5Ҵ! H1H5 H}G 1H5c H[1H58ǘ H?H=~ 3*u<*u5lB A GKՀu8tfD<=.D5;B 1H5m/ H5A Lu,x@v< u>Huu9DIA w׀-t-H=CDJu<_uE1-AAPH=E1-AA1F 41H5c HIDH= gvHD-@ 5@ A fHfo? fo ? H|$fo? H=? H$fo? fo%? fo-@ fo5@ fo=@ dH%(H$1)D$HG@ fo? )L$ fo @ )T$0fo@ )\$@fo@ 5B? 1@ )d$P)l$`)t$p)$)$)$)$)$H$ 9H=? Htϓ H=? Ht H? H? fod$H $> fol$ fot$0fo|$@)%> H$fod$P)-> fo$fol$`)5> fo$fot$p)=|> fo$fo$H> 1fo$)%a> )-j> )5s> )=|> )> ) > )> )> HtH$dH+%(HfDH|$&H $Htfod$fol$ fot$0fo|$@fo$)%= fo$fod$PH$)-q= fo$fol$`)5k= fo$fot$p)=e= fo$H= )%^= )-g= )5p= )=y= )= ) = )= )= R fHw 1ɸaHt"9uHcHw HHDf.1ff.fD= ATEt ru+txHaw 1ɸaHtR9uHcH$w HHDHt6VՃu.E1-D AHD.wH˱HcHfDADA\Ë"=  = DA\Ë<  -ug[ϋ 8 uŋ= = DgoDA\Ë! t< 뒃+ug1p녃-u! rH=M! goo`f.HHc Hc H|gH$v b1H=~< AafDDBH:AHD?t HcD 8uڋ  t Hcփc t HcփsHc0HfDHg!H u bH5; H1yH6@tHcH@u0HfHt3H6 P56 H[]A\A]ú@H=A6   6 Ex^^HcH=5 Hg 5 H5 9~9Hc)HOHHLHHHfBHH9u5 =|5 .ff.@SH=\gr]Ht[Hy Ht 4 uHu H HHHE[ff.fATUHdH%(H$1IH$L L9 Hp HL1  ~:Hq4 HHBH @HHHtB HH9u1H^ H$dH+%(u H]A\҉ fH)4 HtT *4 tJ$4 t@H74 U fHcHH;xt9t+Ńu]fA-3 ]H51 ]H1ff.AUAATL%3 USHA;tOH5P3 HcHHDjIc fZ B:3 tHDAH[]A\A]fDHHH2 @ff.fUHcSHH2 HHxHH9Hʸ@HƃH9u^9 L |yHE1#@<ADADHH9t.HH @ Aщƃ@~̓ADHH9uIcDLAH[]魵@HcLHgj Hk IH1 HHxHP6fDAWAVAUATUSH8t$(T$ HIIHHIHL9uHcD$(H;LHHHD$D$ H%HEHD$ D$,D$ I9AƅH @ T$(E1yE1H{HtDD$Hg DD$EE'EHI9t1HT$ Ha D$ I9AƅxHcKHnH13 H  D$ D$(DD$,H5[1I HL$Hp H/0 H@t JAG <AAAQEL Lxp D L$H5ӤE1' DL$L IL׾@1H H=p I9cDT$ EAD$A9GHADD$HH=Aӊ DD$E!DHL$IH. HxL8LL . 57 3H ݅ I9H8H[]A\A]A^A_%} DH51M HL$Hn H^. H@+D=G E1H5 Hn HEMI9HuDL$ EAfADDL$ HHPH=in I9TH|$H: H|$?tLHH16 AG <t=uADL$ EAI9t EE!IAD$ A9G H1L"HGƈ AG <=AyDD$H51A HH1n DD$B=V, 5 @H * DEg@pHH= H=, HT$HAH J qDLgD1H5BIh LHH1 D1H54 HMl H0DL$ )…EAE <.H}| Hk gH591I H=k MHI@1P~ H=k @H5E@1H5\ Huk HXDH5ҟ14 L{ ?LH|~ { HI9@H5 DL$@H=}{ I@1} H=a{ l@H8[]A\A]A^A_fAUIATUSHcHHAt|9- A+t9- A- DEMH"L1v H) LDHHxH) H؃HH[]A\A]H) HD`Au9- A+t@AHA) LHHH@HcHH1[]A\A]%̄ ff.t 9Wt1HH= 1HAVAUATAUSHdH%(H$1IL$L} L/ Lf LL1{  ~I1fH9 ~7HU( HHtt;huH DH9 1LE{ H$dH+%(uH[]A\A]A^} @USHHC Ht HH9tz' trx H[]H]gYH5O H9tg'H8 F' P| H[]% DH-]gFYH5 H9tg&H- & Hw H9uHu{ B #DgUtԿg&H; ug̎ jz H=Ύ  AWAVAUATUHcSIHHk& L4t! |L4M&HL95ߊ L95ڊ I>E1Py MnLHHH}Ht3y HA&y I9uD)%b A~uQ 1҃-h D)H‰: I~ HtgOLx -7 tmHc* H% H<HHc H<HD;= t D;= uH[]A\A]A^A_H[]A\A]A^A_ÐH AV! IvHH H9{HHuA~McfH51-z uHL1gܸH$ DH= lH5 \1ɍ@HΉ 9tR5 E1fD9t#A9t-yAHcH<tE 9H  5 @ 9~ME19uXHg H:a WI 1ɃIHcH1g1J HfH=rn t)H5Z d x>2n u&1HH= ;b ǃtf111g̸ff.AVAUATD%m At-HfZ DHd x4E1DA\A]A^H= a Aătf AtD5! ^ DH=~HcD1g苟fZ  ff.{ƒ<EÃfKƒN@AWAAVAUATUSH8dH%(H$(1|:H$(dH+%(H8[]A\A]A^A_%` @ALt$ L$L_ Ld L_ LL1[ HT$1gHD$/HcH 5l L4H؃bzEu_9ucHZ{t{ u1{D_ CuAAHH[ J0H9ZuG9HL$D2` HL$AHtH H؋BfD1L(Z H$(dH+%(uUH8D[]A\A]A^A_E1{^ @DD_ AR\ fAtWAtQAjaHJHf.x u@HH9uBBB#z_ H H؋BDAVAUL-{ATL%t[ USLw[ Hxg赠LHY LHgH=! gH=  gyH=i ggH=V gUH=a gCH='W g1H=j gH= g H=ƠH1gH=H1gyHV H H` X g.V ~CE1L%zHAKZ Hxg艟HHX LHg,D9uLg[]BX A\A]A^ff.AWAVAUATUSH8|$Hl$ Ld$$dH%(HD$(D$D$D$AAfVh tD 1ۅu 8h U uEtd k t'W tH&i H;W[ u H@|$EH%^ D5U Aŋg EE~tAD5T Ehc @DQk Et,D V Et Hh H;Z uH ET$ 5S Ѓt~у}S ~Ѓt D$-g LDHHuf.HHD;kuDt$ g!DgD$ Dt$$=C C@f Af L  Ic1E1HD$D9f 1AI4DNHNDH˃F HH9t/1{ ‹C <uEt ăADHAH9uхFME}D$FR JEADl$EDd$ED Et= t5i jHD$(dH+%( D$H8[]A\A]A^A_f.EtET nD\$ET$t |$y\Dd$EIgHU H%-\ He HH;W |$gQ S D&h EH=1h SZ S 89=gQ zEqEc@t$ DgsDgJDžx T$ DgD$ t < Q c Nf؃ P H5[v1T H1g]=2_ g.=_ gAdP izR E>HF(F*c Ht&H~0HD$Lo I4‹FHF(u O HD$I‹@"L$D9ED$O EgAFDNtd.c tZ c bO D$Dt$]fN D]N EFN O D$Dt$X T$ DgT N u{aFu.HD$I‹BZa Dl$EeT$gtT$L HD$M I…M Ht$IuBufM gt$C ƒ{<DED- M M gM u\H a H2H9tIH;W HgHu2 H` H|HtH Ht$H@HD$I‹B H;U wCH=  /` zpDM EuNgu?HH9P t/D O Eu#HcH9` |$g |$gDt$DK C G<Eы-L 7 L gbHt$H L H@[JgDHu Ht$H@#gtH5_ H0H96gH5^ HHu0H9D$O ff.fUSHM aK (HËRK t+H[]D1I+H[]USH0^ -"K K ~[1H9~HHq HHtxu@tڅt֋ J u1H] 9B t9H g-J u;-J uH[]vJ 1eJ H[]ff.HH D] tI u HHff. ] t6I Uu\ t]}D]fDff.@ \ t6I Uut\ t]-D]fDff.@ v\ t60I Uu$Z\ t]D]fDff.@=  t ] t@H=x \ t0tTH[5[ t9 H u/HfD[ tH uHff.@ZH uaff.@V Uue[ u ]fH-$HgKHH$H g6HHG g!]HG H5)ggg]ff.fH7H5G gJ H%FN ff.ATUSHdH%(H$ Z u*H$dH+%(H[]A\HL$HbM HR HR HQ HQ L!M 1HLcH =Y O x!wY 1L;H 1B@H 1L(HH +J ff.AWAVAUATUSH4$Hl$0L$0H|$LdH%(H$1fL L11G L Q HBL HP HP HP H$HHHD$K HH1AG Dz ED Eu $=Q D$tugL5iyDbG 8 I1LF 1L1A gO TS ۅD1HlF O Aą{( W G 1g&-S gsD 8W E u 93W <@5 *N $= 9=W t  { GH-V 9=V xXI V =V H-V uH\$/f.E 8U}H`I Ht9Dr H=g1gc= t$;=;V tJ = J H= t |~g#g=U 5 ?DL H g1H B HX H\$HHD`HXH$ H#HHH9uHL$tD%SU U ~)L Hc1I AHuqHH9uDȼUU Ht$1҃;U D%T C H$dH+%(HD[]A\A]A^A_DHyHD;`tHH9vD;`uy@kT $ 1gHD$HD Eu FT  SH-$T HgfDD% D:A Dgg gHt$gM1Q=+ Lc- 1H5eD HcHL1gzK=f ]Ht$gxHD ff.fAWAVAUATUSH(4$Hl$L$HdH%(H$1iF HK LRF LH1A R  ? ? w  D= HN XD%1V Et,-A t"HkS H;E uH f1A211LHHD@ArLc 7R H= 1E~H׉HHL9uAD Et,DQ Eu rM *pM  @RM = H$dH+%(NH(D[]A\A]A^A_H-9HgH9HO  H] D=J D5O EJ  J g0uADR D5g  < S Et.D/> Et"HO HtH;A )fD5 ; = 8 H&H9oO HtHE jN At#H IcHƒSN @eN HLqN H I9@=I gT]HpH;XtHH9;XuAHR HcAHЃxDgD=:I gH5M HRH9g~HM  d=H gH5iM HH9tg*HKM Y E ȃ AD4$AD 5+ n A=L 11AE Ic3fHL  Hge# DAE D=G gX  He H DJALBL@tBHI9t:x @~D`K EtAtu/G &G 54K kzgD"Z=/K 1A1L9 H5]1< HcHH1gyH5BK H9gH'K 5 ƒ DDB=Hp E1H HHrH@tHH9 h ~H $D5I H $ED9%IJ tH HBtH $111gVHw H $HDI EBH $g襻H $u#=fJ =N ~ =L H $gkH $t =,J =G t$H $g>H $u =7J H $H5 K< H= ~= H H $HGDH $gѺH $H $1Li7 1gH $HHH H $8 P< H H $HgH5H H6AH9^\ @8H $H H $HH H! DH $111gIHj H $HgHF H $HG  HH=TK v=  L: 1LHE5 11D1LH&5 HA1DAEtZH9 H_> L9 1LH4 1҃{Lu4 { t4 HS9 H> L<9 LH1~4 E ~,H= H|H HHH9u1L84 =  I t(4 tHGF H;x8 uHkDH$dH+%(IHD[]A\A]A^A_@HqHD;htHH9VD;huyWINfD5D t 1 uD7@fHY HtQD Y EtEDQ Et9DHb  DHcHHD;ht9t*ŃuAu@ADx Ef1H5*W5 H1gs뺺H5AW1A4 IcH1gr*5 H=G 9 AWAVAAUATUSH8HT$Hl$ L$HdH%(H$(16 H; L6 1LH2 HcHHL$HD$H Hȃx=HHH@HHHH9uDx1L1 A@1DAăbtF t(2 tHC HtH;5 DHE5 H: L5 1LH)1 H HL$HHG@1LD$0 |$=DH5 H9: Lp5 LH10 H{ H\$HHt xuH1L0 H\$HtED;AIfCH$(dH+%(H8D[]A\A]A^A_0 8  A w1L/ H4 HQ9 L4 LH1/ 5D1L/ H5TT11 sH1gpHO HL$HH=mD 6 1 4 H8 L3 1LH./ sAWAVAUATUSHD-(- dH%(H$1EHL$IH{3 H-8 Ld3 LH1. Hc@ 'H=^ 1,HtFt ~t*HH9H4ADžuHt~uFuD蘡ƒ<DEHNHDHH:HH9u@MtAfEnB? t%蝷D2? Et=+ u 1Dggi1L- H$dH+%(HD[]A\A]A^A_1L]- H2 H6 L1 1LH/- => nH wHH9QHTHtzuBu1L, 9 j9 v9 |5A t$ &- tH> H;0 u H, 1IeH0 H5 L0 LH1&, Hc= ~SH 1&HtFt ~HH9t"H4ADžuHuHH9uf1L+ V1f91LA+ DA? "< [ fD=B8 gB8 g"8 =8 gsDA_- H=? 2 ff.AWAVAUATAUSH8t$Hl$ L$HdH%(H$(1G/ H3 L0/ 1LHr* w t; 9% H IcH\$H,H؋@D$|$u}DL$EusH-4 H5N1H, AT$HH1gj1LE1) H$(dH+%(SH8D[]A\A]A^A_fD;Ht$DD$HD$H] H`EupJ LpH Ku)D9%: H 6@tD9%: H gHJHEȿAT$1H5H/ HHtu؋r" uԾH耪95 t|1L$ H$dH+%(u~H[]A\A]uH= Ht t# H H  fDH=q # H4 H4 & DATUSHdH%(H$1IH$L' L, H' HL1# }4 ~GH HHBH fztHH9tHHHtuJHH9u1H" H$dH+%(u H[]A\1% ATUHdH%(H$1IH$L' L+ H' HL1B" 3 ~xH HE1HBH fHHHt zAHH9u1H! H$dH+%(uHD]A\fDE1M$ ff.f  ff.@ D= f=2 ATD%l2 =f2 thA9tuq2 9g2  DA\Ð( 9H2 *2 @2  A9tЅt DA\=2 4& =1 1 {Hr ]H=1 g11H.ff.H1 uR=1 x"51 9u1( u |1 ~1 HÐ&5`1 yHfUSHcHHc1 x$9HN9HMH41 H[]Db HgÁ0 HcЅyEu0 fD0 ATUSHdH%(H$10 u(H$dH+%(\H[]A\DIH$L# L( H# 1HL ]S0 H H1HBH<fHH9t8HHHtzuHr1HDHH9uHH9uL / LcMuM9/ H' D LDfDHL9toH2Ht~uH~HEtkHHeHH9u / ;HtH1HH9uA)HcL9~HNL9uf1H S1fDHH9u. ~HW D H|fDHH9tHHtzuEt JfDLBL HH|H1I9u56. ;quH=W. A1E1@1L :. x ff.@AWAVAUATIUSHdH%(H$1HH$fDHG! H% H0! HH1r 5- #H=- E1E1DMcID9~,J?EnHtPEnu@u@A92H JHHHHHNHH9uDp1H ( t =( gR( . DIMtE4$IfAT$A? , I@HHH HHHH9uEnPH=4>1DgӄH= J?HP5R, g:11H H Ht"fst {1HHu =+ t  uH=m Ht n u-H$dH+%(uBH[]A\A]A^A_E1!C H H   5i+ H1eK+ t uHHff.AWAVAUATIUSH8dH%(H$(1Ll$ H$L) L" H HL1T H=m* g_D=* EgY uPD=* EH V Mc_H LHH|At t D5 EtE9uAE9H=h J8g?`H=P IHH9AHHAH9uHHHt1gHHIH HHHu ;Y) H:H AGt  D4 1D ) EAGEtAGH111x@ 1x H@ H9uu ҃AWH=#gH/HHD$ Hxg_Ht$H1 H2 IIcMg AIG(IG0LH@1gK1H Hg-=   9  t=u gD z = dBg5m k . 1Q Y =G 54      ( -  9H=C k  = 9t1 H5ng= m-g| u18^ H[]␺H5T31l H1gaQ?  -3 % 4H=1  { w ;   =  Ńt9 tht H521 H1gPb H501 H1gGMU -S Z, tƋ: E1@ x_ = ;= ?9= 31x\  mfD2  H511 H1gO   5 1(H v x +-p H5/11o H1gdO H= ff.f=& u 1nfDH 1HSH5ff.H=   Gt H ff.@ G{ f.@U=w gq> 9 u& i  tg7g1>g虳AVAUATIUSHHH?H uDHI9DmE1L= HgFDmtH HxgQHHH[]A\A]A^% fLtYI9sfDLH[]A\A]A^F 1HH߅gHI9v1M II9w  1LH߅g[tA]LAE Hxg QLH A]O@T$  T$ HI9MIL9EuAE1Hߋ5J LgEutL# HxgaPLHbfD]LE Hxg5PLHI ]|I9jfAWAVIAUAATUSHH(.HL$LD$@tG~~t H H@*u{(.D;<*{HgO HA*E* HUIHfDH HuAtx*g*H= 1LDw H1E g5AH9t H\ At>MuA>t_A~A~InA@1H([]A\A]A^A_HH؄!<DLE11Hgo_AD9AuA1EuI9wIcHD$DII9{5y 1H߅Lg]tAHD$M<I9?M9vAuIM9rE/A1LD s HE1 gE/uHD$L0HD$L81E11@{(HD  EfD@*| 1LHߋ  1 g0AInAd@x\HH9H{AA)DH9t Hx\tXLD= EHcHH)ALEL9s!DAII95 = 1҅L1H g;uHD$L0HD$H(?DD5 1LHEg[IcLAHEI9v&f.AHI9DmE1LDȫ D ) HE1E g~Dmu:IIL HAI,Hsff.AWAVAUATUSHHcL7IHdH%(HD$1AH$<'HL-MlA?Z uVAIcLD5At\<'tX <\u E~IcHtADtAIcLD5Auf.<AHD$dH+%(HD[]A\A]A^A_@I1L<$HI)L HvRL<$A9D|5'P|5E~57k > t%A@H5fAHHL<$1H)Lg HHvL<$ A HuA fAWAVAUATUSHH8dH%(HD$(1HD$  H L<H:AE1E1H|gHIEEALAAAL jf.MLL|<u E<u E< u E=  LkLu~Au MHHu@EHD$(dH+%((H8L[]A\A]A^A_fD E1E1Du A JHuuAEH&HD$ LDL$1LT$H)HL$ HDD$HD$A DD$LT$LhHDL$v)HD$HD$ LELE1E1E1-HHE1H@THH9ufE1Lz f.AWAVAUIATUSHXHT$DH|$H4$dH%(HD$H1HD$8t<'uHD$Hc(HD$L$(HE<$EEZHD$ D$AADD$fDAu |$|$tDH9,$„t d uJ HE8uuA}t{DLggHuj=' ~AA $H=f JB@HcHD$L$(E<$EE(H|$ t H|$ ]HD$0H|$gqHt$HT$HdH+%(&HX[]A\A]A^A_H$LH)HT$(H`HHHT$(H|$4L HHH|$ t$4H|$ r H<@@HD$|(cH$HcH9H|$ f.H$1L|$8HL$8LH)HjL|$8DHD$Hc(IHl$HW$Et'1ۀ}t}t}EHxgfCHHzHL$mfDyHD$@HHD$Lc8HD$LJ,8[HM$M'PHLl$L5dH= A=w LcKt=t'uHD$H0H|$g}fH/+11LHtXLxJ<g+BLLHD$ HfL1Hl$@HL$@L) HvHl$@EAH-'E1f.AWAVAUATUSHHdH%(HD$81H ?Ht IHt>uDHHxgAAHHD$8dH+%(HHH[]A\A]A^A_%3AH1H|$(LgHH>H|$ H1gHHHL|$(Lt$ AA8AYHHHMdM,I)@IM9{A]AE1L= Lg A]tLH|$ IfLt$I9tH|$(iHIHxg?HL$0Ht$LHD$0IHLA#1fH|$( LDHIH9 HD$8dH+%(HHL[]A\A]A^A_fE1LDHIH9uLt$LH|$(HHxg ?HHImDH|$ fDME1IEIL9tIA$A$1L5e D$ Lg D$ A$tL&H|$ IQ+HHHMdM,I)fDIM9K 1LLgo tA]LAEH|$ A]I@ME1IEIL9Iŋ  1LLg tA$LA$>H|$ A$IeDH/Hxgm=LHICUHSH0< v;tH[]1Hg}uHgH[]Ðg蚮t@AWIAVAAUIATMUSHxHL$dH%(HD$h1kH9LgH1H|$XLgDHHt$`H|$PLgDHHH\$XHD$`D$Ll$PD;HD$(AOփ2wHHD$ H߉L$nL${(A*FA?<AO߃w#HDT$T$f.H< g;Iǃ*A*IOH@HHux*&*Hq1LL 1 gL9tD$LD$ HHgOl$HccH;J|%Hg?1HMHAVHL IH g12XZLoHD$dH+%(H L[]A\A]A^gHHC)$ARI1HLg)BHcH;E1RH|g0L MHI1HH SgHf.1H6IHMAI1HLgAHcMZE1A>A~AA~A{LIjgHfHImH{g/()f0I@Ae@E1YJf.AVAUATIUSHHtG?HIuQ1E1Ic})HL9veLLHfA]HA]HcA]HL[]A\A]A^DtZtdHL$HL$IƉD߉ǃ))LHcH1g.Ic}Ig@ADA4LcIA8(ttLH AH "f 1Ʌ HL郗fAWIAVAUIATUSHxHcHT$ L$LIHt$(LHL$DL$dH%(HD$h1LD$HD$XkD$LD$HA?HtDAD$t5AD$Lt#HT$0 LD$HT$0D$f.HD$8zD$HH$8H<$D$0tD$0fD$E8E1E1҃DD$HIDEEEEFE=D$ A#wAA\$BDt$EHD$ 8D\$HEt HD$8DT$0ExH$86A`A'A"= H5M )PDH|$D$HwD$HeHT$0LD$GLD$HT$0D$HB@E1A Aƃ=" qH=L  viLc@OD E DI9;AHcA|-HT$(DE1++D$0PT$TD$HD$(D HD$hdH+%(HxL[]A\A]A^A_At A\E1ALc\@=- H=L txE1LcH1Ld$XHL$XL)L5Hv'Ld$XDHLc@HuL$OLHcT$HLL$@LD$8LD$8LL$@L$O3D$L$Ht$TLDL$HL$HT$ DAD\$TYHcD$TIH9A7 jE1ifDtCD < tH5SD }= J  fDH1Ld$XHL$XL)LHLd$XLckL$D[Ht$TLHD\$T HcD$TIH9A[E1Lc!C| (T$D[Ht$TLD\$THcD$TIH9@L$OLHcT$0HLL$@LD$8LD$8LL$@L$OD$0Dd@H1Lt$XHL$XL)LHqHf.E1LcRfD$0c\$TA'ts1HL$LcLE1fDALcHT$8LD$HT$8LD$D$0DLcLd$`HD$`Kt 't`tfD=m HBH=I t=x4LcKt )'uLcH1Lt$`LL)ZHvLt$`Lt$XHuAzfDHcg%HcT$TIHD$(LHc0LIHcD$TAfDL$OLHcT$HHLL$@LD$8LD$8LL$@L$OA'D$HL$Ht$TLDL$HT$DAHD\$T8HcD$TH9XE1Lc H1Ld$XHL$XL)L9HwHfLd$X1H5'U _H4$LH1gAWAVAULcATMUASHLHHdH%(HD$81HD$(LHD$; 1 D$IcH4E1EAE1L-EEDEu{\EY`h[]t`'"$=t AT*AqDE]uAPENjD$K HD$8dH+%(WHHD[]A\A]A^A_D= ATD Et/x&AE1IcH4хoHT$DD$1HL$(L|$(H)DD$HL|$(AE1`Aă=C ATD " Et mH|$(HT$DD$HL$(H|$H)1TDD$HMH|$AIcH|$(AAIcT(t {AIcDD$$<WHt$$(x1HHcD$$IH9D$<DAE1Icf* t HT$DD$1HL$(Ld$(H)bDD$HH#fAE1IcfDAAIcfDAIcA't_Ht$D1H ADLd$(ADHAfDAAIcyfDIcL|$0HD$0H4'Dd$MEljl$HEATud= tjxaAIcHt'tr= AHAIcffHT$1H\$0LH)HviH\$0AvHDd$l$EtAIcE1]HDd$l$EA LHH HoH1D|$cff.AWIAVAUIATUSHH8Ht$L$dH%(HD$(1HD$ QHHD$Lc0K7MH7LHD$3\$H-?Dt [;A8Eu A}LgH= ~7IcI4DuK u3AMcC47t>\uC|7t-AAMcC47uf.H D$u 1D$H|$D'HT$(dH+%(H8[]A\A]A^A_f.L\$1Lt$ HL$ I)LKHv=Lt$ A31DL[HcA<]DDf.H'fHD$Lc3MK7AHD$DL0g-#fAWAVIAUIATAUSHXLc>L$J4?LHdH%(HD$H1Ht$HD$8Ht$LHD$D%EAAl$tD@DE.D$E1LEEE?A\Ay$}`$mAIcM|-LcK4E1AA`ALcIcK4M|-Mc؃t$DK4@HT$DL$01HL$PDD$(L|$PLT$ H)LT$ DD$(HDL$0vAL|$PDADHHEMCD/T$LHt$LLT$ DD$(DL$0L\$8H]L\$0Ht$(DL$ ?DL$ Ht$(1L\$0 K|17AdfE1LH HcR A1Hc2HD vff.ATIUHSE1HcЀ|)t [L]A\XA4$Hg薖A$[I]A\LAWAVAUATIUSHdH%(HD$1H$yHJI111L5H.WfD=U S~7HcI4AuP2 u8S9 HT$hdH+%(Hx[]A\A]A^A_,$AIc AAIcfD'=HD$\ALl$\DIcH4tj'a= H=[)D a EAIcH4uf.E1h$'DT$ Au<D$ *|$Kt [}E= AMH=(%fIfDAAIcfDLT$1Lt$TLHL$TI)LH&Lt$TAL$JH|$(HT$@D\$8t$0gSt$0D\$8HHT$@L$JYAIc0DD$LDEu<(E<{D$ = |(HT$8H=Vt$0L$@gßt$0HT$8HAGHcЉD$P<LL$@(HHt$PfT$fAHT$eLL$eH c*fDL\$DT$01LLt$THL$TI)LkDT$0HH!AIcHfDAkfDLD$1Lt$\LI)LHvLt$\AL$Ht$AWHE1HcIDALt$TIcDxE1IcqAE1IcYf|(4AGDT$0HcЉD$P<|'= ~DAp 80AA9'AD9fHD$ LL$ fIcH4tZ'tU= A AIcH4uDA}@AA9qfHufAWAD5 HD$(dH+%(rH8D[]A\A]A^A_D`fDAD9ffDH|$ LL $LH)H|$1YL $HSH|$AH|$ E$A9 f|AT$LHЮA9_HD$MD $1I)HL$HD$LĴD $HvYHD$AHD$A9fDHD$M1HL$I)H$LyHv H$AHD$AH4 H:AWAVAUIATE1UHSH8dH%(HD$(1HD$ LIE1LbAMcJ|D?A\!EE:}A't`A"=3 DDA' )E  AA9vAA9dE1HD$(dH+%(DH8D[]A\A]A^A_DL$IcLL\$DD$H|$аH|$DD$LWL\$DL$DED)AD9o@E|$D9]T=! ~CIcHtAu>= tdx`u.AA9r@AD9\fDE$A9?AD9,fDHD$ MDL$1I)DD$HL$ HD$LֱDD$DL$L=HHD$AHD$ A9bA'>DLHDL$DD$)DL$DD$LA ALDL$HL|$ DD$L)1HL$ #DD$DL$LHvL|$ AHHAWAVAUATUSHxH$H|$t$XL$,DD$$LL$PHD$0dH%(HD$h1HIHHD$`HHHxg/A}HD$8IHD$`M1E1HD$E10DA< t< t AAMcHHcM|5A?tSHD$`H$vHT$8N"HvLD$H1HL$LǯLD$HHH$HD$`Ld$8HD$A$MHHl$1#@Pv< u(EHLgHEūD$$D$(HD$D$$H|$8T$HD$OADL$HH|$L}D$9|$OHT$HcLct$IL4$Dt$H|$Dg}HHg}Ht$Hgg~HHD$D$(L$,H|$0h9A9|l$$D$@l$(H,$Et|HcT$H|$HLtCMtEHv< u;EtH$<'t'<"t#LAIt%Lg詌HuE|$$uI|$@tBT$D$XD$$9N‹T$,9%HcHT$D< T$(T$$< HD$PHtT$(HD$0HtT$$HD$8Ht HHD$HH8HD$hdH+%(H|$Hx1[]A\A]A^A_gyfDLct$Lt$L4$'D|$$ ˆT$@tT$,C9tq9Al$(D$$XHD$PHtH|$0t HD$0HD$HD$hdH+%(VHD$Hx[]A\A]A^A_@l$$l$(H|$8gH1KH|$HcщL$L4L4$AM?HlLd$@Ả\$\HHl$81f.Et A<'t+<"t'IHAUHgmHuMc\$\Ld$@Dt$Lt$L4$fH\$H=sL3gzHLg/{D$(Hl$$HL$L4$\$@HlHl$(AHv< u&IHLg跉HuLcLt$\$@l$L4$HH$LLH$AH)McHD$8L% H=gyHt$HgKzD$(HD$D$(D$$Dd$\$\L4$Ld$@H|$8HqHD$L4$\$@l$Tԩ@AWAVAUATUSHH4$HeHGHL LjH}H$E1Ht 8I1J#L9HEIFH8(M6HMuH{HgXHD$IHCL(LLLIHHMHtCH9tMtItLH4$LMXfDH$IAGAHD$H[]A\A]A^A_xAxAHOIHxg~HL[H]A\A]A^A_%@HD$vfUHAUATISHdH%(HE1ۧH$ HHH)IHu8 D$$LLHUdH+%(u(He[A\A]]@HH5ޣ HfH5@SHgH IHu) A@1AHtL[H5a HIH> HAUHAUATISHdH%(HE1H HHH)IHu8 D$$LLHUdH+%(u(He[A\A]]@HH5 HfUHAWAVIAUATASHdH%(HE1HHH)H IHt A~ fA u`LMt/Lk1MeLLIEiHHuLLHUdH+%(u|He[A\A]A^A_]L(IH@Hu8lL% Iu D$$TfLH5 HŧB$.Mff.fAWAVAUATUSHHdH%(H$81HH/IH]HIIAր HT$0 1H@HLE1"fD DDHD0tuAELL$D$D$LL$H!f.|0t]HDB u߀}}D$$t}LHHL $HT$$|Hc|$$L $IIHt=MtI1EtHt$T$H|$D$T$Ht$HH|$D$D PfA A=E AJHD$(~?H  h`AJHcL$$LTAH|1f.HHt0A΍CA<€ 3|0uIcHEIDI7H$8dH+%(HHL[]A\A]A^A_]Ht$C<Aŀ A|0u1I/MtI)DE1 E1ɀALL$HD$LL$D$H DA|$ %A|$ A|$ Ht$0 1AHHE1ɀ A1AvDEtDt$$EÀ|0EtuqHcHLcE HcD$HHEsDDHT$0 HE1HHL$$$L$HDX hHct$$HHDL$HL$(H)D$1D$DL$HHtHkhDHt$$$Ht$II DA  |0Dt$JD5IB\5Hr t LYATISHH?ufHLI9sEH0 q@v u <2ut uHq@v u HI9r@HL[A\Htt>H~DHuff.ATU1SHF LcHH;HtgjlHHHg*oHL9uHCF Ht*fDHCH8g3lHHgnHHHuHtH}t[H1]A\bkH[]A\UH 9HE H,HtXHXHxgH]H%fH-E Ht#HGH u HrHmHu1]DHEH(ff.@ATAUHHEt)HIHg襯HL]A\f.H5HIff.SH~HxgHu'HZ@1RHt\H2@u[@1yfffDAWAVAUATUSH8dH%(HD$(1HD$ HyHߜHxLdgHIGHH7 E1Ht E18AELtrL5s LLEtX<M=i LMLS~ӉAuK tOxK HHEufDHD$(dH+%(H8L[]A\A]A^A_HD$ LLT$1LL$H)HL$ HHD$6LL$LT$HvOHD$HD$ EL͈LMtt EHE1JHHE1HU THH9uf.HLIfAWAVAUATIUHSH(dH%(HD$HuAt'HuAuA4wHHcHDE1HD$dH+%(H(L[]A\A]A^A_HD$dH+%(H(H1[]A\A]A^A_=HD$dH+%(H(H[]A\A]A^A_DHD$dH+%(PH(H1[]A\A]A^A_`fDH1LHgHƙHxgHHIHD$dH+%(@DMtAD$)?I|$31HHg<1HLIgMA@Ņu @McM1A>t)A~tA~tLHDI<$J|- Hg(IM$E HMH1AVIH DLXZH11HgxHHH]HI@HD$dH+%(;f.H1LHgADžlMcI<$ I| gGIE~j@teHM $IؾH ~H1E12LqfDMH BL1HE1ff.fATIUHQLHH•HH]A\%fAWAVAUATUSHHH|$dH%(HD$81Hj?a % SH|$$`@)HD|$HcË|$gTgHt$,Hc IH/dev/fd/I$AD$g|I|$HL- Lc5 MtD9|]=e 9| E HLH4gɓ 1Hȓ IJ DH5H1LH1g D @1H5ʸH=H1gLa Dg$H=AgT4fD’= = g@g蒔gA9t DH=7 HtgwH7 \HL$H|$H 2 ]1H= t2t%t8 g@j8 >9 u&"8 H|$H51gpI@1H=?8 18 uff.f?t 閡fDHgafH@AWAVAUATUHSH(dH%(HD$1HD$Ht ?E1g DuIAAH HJD%HD$ELL=Z LLDuEt^AM=E LeLs~ωAu'  HHDuEuHD$dH+%(rH(L[]A\A]A^A_IHxf.}HHJD%HD$MdH HD$HT$1HHL$H)H$HvPH$HD$ELL}pAfHHE1HUf.THH9uf.AHLLwATISHH?NI<$HÀ?tI$HL[A\DuAd$ATIUSHtTHHCHH(Ht3HCH8HHCH8?uЀuʁ`fL[]A\ATIUHHt|LHHH,HL]A\fAWIAVAUATUSHHdH%(HD$81HD$08HD$HxgqLL$IME11L1LD$0A HcL9A<LcK4'Ic݃A=Ϝ M~ʼnA¸I)HMA A HH9uHAHcL9rDMcMAEHD$8dH+%(HHL[]A\A]A^A_LcK4't H= <u IcAAM9&HD$0LLT$ LLL$L)1LD$Ht$HD$(AHt$LD$LHLL$LT$ wHHD@HD$(HD$0AIff.fAWAVAUATIUSHdH%(HD$1H$HL"IHh11L51aӃ<tI= S~7HcI4AuWњ u?S9CHcL9sxA<uZEHcHcA,L99~HcHcH)LfA  H91)؃9MlHcL9rHcLEHD$dH+%(ukHL[]A\A]A^A_f.M1L<$HI)LPHvL<$SfDHEHI,Lۊff.AWAVAUATUSHxT$dH%(HD$h1H&ID$IHt > HLJ D$81Hu(fD <DHt <ut$8|$ufMtaE'EtXEo8H5f <Ht3HDH t ANIjEuA8uDA>QHD$(A~FHD$\D$\HD$0D$HD$ D$HLMAHDD$8HT$0HLHt$(IHtW<Dl$Eu]HcT$\HADP =LHcT$\I4HuQHD$ HH8tH1gUHD$ HD$hdH+%(HD$ Hx[]A\A]A^A_DHAD l$v Y1D$<=^ LD$`DgHD$`~?H %D) EAAIcDd$\AA1LEMcADd$E IEtDt$\DD$fDH11[]fuˋ~~ utH[]蛔HHHtHCH8tHCH`HuHH[][HHHtHCH84HCH`HuHHH5ɠ[]@H1[]ff.AWAVAUAATUSHDD$ HIIE1@LILgaQM?IMtFIGLHHg NIHuH$g%L $HfHtkH8tH1gMIA*t1T$ LD1LIgtHL[]A\A]A^A_f"~ tŋ| tL$ DE1ff.AWAAVAUIATUH dH%(HD$1EAA*AK3atfHtF(t:H~HuhE1HD$dH+%(H L]A\A]A^A_@tI}Htg]I(F(uHH~tAtI}g^IMtDELLLIg|$[u AA ED1H5sH=*H1g LIcL H)AHI9uIM\Ed0I)L= 5#r~uH:p Ht :EmqLg3FJQE=E1hLp\$tH=O)u9t4\$tH=u9t\$tH=Ut9t |$tys\$pH=t9t4\$pH=t9t\$pH= t9t |$p0s u +vg=m uv +egg= H|$1H=8{ 6 P 6xuaD ET$ H5_H|$g*( gD n EtwD$1|$t,|$t%DT$Eutt f. D$1H= qwgq pff.AWAVAUATUSHhHT$ dH%(HD$X1HD$PHII˃D$Ht >,D$dA<$u M@@E1g*LHD$oLHD$8HD$ Ht8txAf@E1؃D$HD$HHD$0IcA<$IL$Mt A}3El$EtA|$t L5oHHH9HD$LH<{mHD$XdH+%(HD$Hh[]A\A]A^A_?T$HL$@LLLD$HwH|$ HD$ 8xg׳HD$Ht$ H|$lbDH@EtA|$t LLnHHH9sH|$HgʳHD$LD$0T$LLHL$@gvHL$@IL$HL)HH9HM|$Ld$HT$L91| B:HH9\HD$A $MD$Jp MĸLd$HAH@H9sHL$(H|$HHT$L$g۲HT$HL$(HD$L$HHHD$HL$LH$H<TkH$HL$AMcMHD$H $ELHt$ J<k|$H $McLd$HMHD$BHD$ H8xxHllA<$HA|$H@@H@H9sL$H|$Hg轱#{ L$HD$uxAYHkIHA}gHD$HD$A<$#A|$R1A|$HCHxg˰HD$H|$@H\$LHiHt$ H<+i2g肰HD$IcA<$ImHy tLT$PHT$81LLD$HL$PL$L),kL$LD$HH(LT$PA$MĈgʯHD$H|$LhWA<$tyA|$H{g苯HD$ IL|$Ht$ LhI<LrhHD$ xuJg7HD$[H{1g!HD$ZLiHH-KH|$ iHHxgHD$H1HA$HD1AHH9u g菮HD$oiff.@HH=g gzHg Hff.@AWAVAUATUSHHXdH%(HD$H1HD$8hHD$ HxgHD$IlE1HރLH|$@El$E1H|$Ix<"IcIlM=aw H=6D$AHHLLjDd$IcLEt/<'t[<\uAIcIlM\EHuIAHD$HdH+%(HD$HX[]A\A]A^A_ÐD$AMcD Kl5'HtAD)IcALWfDA HIcL<t$D H5@\HMHD$HfHD$HvHfLHD$ME'LHMHH\$PH=u AIcI4t 't=`u AIcI4uHMHDDLg5}AIIcE1ILHHHeLHcmfDLL$1Ll$@HI)L5fHvLl$@A;fH&A@fDH|$8HT$ HL$8HH|$(H)1eHvHD$(HD$8-HALED\$MfDL|$Y`eAWE1AVIAUATAUHSH(dH%(HD$1HD$dHv HdIMH1E11ALIPI>I~HLuBLAE݃=s @AAw`t~uUDHE1AHHtHH5~蓺HIgvHD$dH+%( H(L[]A\A]A^A_À\AD݃=r mAIcHt(t AHcHxgHH bIzr t $HD$DT$1HL$HD$LH)HcDT$IPIHL v)HD$AHD$BDHIH1cAWAVAUATUSHHH/HE1H HA1gHLcbHxgHHaHJ(8=E1E1gƧIƋ j t,EMl-DLAE+HgWAE[HglAHEDLHgnIHM,$LE1gopAD$(u@AAD$(L~_Hu_HD[]A\A]A^A_IT-E1:+u AMt-EtC A>LE1maHxg諦LH_IDLHglVE1[ECD@DDDDD@=DA /DLHg iIHts@(zfH51L`HH1gޛLE1]H]w@DLHgDIHHE1gn5@AgoT~HLuQLAE݃=j AAD`t ~HD$1[HxgoHHYH|$E111DHD$3HHX H9HX H9HH&HIglMLH5yL LIg~lH|$Hth6X`\AD݃=zi AIcHttAulAtfH=ZHxg{HHXIHD$(dH+%(H8L[]A\A]A^A_fDH|$E1H[DDHIh t THD$ MDT$1I)HL$ HD$LYDT$IPIHv5HD$AHD$ HD$KDH\YHD$fAWAVIAUIATIUSH6H$T$nLL$LcHD$IAdH%(H$1A߉IcL(5)<'\j"=FY ~8ADl +Y 4,P DAwD$tD$0D$LD$@D$8D$(OHgDfDg&M!H5m1pILH1gL!G=\+5%fA$E1A}u L$( Am0@ LgD$XAmD$ @#AExHcT$tA|}H 3cDtA}t+0Im< w Hgqu1Hg"HLYHHH9DQELE~fDzOAMIIHDJ_QЀ vxju #ti?td<@t`<*t\AEAm'D$XD$ Dt$$H|$AAMH|$Ib%D$ }AED$X D$PfDDD$XEHcD$tImA|}}t$ HOa|$ u11HgfH@)tHpHt>DHgT$t$ 1HhHT$t$HHHD$`WLL$`MA0< QAyAH`4 LLL$`KNLL$`.Az0< AydAH` D$Xt$XT$E1LϋL$0 $LL$XaH|$XHD$0CLD$0HC I9HC I9MA@D$Pt %D$PA@I(LgWH6C H92H%C H9L C $;2> => 11LaIfH5`LIfHcA<@` HA<Ht$xPfD%EEgHg,H>g EDA}=D$XD$ LE15PIA9f1QfAT*A@8]b1Hg$@OHk@Hxg詅HH>H$11HHD$`gLHHt=H$@t*u x]H|$`=fDD$tE1҉D$0bADI}HAE9>J@A8D$XA}LT$gMLT$JLT$H5c1Y?LH1gzLT$Mt L=HH<M} D%; E8D$A&A99 LL$g<LL$fLHD$E1<LL$L={< g5H=aDLL$gȃLL$HøfE1A9AAI9L;I=: tqt$1LI@AG݃w0HA}EDH=ag$HtHcD$tA<}'AmdL轕IA(DEu<# 0LH1gk'Au |$X?HtLT$8H-LT$8A=u |$ eA?A+D$Ht$HHPDLLSL$1LL$ D$LT$ pH|$I7-XZL,-M/b{ D$AOHt$0gYH|$0HD$P1/HxgotHt$0H-LD$PIA@;{LD$A/LD$ gLD$ ILM{A8fAx[JA9\LL$LgFg 1H5TW.Ht$H1giAMLT$ L$(LT$ H|$L$(D$ AFDD$1H‰LT$@HD$8菬H|$8HD$(g?LD$(LT$@MtP|$ u=* L1LT$(LD$ )H|$ H>+LT$(IDLT$HL=)+H|$+gjHILIL=LT$H*H|$*g%HILT$gf LgqLT$Mt L*Ly*1 耚Ig I}gqAAD|$HD$AHt EtHtLT$ H*LT$ MtSEtL$QLֺ+LSL$LL$ D$LT$lH|$I)^_zL)L1)L$H1H5O+LH1g1gLT$g 1H5Qh+LH1gfL)H|$)$$t$H|$`g8?HH$8@L(H|$`(D$tD$0gH(INjD$PAGAPD$XELHLPDL$$LT$0gHH\(H|$0Q(gHIAYAZH'6%L$LT$ H$LT$ HI|$MD$cLT$gLT$MtA:u|$(LT$H5+NtH58N1)LH1gbeL'LT$MLj'LL$LgLL$L16H5HHILT$HHLT$H1LH=ugdH&LT$LT$Lg;L&LT$W1H5)M(H5H1g|dD$XD$XHD$XLT$H3dL1H=tg2dLT$eH8LT$ I1H5L_(H5H1gcLT$ LgLT$ H$L%MH$H$LT$ LT$ HD$tHD$HtHD$P1HLT$ $LT$ IDD$H1QLT$8HD$(FHH'HxglHset -- H0HxHHD$ %H%H|$(g=9|$LD$ LT$8D$PfDAWAVAUATUSHHH|$H?t$T$HL$0LD$(dH%(H$1HDŽ$?"uH5O(pgkIHD$D$|L D$xM&HD$HD$D~Ln&HD$HHD$0Htt$D$TpD$@D$D$P@@D$ D@11@|$[1T$\D$tE,$f.I<EAA`CA9A'VL NAIcLD$u DULcI9s%HcE,.C>D$tHHcL$tE,fHI9sT$8LHgjT$8IfDHD$(HtHD$Ht$tLDŽ$P @EEEPH$PT$ HL$8L$L$HNj$D$,Gt$,ƒT$PZHc" YH9cHB" H9HL$0Ht t GtD$| tD$|L/g5D$| MHcD$tE,H4@D$t oHD$Ht$tLL$t@$‰D$ VINj$D$ D$ MtA?gLN!|$ L$t HD$Dl$D$|@EuH@P D$|AL$tT$@   HT$RPt @ T$A T$@0 DL$E{f=1 CH51 tAAHT$HHL$H$1H)"IHL$AggIHcD$tPT$tAAECD=MDAMLc11҄ ʼn)HH9 K<>L$HcALHcD$tE,Hf|$DL$t~HcI4[ LcgfIHcD$tAAEAEHcT$tA<H. D$t+f.A>HD$@ T$x\$  Dd$@E\$ T$H5 L H @D Ht$gHt$HJD\$|L0EtA>L9ut LW|$ g^A~HT$RrAL\$PA T$EKH <2D$Ht$FP?D$PrfAUƀ&L IIcLAD$tHA<(L$tCHT$R tP T$H8 <2D$,L$tE|$DLcm D$tH=ZD$tHI4 AHt$`LD$8gtdHt$`LD$8IHPHDHcD$tHHL$tABH9uCDAMAHt$tL牌$HmTD$t!EIHc I9HT I9HD$(HtHD$@  LE1Vt$L1fHHt L(g/MLfDHI4> |$QLcT$tDu A"w|$[t A}s D$L$\D\$AL M8A# A  H 9 <9 DUMcI9GEC>HA\C=, MϋT$tDA fHT$RfD=Et €Q|$TF>A|~L$TXt HD$PD\$EMHD$@P>HW <0-D$PD$f.E A@D$DL$EH 2t!tDEt€t A|~DL$EHD$@PvH <0=`D$ HD$@ A1L牄$HI4H$gbINj$D$tM]1A>L@9LI%DHcT$tA<H&D$tfD$xE1LH$dH+%(HĨL[]A\A]A^A_@~ D$vAu E1AH$DgHHD$`H?8$)H|$8DgIH|$8HIA8~u D/A~uHpH|$82$D$tA} fL$HDŽ$L$t$HcT$tIM HHT$ LLL$8HT$ LL$8HHD$ A '  H\$8LLMWH=wD}( EAIcI4t 't=F( AIcI4uIH\$8t$tMLL$ DLgLL$ IA9A$Dl$t A? LHD$T$D$|@uH@ D$ L$tPHl$tAMQAMNA}LcwA}8 LOH3A}ủʼn)HH9鍝HT$8LD ))HcHg]HT$8If.{ H=VHD$0HtHD$(HtH= H5 g"IIRf.LcAL$tHcH9s+BG >HE,AHcD$tE,HOHH9sHL$hLHDL$`T$8g\HL$hDL$`T$8I랐D$t;$A D$tC9L$TDA>uHD$D$@D$@D$PD$ @gD|$|L0HEt A> H\$CtOCĀtHD$O@ t HD$O @tOD$tO1E1gKID$ EL$tA8D$@A D=$ tRHT$H1L$H$H)Hl L$gZAIHcD$tPT$tAAEHHcL$tE,<@HD$ Mf.t$@|gHHD$(HtDEuDL$PE |$|LuA>E EHEI9]LHOD$t$LPgQI$=n# AEʼnT$tH=,{,=2# tHT$H1L$H$H)nH L$g)YIHcD$tPT$tAAEAD5LcAMH>H2LHDIIf.fDLL$ 1L$HI)LHwHAf.L$AAHcD$tA<ED$ D$ -!=! AjDH=yDY AHt$`LD$8gWHt$`LD$8IHPHHcD$tHHL$tABH9uSD$|u |$ fAg<1L0HHE1HgQID$Kf.EULcI9s,EC>HA\C.HcD$tE,H@HI9sT$8LHg'WT$8IfD- H5ILƆIfDHcE,[gRH|$L8IŋGt %A EGtHD$AM@tHD$AM@tHD$AM@tAME11LH$DŽ$|$t$IHw I9HW I9LD$8LgP!LD$8MFI@Ht I87LLD$8"$LD$8t%HD$0D$xHtHD$(HtI8D|$xEL1ҾLD$8iLD$8ILg!E= ELDH=vDbHL$`Ht$8gTHL$`Ht$8\IHPHHcD$tHx|$tABH9uAD5AMfMcC<8D$ D$ LqLIH) Lh Au(gSAfDIL? SfLIT$LH5IЃDl$|HhHE L D$MH\$CtMCĀtHD$M@ t HD$M @tM1HE1g*IH5!-L3IAALgRIHJ48@HcD$tHHL$tABH9uBD$@D$fDfDHI9sDD$hLHDT$`LL$8gRDD$hDT$`LL$8I}HD$ PAHt$8g1RHt$8IHPIHcD$tHHL$tABL9uHD$ PA>AA~6M*A~H >mHIHg=H3 HcA<D$tD$gHcD$tD$xHE,LL%  L LLD$8kH5 +HbLD$8Ir  HL$`Ht$8gPHL$`Ht$8IHPH@HcD$tHx|$tABH9uI@LD$8L(L! Hxg_PLHs LD$8III@LNj@D$8gD$8A?u AEL]~AEl$tAD$  L|$g Hc$1H551_ LHH1gELL%D LLD$H I9H LELL%  L@ D$|t$tD$xD$|HcT$tH=pI4ALL$`DT$8gNDT$8LL$`IHPH (HcD$tHpt$tABH9uCD=DAMM.HT$H1L$H$H) HHHEH~HIqHHEH~HILD$LLIELgLd$A~ EHEHLDMGHT$H1L$H$H)HHHEHyHHHHDLxHxL3HT$H1L$H$H)wHEHHEHyHHgL1oyDD$|HEELD$HLL$`1H$DT$8H$I)LDT$8LL$`Hw~HHDHhHxIL$gLIHcD$tPT$tAAEL$t$LmLL$`ADT$8H$g*LDT$8LL$`IHcD$tPT$tAAETL$gK\ILA~ML{H5%H\|$|HELD$ ff.@ATUH(dH%(HD$1H?HAT$Hxg-KHHADHE111H$  IH} I9tpH I9tdH<$Ht5MtHID$HtH8yID$`LBvHD$dH+%(uEH(L]A\E1HgHHD$dH+%(uH(1]A\N7AWAVAUATUSHt$HdH%(H$1Ht9gS6HD$HW D$HD$D-tvH|$ E1H$dH+%((HL[]A\A]A^A_HD$Ld$Ht Hg)H|$H L?Mt!1gHD$H|$ HD$L8HD$Lt$I HD$H|$MNAADHL$\LD$X11LD$XvHH| H90H\ H9D\$XEtIF@HHHCH8vHCH`HuH}tH1gHHt$H1gDHD$MMH|$M?MNAAH\$IEށH\$t D$`-@@@DbHcD`At IcAD`GHt$p1HHHD$LM9 MBI8?-uCHG<-t*fDH,w IHHuMM9uT$p1 t IcAD`HH=uAA%D (Ic1D`IFAYH8gt@D$@HHD$8HHD$0HIFH(HoHD$ HcЀ|)DHt$ 11g1HD$(HgH|$ Hl$(H5h HzWHHD$ HgD$@HhH ;{S{kL$@HL$@ALc`DH}HHgHi1pRAԩHcAD`gfDDpE,D$`-AI8T$pH|$ Hf$gHHD$(Hg<HDd$LIC@uMHH/;HDgFHID$H8MID$M$$HMt'ID$H8tgHʾg2HDd$L*E1E1A| DL$@LT$(HcgDHT$0HIFHH0HD$8HcHT$(Ht$ HD(DL$@D͍MHcHc+) IFH8IFH|$ H}EIFH8g1HH8g聹HUHH€:=m1HgH|$`HgFHHgHHgHgCtQIF%@ @1H8gIVHHMNIHD8+uMNAa=JI~IFHcDbHcD `gD`AP|$@L$(HcgCHT$0HIFHH0BHD$8L$(D(--Af\$`IFH|$HgLH|$gA"PHg HD$ HUHD8+~vH|$L%8Mt LgHLt$L IMFA@ILHuHOHD$HII@AA"DbHcD`aAAH|$g2HD$H%H8tH1gHD$HD$HtD'EPH|$lIċt$DhL=LMUMIT$HH:gwHD5Et!ID$HH8E1g)xHAL=M H HIFH|$Hg- H|$g" ~HcDbHcD `gD`aL9t$tHt$H5/HD-EtKIHtCL)H= HH HHHHHtHrFuHHHu L54HD$1I.HLCLIA@IMu%=tI8{gnHtIFH8g'L8HD$MtzLhI4LuGHT$BEILHg.M}IMt@gIVL8HH2HT$A8tHLgHHIH|$?Hl$Lt$ Lt$dMH&I|$HTHUM$$MuH=eg HT|$DL=<MsɠH2E1E1D$DHM1H9@Ld$L-Al$DD%IH`L-Wu+H5\H9`u A6M?MuLd$L=Lg) Hn16HD5E8l$DHOD$D.Lt$MFA@dD%QEt ^1Lt$E1Hl$BDH8eIHCH88HCL(LE1IHLgdMLM6HCH8@ ugHCtH8glIH I9MI}HImE1gvHLHg6H}IHuHLH1gIHD$H\$AHl$Ht HgMI<$L1g_Ig;HIHCH8VdIHCH8HCL8I}H/D [EDOEu5LIA k3AHD$H\$bD$DIE1TID$H8g!HD$DHlHCH51NH(UHH1g0#xATE111UIHHHH9taHH9t9HWqHIgMtHL]A\eH1]A\I$ I$s␋SH4Gt@1E11ɉCH=HFH9t3H*H9t [H~HfDjSHGt@HE11ɉC1HHH9tEHH9t`Ht [dD1[H^HCATIUH(dH%(HD$1D$>Hxg|8LHHE111҉H$IHI9tPHI9t*H<$HtHD$dH+%(uH(L]A\ff.Ht[?tVATUHHHt2HnHIgNMtHL]A\:cf.H1]A\fD1ff.fHt ?t@1ff.fATUHHtbLA\E1LA\ATUHHtH}t AH1+HAHHD$ H@H|$>DHD$HHta8t A1HH|$E1Ht@-8Hg7HHhHt@(AAfE11gUD `IH(fDA*z]5 _HL$ LD$ 1HgHDuHr}m}cE1AAAOf.HHD$ƒ@A@xtH1g聿HHt*}t AiAHbHH|$H@@*z]D HL$ LD$ 1E=*DHL$ Hz@(DpDHLD$ ggHe1Hg͡HHhH}1Hg}HggAąg聼H51HH-H1ght,U HDH5 gHD$Hc_EMHDH5gzHD$H/Dz]9H0DE D = HHL$ LD$ gH@H1FHfDHPHHH5$+g(HH(Hf.AUATAUSHudE1D L(HMAA L6AILHgHL[]A\A]H|$1g胟H|$Ht@)tLhMzA}oLHxg(#HL[H]A\A]%2fE1 DbX;L(JHMtLKI7f.E1.AWE1AVAUEATUHSLHHHt$L$HT$L$dH%(HD$81T$H},HHPHE1I>f.1}u jZ<#tHIfD<@@<* @AH11Lm<D=}A=D^EHcH4AuE)L <Au_f.A=AIcH4Ax=AՐLD$HD$\DL$1HL$\I)HD$LDL$L];HsH"f.E1AvfDOfDfDL9AHD$(@(@HD$8LcP HD$E1Hz@AHD$PDDL$ELHHx@(@gIMED$ L1LHI{L\$HD$\1HL$\I)HD$LL 9Hw)HQ$HD$HD$\fDHD$AHD$\DHHD$ H8xAHgItHD$(II?@(@H@DP HD$8McAD1ADHg HEuH|$HHtAH?1HEIH'@AM rH|$HDg萠Hg2If.HD$ LP~f}u:gIĸfA$kDHD$ LcP"f.HI>MAIDE1 H|$ E1H?AAIl$EA91T$HIutGM̃~hMu a@D9~XM$$AMuLgEHD$MH wLL$H=wE1gHt$HgiIIMtLE9 E9~IHmAHuL$LDLL$I;LD$MLD$LL$IL9tI(Lg*H5&1Ht$H1gA HD$H=vEuH|$HHtL%@H11&L\$H51Ht$L%H1g HD$HuFL$LDLL$I$;4LLL$I$AWAVAUATUSHXDL$(dH%(HD$H1HHeuDIHcHH=OuHD$(HD$@PD$LL$P AZA[uA1$AA>/D$u IL;HxgyLHt$(HIʼn؃ @LE؉ EE؉؃@E؉t$,1A>/@1HIT:/LE1 HD$D$h0bL|$D$(wb.HD$IHu/HI|$HL$g=HL$IL$M$$MID$LLH8\HD$g6HT$HHuHD$gIHL$H@HD$H<#L|$<%D$sP fH|$MMt L?L6HD$ H:sHD$HdH+%(FHD$HX[]A\A]A^A_f.|$|$H|$yNt(LA>D=U*HD$ A>LE1"IHH5H"LIgfDL|$H|$8LL[HH }gAHD$fDLHfIkcE1HD$RfD؃@ÀEyHD$LxM @L|$%=HD$@LLHx@(@&g HD$H|$D ;L|$1LLHH\$LHeIh@ډٿ@Àt*@pLd$L3GLIHD$gMt=u)D$, /K@HD$0fH|$+@HD$H|$fDg:HD$L|$Ld$8LLLXHML@D$sE1~E1|$gXDHD$HD$ Ho\fD1HHD$HhH|$  fD1E5EkHHD$fE1E1E1URfAWAVAUATUSHHdH%(HD$81HHnDMAHHc҉H=nHD$HD$0PD$LL$@LAXAYO1ۀ@ـɀEى؃@$EA^2A,A~vE1MQ(HD$HD$HE1Ll$"@I}IgMuMmMIEDLH8gH$gH$IHug HfDAMGA<$,NfD$L|Hxg LHHHD$$Iă\u='IHt0HD$ fD1HVIHf.Mt LH|$HD$HlHD$8dH+%(HHL[]A\A]A^A_DuH|$(DLg誋HE1Ht f}Lg f8INtCHD$[DA@MA<$^IAHD$E1\HD$E1%=u@EHD$0DLHx@(@gIM1 L1LHIl@ډٿ@Àt*@t5E@L|$LcALIgMe fE1AMA<$~FIA 7gjIfHD$E1Ll$(DLLg蠉HML#fDMbfHD$E1H jq@IAfHI E1&BfAWAVAUATUSH8dH%(HD$(1HHDEHHD$ HcIPD$L-wiH=piLL$0>Y^Aǃ`EA#}<%AT$ HjHxgHHHH$H<$HT$ TuyE>"IHthDHADHLCLIgMtC3=u4L1LHkIfD@E1L-VhHt H8HD$(dH+%(H8L[]A\A]A^A_f.uH|$DHIMt A>pgefIDA<#Af.AHbAHD$ AEAA*HP(HxHg蝟IMDLADHALIgQMf.E1L-fE11LfIL½pDL|$DHLIMLHxH+g}I+DLIM?̿ff.AWAVAUIATAUDSHHXT$L$LL$dH%(HD$HȃD$>ILL$gALL$D$(IA9MbAL9`L\$+l$(yE1g LHbA}!{AMIIHDJu4_tAQЀ v'DLEu #t?t<@t M<*1fuUu.1A}u%D LE=<#tHD$HdH+%(JHXL[]A\A]A^A_ÐgڞuDH5HIHA?HEHE@ AN @H5i1LH1gLHLL5g0H5H1ANI<@_L9LBD,fDLgM9t Lt$}HIHt H׶f.A?%Hg\$+><*@<@ @D$8  D$81HIH>AfH=T$I8xANgAfDIANgnfIHYIم@H AHEH:z@ HD$ANHT$(DA6HfD$ZfDxHD$0 ]HD$0\hfUHH=HHwHH5h1L_ 4>L1HHHAuH5H]HÐLH HmLsHHHָ Q@ڵH=cHHHwHH59V@HH=&H5HcHBH˱H#H=ű]%fDL H5LH5H f.HHtWHtuH?T*@1DH?H5M9*fƯfD鶯fD馯fDUHH?;H]%1fH=ptDHgHRHDH=AHtH5 ff.@tfH51HtXAT1UHgHŸHt1LeMtI<$LxH}nHe1H]A\ff.@"AVAAUAATIUHH5pSH1LgHH@HtgH8H=Hxg{LcHHHSI$1EB}/tBDk[]A\A]A^DL߲HxgLH1HCgHCkfgHH(fDAUATUH5nH1HgHH@L(@taIEH4}.u }/HxgbHIĸ./fA$I|$gLg螜uuLA}.t*LٱHxg]LA\HA]%&fD/LzHHt11LH=gnE/tE1L]A\A]@HxgHH¯ISf.HATUSDgHA9wHcH/H<g\H[HDž~Hc1HHE~RAD$IDCLTIHt)HHJD!HcH H1H2HHuIM9u[H]A\%A[]A\ATUSgIąuHgID$I$HDžHHN1@L[]A\HcH<g_A\$I$HAD$ L[]A\ff.1HtG DAWAVAUATUSH(H<$HPIH'HD$AGE1H$HN\t:H<$x31H $H¸HtHH+H9D1HT$dH+%(uHH1HŢH~DHJHPH fHHH@H@H@ @(HH9uÐAUATUSH`L-a~CLMdf.H+H}ˡH}HtHHL9uMt LHH[]A\A]@ATghH=Hx gIH/var/maiI$lI|$ fAD$AD$ /H5SݡLA\ATH=ĹUSHdH%(HD$1D$Ld$guHHfLHghHHtltHƀ\t-?t@%t;VHu1HHf~tVHFu@>tH1HD$dH+%(u@H[]A\H=g:uHHuHHtH1KH f.H=`tDff.AWL= AVLAUATUSHdH%(H$1gtHD$HH\$HءHxgHH*ԟHD$E1Lt$ HDJJL A<$tbH@LLH$g$Ru@H|$Pu2HsHHx ~ HT$hHPHT$xH(HPH@ f*ufID9-+mH|$1Ht$LgIH$dH+%(/H|$H[]A\A]A^A_%nfDHўLHHXH8gUQwH|$PkH;\$h`1H5mKLH1-H$H;D$xHRHL@L$M%1LLLD$gbH#LHHH H8HL$gPunHL$H;L$PLD$}]LD$HLD$HHHH9HH<$g蔭HHtDH$H<$0SHHHPH9P|9H5  ^ J{fH$dH+%(ujHL[]A\A]A^A_TLD$H51ǞLD$H$MH51H$ݞf.SHHcH4gHH$$[ff.H=H 1HHHH5HH)HmHHHoH\H}HVH@HHH=mH ^HSH@HH)HHHHHH9u1ggGHcHgRGH=R( 1g(GHHgGH=1gFHuHgFH=drtbg+u Hh<1gFHHgFH=uSt(HH#<뙃VATHןUH(|$ Ht$dH%(H$1D$\A+HcNj ẢL$ AAA@H4HHHVHT$H9FD$$w T$ əH 2Ld$D$DHcD$ LHgHxgLHHD$HE{٥ϥD$@gH$0HD$8gDHGH<HD$(HBHBHD$0Ag<+AD$X|$$҃?D%XAH {?L$\|$ Ad?t g+HD$(H$0Hg EH|$8gHD$0HcL$ HHBD$ uT$D\T$@ D$XuzfH$dH+%(H(D]A\E1@D$X L%?Ht$`Lgm1L|D$\D$XH|$`H-c?D%$@H@g]mD$\QHH|$HcT$ Hٜ$ߋ =gKFfDHt$H|$HgP=D%>PDATL%7UH-oSHcHDt/ƒI4܃AHD‰ƒ E‰DH[]A\ftIH%~Hމ|Ky tdu ts=gg (ggg!\H}g6'Hn}H5g1hzH1g[>8H[]PH[]@=g\'~1~t%t!H~~H@<f.= tu=W1@=z 1=Y ti1u 19=#9=B uf.AUATUSHdH%(H$1H-1yHxH\$0 H9HOظHHDHg.0Ig ;-}I}eH}HcL$1HA,$Ml$I\$ID$(ID$AD$ H$dH+%(u0HĨL[]A\A]f1DE1y}xff.fAWAVAUATUSH89AAAM9=|=D$ u1D9%D$ H|IcIcHHD$L,Liubgu>_uuk[f_g2[d@g_t@=gbT[[j f1H5W_%Sff.AUATUH@dH%(H$81H4$DŽ$tuvDŽ$IL$H|$WH$WLL9THD$H$8dH+%(u,H@]A\A]fuHH9utdU@AWAVAUATAUSHdH%(H$1_}_ tH}wH9d^A$ggn4d&d$df gF1ҿH5x]Q1D(rSDV=lt~A$ZAAHvH9cu-@g肔pAf$ tgM$g0fDIHFe1E1LLQ@+1]LXA9uD{HL9u1LPEH% fg1g_glb]uHDv3-]9tAD[=]Eu>H@H Hsf=\f.5"u.h^R[\uH tȃtu~uu#fHH5Hd\Hff.@H5I\ff.@ fUt \tSH-ZHS11HNHHWu|=u]@릐H59gH5]H|[WfDHV1HJNaf.AWAVAUATIUHSHHdH%(H$81Lt$Lg6HD$pL$L|$hLLHD$g H$H$t51H$8dH+%(HH[]A\A]A^A_fLLLHg. @tAH$LgxKuI9|uD$)xI9juDl$1A)EUt'A9D:1)A9|TO@H1gDYH=YSUH5~H1NHHff.fAUATIUHSH(dH%(HD$1tILl$LgFL$HD$uy1HT$dH+%(H([]A\A]Ht$gUHt$Lg?HD$Ht$H }HcH@LLg诶T$HD$udDH9Sf.H9;fH9+fH9fH9 H9H|MLnff.H5~1HM1Hff.SAIGIA=ڃD[fW!u<=ttkE1A@tHt$ 8KuD$8%=fDHt$ g%uD$@9QqhfD1>UHt$ g=D$8%=)gHP(HxuHt$ g腵HD$xH9D$hH$+D$pfggjH|$1gGH|$VT1HL$E11g[T$H1HD$}ED$@Ht$ g荴D$9jDHt$gHD$HcЉH9FHt$ g%}H|$Pl@gʹRHt$ g=D$8%=)@g躊@1>Ht$ g荳D$9jDHt$ geD$9BDHt$ g=1D$8pHt$ gmD$8%=@Y@Ht$ g=D$8%= )@Ht$ g赲 D$8%=`@H|$Ht$gH|$t$H|$g%HH;D$g= HP(сt&с@@t3~Hxn1Hxgb#HVHxH5_gc\H7/Eff.@UHH OHcOdH%(HD$1H,р}-u u@u"1HT$dH+%(H]fD}uHH<V3wI IsPD-O+O@tt9D9OHD$dH+%(Ht9HH]D9}CH|9HgKNHNHNHHt#HD$dH+%(uHHH5mp]CYf<=tYƒ1HEtщ5HH5Lo1=HHff.AT AċH;H}H HHcHр:-t DA\zauzuHEAE1EAA!fDATAċLH;BH}H 1HHcHр:-t DA\zat*zouzu HA AEzuЃGEAE1EAA!ċG;G}H GHcHр:-tsUH|$H=GHt$1Ct yGH]HD$HWGHHt 8[HGD$:GG?uT GGH=GF@uHD$H@!B(dHcF;Ft}HFH,Ѐ}-tH5/m1;1HH5l1;HHuxl$HL$HcD$HHt 8]uhxub|$~?#FD$FJHD$H@8EH=E?H59l/xHD$H@ 8)xEsxxEwf.=IFATL%@FtLA\HLHk PL k1jLk j7LH A\ff.ATL%ESH=Et?1H5k9H !LH1y>uUH[A\DH LH=kL %k PLk1jj07H f.H5$k1L9H7H5?k1/9H7H5rk19H71H5k8H[HA\%7DUHGu&H}6H}6H]%6gZ2HH8HH0)u %:@ff.@H=hDtDH@gHJDHDH59DHt4H1g舊HtH@Hf.1Hf1ff.fH5CHt4H1g8HtH@Ht H@HÐ1Hf1ff.fAUATUHSHHH5CH1g؉HL`MI|$5Hf7Hxg|HH5Al$ID$Al$;t H/7D   H[]A\A]D@guHBg3|HI6Hxg|HH15HI$6Hxg{HH5AD$ID$;tH6D t[ tVHL-\Bn6Hxg{HH4LHg菋H=PL`H[]A\A]uV@AD$Al$H5AHAT1UHgHHtqL`AD$uUI|$z3I<$p3Lg3H}]3HT3H=OgUHxA@ H]A\DLg/D܃ff.fH=9AHtDHH5Ig#H=Ag֌H=oOHAH[Uf.ff.@ATL%@MAD$ E1xHcHgzIH@P~]H1HxLDHHt/Hcf.HJHIILHHuHL9t HMt!LgH LHc2LA\@H5 @HtLU1g[Ht6H@Ht-HhH3Hxg6yH]H%I2f1]@1DAWAVAUATIUSH83XHcHgxHIHD$gxD$HD$AE1f?IcHD$M4<A1Lt$ EA1Ӆ< < <\<'<"u*H=eg:H>f.AIcA4HuDDLt$ E9~I,4H|$2EE)IAD9L|$IcDL$(IcLT$ LL0LT$ DL$(=]>EMcC>D$E3>,\$ ID< < H= egEHsAHcAM4\ N=ND$H5/=H61H|$gyH HPH|$HT$ 1HT$ IHLjL0HBD09IcLH|$=/t D$tHcAD-< < y<1D$1!AIcA<4fDAIcA 4\t8uA<4Ht$(7Ht$(HAL4Hf%fC19f1)fH|$/DD)IDF4 9Ll$IcMcHcHL.CD51D$=D`D\$ D)A>VHD$ALpAL<:IcDLt$ LE9}H|$,HD$H8[]A\A]A^A_f.u@CLt$E1`@H<\t#8>AIcM4 HD$8t$H-fAQ2@9}DL$(H|$HcLT$ gsDL$(LT$ HD$fDslLt$1@L$(n5L$(HDHAN2@9}T$ H|$HcLL$gssT$ LL$HD$H=`g 1HE T$aM4AwfDLc\$ LMAM2D9}H|$HcgrHD$TfD$1AT(gcr IH@@H@ g8rHH@H@H@ID$LA\fDHtkATIUSHGHXH9t-HH[H}HtB*H9*I9\$uH[H[ID$AD$ID$ []A\fff.@HtKATUHHlLeMtI|$Ht)L)HH]A\%)f.ff.@HtSAUATUHSHGt.HGIIHXH9ufH[H9]t LHAԅyH[]A\A]fDATUHH DOIEHG HLgL9tL1@9~TH@H9uL@HH@H9uHBLHHI@A@H]A\ÐHHHAHcHGHxfH)H@H9uHGA)EHHI@u HL]A\fMt(LMd$H}Ht)(H (MuE1HL]A\Lff.1Ҿ@HtkATIUSHGHtAWtDHXH9t.H{gΗH{HHt'HkH[I9\$uL[]A\D[1]A\f1ff.fHtkATIUSHGHtAWtDHXH9t.H{gNH{HHt$'HkH[I9\$uL[]A\D[1]A\f1ff.fHtkATIUSHGHtAWtDHXH9t.H{gH{HHt&HkH[I9\$uL[]A\D[1]A\f1ff.fHtkATIUSHGHtAWtDHXH9t.H{gnH{HHt$&HkH[I9\$uL[]A\D[1]A\f1ff.fHtcUHSHHGHt4Wt:HXH9t!fH{g薛HCH[H9]uHH[]fDH1[]1DATUHSH glHIHt"H'HxglHH%HIl$LID$ID$[]A\ff.@ATUSHHIċEA$HEID$EAD$HEHXH9uXH9tDH[H9tIHsH;6IT$HJHAHHHMHBHPHU HuHQH9uH[ID$ H9uL[]A\ÐE1[]LA\DAUIATUHSHHhIċEA$L9tY1HsH;IT$HJHAHHHBHPH[HI9uID$LAl$H[]A\A]@11f.HATIUSDGEuUHID$HXH1HSHBHPHCHXAD$D@ED$AtaID$f~=HGHXHuHcH9tH3H[H9uH@HID$ ID$[D]A\1DID$ff.fHHt#UHHHt"H]%"fDHAUIATUHHSHH II9mIMHYHH9Iu HNH>HH?HHH9H9t(HH9tzu H9OH[H9uMtI|$Ht!L!IE H[]A\A]DLc1I\$IL$LaAEMe H[]A\A]H9H[^fDIEHPLbIT$L`ID$1AEImMe H[]A\A]@HH9DH{.!ID$LHC!I] H1[]A\A]HH?HкHH9HCL`ID$1LcI\$AEMe HCL`ID$1I\$LcAEMe ÐHDOIEt{LWHI9|oHwHFHH9_SL_ MtuIHH?HHH9~CH9tH9tntH@uH9}1[H@H9~11DLعH9@HH?HϹHH9|HxHHAHOHyEHI9uHIPHPH9tIP [1H9HDIH [ff.Ht{GttH9w|nHOLAIH9^LO MtuMLH?LHH9~CL9t/LH@uH90|H9tH90tXuH@H90~ILG 11DMȺI9@HH?HкHH9|HG H@ATUSHtgGIt]HGHXH9tP1fDH{g>HHgH[HI9\$uHtH8t]1A\kf.1H[]A\fDAWIAVAUATUSHHHOHGHH9wHqHEEH9uHvH9H9|H9HH~1fH9~ HRHH9uL&HHIHt2HL}MtIHtKLBH9Mt,DDL*g貜LIgF1@E1HL[]A\A]A^A_ff.AWAVAUATUSHHHGIIAIHHfDHCDLLH8gjHHCH8Ht mHCHH(HuDDDL%*gțLIg\0HL[]A\A]A^A_f.E1ff.AWAVAUATUSHHHGIAAIHHfDHCDLH8gHHCH8Ht HCHH(HuDDDL%*gۚLIgo/HL[]A\A]A^A_DE1ATUSHtGH1-If.HCHLHH:HHuL[]A\f.E1[]LA\DAUATUSHH}GItsHGHXH9tfE1H;g|HHg;LHgHI[H[I9]uMt$I<$t HL1[]A\A]YE1HL[]A\A]ff.@ATIUSHt*H1HCHLHH2HHuL[]A\fAWAVAUATUSHHt$HIg-IIGHXH9E1fDHkHt,HEt$Hxg`HHKDMcH[I9_uIcIDHHD$HtD HL[]A\A]A^A_HD$E1HtLE1AWAVAUATUSHHH|$t$dH%(HD$81H-OHE1g4`IHCL`L9HD$ 1HD$@Ht$I<$gzMt$IMLgI|$511gIƺMtA?tA MA>BtA~BtA~BfD9.HcLLw1A?t'AtAtLfDhHcHcAD LM;L"1A>t"A~tA~nfDHD$H@I9D$t HcŃAD LHD$Md$L9`Hc9|)LtHcg^IID-D$"HD$8dH+%(;HHL[]A\A]A^A_@9}LHcgv^IfD MA?AA ELP4@HL$""GfPHII9L$HcҍhAD @grIf.BE1LfT$L T$DfDLg臱LHIE1L fDAWAVAUATUSHHH|$t$dH%(HD$81HMWHE1 g\(IHCLhL9"HD$ HD$fHt$I}g wMuIMLgsI}G11g-IƺMtA?tA M&A>BtA~BtA~B 9^SHcLHcT$LA[1A?T$t,At AtLST$HcЍXA]PHcHcA=MLL1A>t A~tA~@HL$HII9MCXHA LxHD$MmL9h}Hcf.ILc9|)LtHcg[IċD$C,)C4HD$8dH+%(AHHL[]A\A]A^A_9}LHcgZIfDHL$HII9MeA< X8 MBA?t1 HH1g@GH5L"1 HH1g6JAe(fgIHP(gxDgumP(FNff.AUAATIUSHHHGtTHhHAHt&HCHE1LHHUHHuAd$(HL[]A\A]fD1ff.AWIAVAUIATUSHHxdH%(HD$h1>(H.Lg[IHt C(@E1MtuHD$`Ll$LHD$Lt$L|$ DHEHt'H8Htt@t[fHmHuLt$Ll$L|$ LgUILgM9t LmHD$hdH+%(HxL[]A\A]A^A_IM9ufDD$\Ht$\LgrAIHE1뜐=gHLHEL0HD$LH( I4H|Ht$0g\NAHD$(KLt$@ILE1A $LM to=fE Mt$=L{~ȉH5ouJBA $HI u@A$HEH8HEHt$(H H0QH|$@H1H)HL$HL$8gBHߋt$8LcDJ\;gLA$\HHD$8dHL$HD\]H|$8)HIfAMf Z=fMt$[bHg)uH5<Ht2A$\M IfD AMt$DE1HD$`HT$01HHL$H)HD$8Hv+HD$8HD$`LA$MAI0HHE1H AHH9uAf.Ld$(>1HtHWBu H8[fATL%AUHHHt1gHHLELgHIHL]A\AWAVAUATUHSH(?[u11g@HcIH;]tH(H[]A\A]A^A_錟1H}g)H=QA]HIHEg_LIkMtNA}tGA}A}LHDHD$HcHcDPMcHL$Ic*fDHD$1AD$AHL$LDT$H$guJH$LI[HxHL$AD$DT$AHcHL$T+uDT$AD$A+HcATIcʃ1AAZHH|gH=&@HIHEg7LHCHt}t}tZ}ILLgJHcHIHLHH(L[]A\A]A^A_f.If.D$AHD$A@HIcD$AHD$A`ff.HAWAVAUATUSHH(P@A?[u]11LgM=LLcMMA<$]tjgHŐHCH8HCH(HHt,HCHtL8Mt@uLg褜HH([]A\A]A^A_fIA$Hgh<A$]H$HcgGH4$[HHtP>tK~~Ht$HHt$HD$HcЃH $LcHD$($A1HD$D$H}A$HL$AET HcA+uL$AEBD5+HcЃA $LcBT5HI<gt<$HƃHcH/zf.HD$A$D$XHD$A$D$'ATAUSHHgHt/HHHH5F1[H]A\%DEH4H[H 4]H5zFHDA\1%ATAUSHHg,"Ht/HHHH51F1J[H]A\%EDEH3H[H ?4]H5EHDA\1%AUA[ATUHSHguHtlHHgqAAu8[EtL11Hg9HcЀ<]u6t11|H[]A\A]HgHt@(@t[EuH1[]A\A]Dt1Hg9H|ff.@AULcATLIUSHdH%(HD$1gDAULHHcHBD-HgHT$HԥIHHåggHIL9t LHT$t$HD$dH+%(u.HL[]A\A]fDgt E1gҤgWAWAVAUATUHSHHHG(T$,ƒ@HwE1MLEHt$8L|$QHHE1gLE(L|$0ƒ@H΅HCPL0MHD$D$,HD$D$(QfDE1Hb@tmHT$Ht$LH1IL=<EukHHttHCPL0t A>[E(@Ld$DD$(AL=AuHT$Ht$LHIL=ѣEtLHHuE(@HD$HH9D$0H}HEHH[]A\A]A^A_g%Lm1H5#0}LLH1g 8H|$_HD$E1HD$0H#HH[]A\A]A^A_fD11Lg6LcO<LA?]E(@LT$,Hg=IHE H?1LLHMt LIZft\HwHt$Ht$0E1HD$8HEHL$H@HtHt$HDLgG@fvHD$HHD$8@E1HD$0@:HCL0PNOlAu@=t@+C|=fwAF<@<*0'g<H5-E(@uH5 .1LH1g6A>[L$,HM*DLg7?LIHZHPL:L0MIFL(1Lgm IH?8tL1gQ IH1Ht$HALL1LfH|$8HL$8HIHL$LaHL$HL$0E(x@K|@+?=DD$(u AK|DD$ 1g DD$ HI E(L=ADE1IDH|$yL|$AguHL|$0HD$E(HD$8E1@Lg=vg >IH|$8LLgLT$ I~1AgA]HD$H8E(AULT$ @K|+DD$(fDg}=DD$ IIv1HLT$ LT$ HHD$H_E(AUI@HD$0HD$Lg(H1gZfADAWAVIAUIATA[UHSHgKHIDHHI)Dg-AAGD9}^IcĀ|]uTHHxg9HH"[MtHIMtE)EeH[]A\A]A^A_HgW8MtI1MtAEH[]A\A]A^A_ÐMtIfAWI1AVIAUAATUSDH8dH%(HD$(1HL$HT$ @HHHg趺IHt@(@tLD$ A<@<*HcT$MXAD$(@dL1LHHy&AD$(t ID$H@HHHaDLHIHHD$(dH+%(H8L[]A\A]A^A_fAx]NDHE1Lg6fHcD$~LD$ ITHT$LL$Hxg6H4$HHT$H];AD$(A @It$LELH1dI@L11H@ITWH$1LgaH$H]HifDLE1g5E1@VfLE1g5Hc^fDHg5Jff.AWAVAUIATAULSHH8t$ DHL$HT$ dH%(HD$(1 HHH$gH<$IHcT$Ht$ <@<*HtMtAF(D@xAHL}M(MfMAF(1D@LHgIH$~]dHt <*AMI~HAF(D@gHHtqHD$ Dt$ H8*u D$ gHIHgE1g2gHH ygʼ1Hg?HgEIHgZLIzDLE1g1"HObfHD$ L@g^1HD$ @[f.ATUH$Ht'HHgHIHL]A\@E1HL]A\f.IHщ1qAUAATA1USH(dH%(HD$1HL$ HT$HHHgzHHVHtiHD$@t*uWx]uQH{HtHC(u@Dtt@u`gbHHt*HD$DDH8ghHIg'DE1HD$dH+%(uEH(L[]A\A]gHDH=G7g軺1Hg0HyfAVAUATUSHW ItwG~pAE11fDIJHt-@H{EHE{gHHgºHHHuIE9nHtH}t[H1]A\A]A^1[H]A\A]A^HtUH1gAH]ADff.@1@ATIHULHպSg%Bt.A~Bt$A~BtT$LT$DDD9UIcLL1A?t&AtAtLeDDDhHcIcA LMRL1A>t)A~tA~tLDDhHA L;{t LLHH&H{g4H{gL{A@i*`LsMmAALWPg9}LHcg%IfDMrA?(A-A Dh""GHfA L;{LsHHHL$HD$HD$9A?IcAA9|A)LABt-Hcg %IID$H(L[]A\A]A^A_gjyI>fALgLyI@H{g6yIfDABE10E1B LgWxLHcINE1Fff.AWAVAUATUSH(H|$t$H O HE1 g#(SIąHD$AHD$HL$HHH_f11g6ILsMLgMH{11gIƺMt A?M A>Bt.A~Bt$A~BtT$LT$DDD9uAUMcLHcT$LC,[1A?T$t*AtAtL!T$DHcDhA]PIcHcLA=MLO1A>t'A~tA~tLfDDDhHA L;{t LKLBHHH{gH{hg蒀L{A@Y*PLsMM AA pLPG9}LHcg~!IqfD DhL;{5LnHH,HL$HD$HD$9AiAEMcHc9|)LtHcg!IċD$C,)AH(L[]A\A]A^A_ MA?AA ]g*uI.fALg uI@H{gtIfDAu BE1 E1BLgtLH#IE1Aff.1ifVfDAWAVAUATUSHHt$HDO I#GAE11IJHu:gGHIg6HHgHMuPHHtYL{MtLEuHxgLHHIgHHg襩HLHHuIE9nSHtFH}tH1gHHt,Ht$Hgv/IHgHL[]A\A]A^A_ÿ1g+IпgIE1f.AWAVAUATIUSHXHc:Ht$HT$ I4w)AIAH!@IE9D$DD$E{uEAT>}@@u wE1E1HcI4>…{'_AAVfDfD9*"#$A|>("Ht$<1L\$(tE9D$a{}EAft@{|$}AEӃ,uVED$E1HD$(HD$@.fDAT>JDE?.6>.-~.#A|>}\$ f|$}AEӃ,uEEP.Lff.AWAVAUATUSH8H|$(Ht$HHHHt8u HHL$HHt 8JL|$(Lg*dHl$HgdD$AÉǃHcHHD$HCD$ MIDHD$ AFLtI,$H+T$~qDhHL$HcHcD$ L|$McHfDI?IHJ<(g-I4$HHC<H{IwH+M9uL$L$ I,$HIUL;d$ bLc|$ HD$JH|$(1HHD$H8[]A\A]A^A_HyHD$(HD$HD$HD$H\$g.cHD$HD$fAWIAVAUATUS1HdH%(H$1Lt$`HDŽ$IHD$dHD${LLL\$` Lcl$`A]HT$}LL\$dtHcgHD$EyHD$B(gHt$HD$H0H@{tjH$dH+%(2 HD$Hĸ[]A\A]A^A_@Hcg_HD$Ei H|$LL?qf.}LLL\$`l$`Ll$<)g芟l$ IHcHDŽ$AHD$D$dtyL1L%c71퐀\,=cqAjDCEl$dHcI4uH5L&HL)1LHɉg踞T$ sLIHD$@g蠞A<$HD$08H|$@Ht$hg跆D$ AHEHt$@DBt1~D$ HD$pHt$0H Ju+; FDB, SH|$0Ht$p IA<$"HD$(HL$pH t<.AA$<. HAH)HHD$H)Ћt$ D9 )Ld$hD$H~#Ht$@<0Q t<-u ~0> D$ 1҃|$H HD$09T$H0@0  D$ ;\$H~9l$H  D$ M5L;d$(MIM+HLH9D$(HT$(LL)HHHHHIHHHHHt HH9tHgLT$P{g]LT$PH1H Lt$PMLl$XMAIcHW1AH|$ y|$ >HD$xHtD(@HH|$x_MHL)I9#MMyL9l$(MPL9l$(EMcH|$@Lt$PJDLl$X H|$0HcD$LHR11HHD$g_H|$IzDT$EuD$<}tNH\HHH[]A\A]A^A_HcHHt?Lc11J<HH[]A\A]A^A__u1HV\EA~H?11@ATUHSgPAA~HwNDH1ɾ1:H}IHt HHHCH;HuLe[1]A\At$H}HcH RHAV AUL5 ATL-` UL% SH-H H,H1 HHL5L- L%H-s[]A\A]A^@HHu*fD&tHt\uHDO 1fAUATIUSHdH%(HD$1R;D$D$~CHcLl/A}[t+AE<{<$0ft A|,(1='tWHl$9pHLg1HT$dH+%(H[]A\A]H1LgHcA<t(9~$p|H|/]gH%wDA|,$I|,}g褜HuAEDI|,)g耜HufDA<,!]ff.fSH1t+HfDFHt< t< tA<#t')޹QHpHgE1H<#AED[ff.H?H=2(HHH鞋ff.fu<Ff)Љ}HH[i1F0ff.HH%H=D Hg賋H=HqfUH-H5?HgxHg/HH-g/HHgSHg H=g Ht8Hu]fDHg{tHZ 8]M%7ff.@H(HSHHtHػ-1H[US1H*HHu0HH|Hu)H[]1@ATUH HtvH81fHH<u==7HtHXHHtH-<E1HAx=B9&HD]A\E1HD]A\f.rHD]A\kff.ATUSHdH%(H$181H$dH+%(HĠ[]A\fHHuI8HtA=A~ 9~3H,"uHﺀA1Džx D;pH5F1IyLHH1g1UH=HgHHt8u1H]fHgxt{5==9} tCH* D$ H=gmD$ HoaHﺀAͼǃgܸ\ff.@AVAUATUH=SgiGXJG%HH8GAċG%t~HL-n| t$fL-29t5bEHøEFHL#L FLcHpLIdMI<gHMH UHLIH1HSL.LHXZHtIH[]A\A]A^% @Ru6Hɴ[]A\A]A^%̸@ u[]A\A]A^%@E1rLcKL4\t@Lc 1A};IHg_IiC|4\L-DAWAVAAUATIUSHt ? it4qHtH8A$8uLǶ=2lffD1N@ ~1LLgHBD( H9-HIILL8@ t6H'HLH&gI`jt@EſLϿ fDL/0fD1H[]A\A]A^A_LOHxgLHIf5S5DHtUH8A$8uLufHHtسfDLXHfDʵD$ D$ $f.UHSHBtT=B+H1sFlH[]fVu6CH[]@Htk(BÉЃu떐HfD t$Au IAutHRAufD=A8_1SfAVAUATIUSHD-dH%(HD$1Eu -ѿuAtot A<$8HD$dH+%(HL[]A\A]A^@t -5 H@@8tBHt8uD5 E~/DEt#DмEt=@~AF @HLD AEx-DEt!=t=x@~D5 H $Et_ucA@E@HAu2t.=?E1L`IEx;ѻA@Ņt@tH=,H1ɵH $eHH=1g>H $H) {tEx%E1:Auڋ5 u9u2HD tу=>uLE1gndSHH $gOdH<$fDH  Et U+HfH=IOATбRIMtM$$LA\f.u HcHtHc ϻHHHt f1ff.fUSHH'xHcgcHt3H=\t5uY'"t{HHHZRuH[]@Hq't:S"t&tHSHfD9uH1fDB@u\HSfHAVAAUATIUSHuHT$ gwHT$Ht]A<$~MLgFHAM9LHAg0IDD<"0<'trH5LHE1gIKIHL|HcgAuH@MH@\uz\AD$HSC2L1H:H*LcHcgcHIHttCD,HHL[]A\A]A^ÐH=IgHt\IA$M9AI^LpL`@;HQ5u&A<$~MLgEHT uHT$!Lg胊HtHT$uA1LgrIID$HW<~BLgju;AE+A[1LgrIKHvA\IAE11DUHdH%(HD$1D$_H|$D$D$g\rHt8HuHD$dH+%(u9H1]H/HxgmHHH@AWAAVAUAATUHSHL5dH%(H$1995HHxgEIIH1HH G۰H=@1d8oKHHtILg3RۺLHH5HEg!`LAgSgHHt!9Mc9H#.BL5H$dH+%(HD[]A\A]A^A_ÐH=8gH=m8gtZH1HxgoHHIxn1x@D2ff.@H Iff.@ATIUSHdH;HtD H{HHt3C9}~)HcL8uqu[]A\[]A\fDATAUHHH5Ht%Ht :u8uHT$HT$tHDH]A\HߦHxgHHH]A\%*f.AWIAVAUIATU1SH(dH%(HD$1HMt 1LBHHnHxgHHHD$HDHtH|$ЅH9HtH|$ЅH1LHD$gmIHA?~Iu A<$~D)LzCL|$McB|8HcgHHHIcKt5HH0HD$dH+%(H(H[]A\A]A^A_fHHl$6DHL.HxglHHD$dH+%($H(L[]A\A]A^A_%^fD5H|$HILH|$vfLLĦL/g΃IHtvA}Dt,A}AFt!A}AFtLeDf.HcgLHHA}uHcD$II@D$HuIcHDAthAHUHtHHHTHuHHD$HD$HHH[]A\A]A^A_%;2<DLcl$EtfDK|I EuLffDA|$g}2ID5ڵt H?AՅtiH[]A\A]A^A_DHEtH;H7L(fH;oHEHCH H;RHff.UHH=EgoBItH5H1]fHH55p1HfHH5P1HfUHSHdH%(H$1t-5HHu9%H8f HxgHHHEuQEHUHcLHBH< wIs9HcDuf.HAD Hc< wIsT@HIlADWHE|E9H$)HLcLH=BƄ$W9HL`LgBLc LAIN AsOLADžtHE111HD$(DH!HIcAHTH9~mH Et-HH $H4A8uHT$LcH $uAED9AH $HDgV H $Hzf.Et McJDH-ȜHt^HcHlHtMHHxgHc~Hc=HŋrHHEHnH4KHH[]A\A]A^A_fzI${YhH1{g'Hc HŅ~ H51HHTHH9uHDHff.fHN1gnTH5 H=ǑY;1Hff.H= HtL;5q3A?.u AH=DgLIHgXKLHHg^IHzH!H|/$ZE7u~AF<vAU8UD8ALL+H|HD$dH+%(H(D[]A\A]A^A_fDA}~u!$~E11AUf`LggHLXHLg~Ņp$`E1DHLE11LL$AHui@LIƃpLMcHcgaB0/IBD0fD Hg IHHL#LgI1MA M$tLLTDEK@LAɄLgMH.f$LH$ f.AWAVAUATUSH(|$ dH%(HD$1HD$kD5JLc-ELd$=mA^~EH=HcH ˠ gbADž=.Sl$ AuD51@E1Hl$AD9~4IcL1Hl$H)LH5"HwHuAD9D>fDEAH=DEH=DHcH  tg|<=9Du~E1E1H\$AA9}IcL1H\$H)LH5@bHwHuAfEAl$ EDf1HT$dH+%(uzH([]A\A]A^A_ÐE~11DL|$D9HcL1L|$H)LH5HwHu  vPAWAVAUATUSH8dH%(HD$(1HD$ 1HcB-H\$H!_L-\$ L%H:9fH=gHcH=Hхt~|\L5`hL5M9|l@"=LAAAG AAD'EVAHDDHc9H4tkDB 'G\n=Ñ A sD9Hc̀<t95 1HT$(dH+%(H8[]A\A]A^A_fDD IE0(uOfD9-~UH=^gFtB=~H5BHcHAt9-2D$ l$ t9-c1/uLgoH=ŋuLgGH=ŋ<9fD9H4L5L|$ DDB '\"=@A<=t<x39H=HcH4w1fLL$HD$ 1LI)HD$LHHfuLgŋW99H ,HcՀ<kf.=Ŏ  t fDLT$LL$ 1LI)LL$LHH`uLg7ŋ;f.)ADLL$1L|$ HL$ I)L[HL|$ @;fDLL$1L|$ HL$ I)LHw%H=HL|$ H=^LL$LL$ OfDHD$HD$ LL$1L|$ HL$ I)L{~HwH=FHuhSSL|$ H=$36fDH;ANjANj}}fDAWAVAUATAUSHuHD[]A\A]A^A_fD5PDD-?D%D=E9E9DDDIHHzDD-hFLUzDDD%L*E1H6z4"LgqHghAD5 tH z1H 1fU1H1SHgmH9t H[]H{HxgHH[H]%zUH111I{5=1H y111]%`{xTS59u=t1[x|=u[1[@xTU-5~9u=gt1]f|=IuM]1AATUHHH?gMHt!LxMtH5LTxLg=Ht&HxHt$g/-t|$H5Lg=Ht*HxHt$g,t|$H5DWLg觋Lg螋Lg蕋{Ht6|t1z1@kHc[Hc1s1wLyouff.@St_u tyUH tHH9utIg1[FuCug|D1DFg`ff.ATD%UHSHcHtH5Ivu5HqA9t=9y~HX< t< u6[]A\ÐHHHqA9uË<[]A\f[1]A\%Wrff.@ATUHH=Ht8HHg?HI(qMtLH1]A\f[H]A\ff.HH=ug_?HtH1HHfHH=5HtH1H@HfUSHh-H=Ht=H5u!? sH1[]f)݋)@[H[]ff.@ATL%H*UH-SHHHٻpL%H-ŻH^[]A\fATHu?UL%bSH-H+HLHykpL%4H-eH[]A\fATL%H`?UH-3SHHH pL%H-H[]A\fATL%H@?UH-ӺSHkHHoL%tH-H>[]A\fATL%OHp ?UH-sSH H,HYKoL%H-EH[]A\fATL%H?UH-SHHHnL%H-H~[]A\fATH=USqL%H-HH?HHWnL%JH-{H[]A\ff.@ATH=US_qL%H-AH6HH HnL%H- H[]A\ff.@ATH=USpL%H-ѸHƸH_HrHwmL%jH-H4[]A\ff.@ATH=USpL%0H-aHVHHH1mL%H-+H[]A\ff.@AUATUSHH=oH9HHgE:HIkMHcD%JLH5(oZLykg:L-HLmHxgLHl5HE1HEgBxHIgV~MLgLHg8HtH5HSoHjA99{~&HZ< t< t 1kH1[]A\A]fDH[]A\A]3gHWf.HH1[]A\A]LH(AUATUSH=u HHH=HwnL-L%HصH-qHhHjL-|L%H-FHH[]A\A]@ATUSHH=yHtEiEH-x<`J<$HxakHxg蟰HHiH=xHxIHHthL#kI\L9L%@H-axHH93@ t@ t@tLgJHtH-+xH9H{HH)x< < wH5`iHwHH8HHxtw3Hw1g2HHgr*Hg^/DHYwHHcEwHH[rj1Ҁ8o H=#s9rHtcHsHgF\rQ}~ H&eDoqHxEjgTHHhcHqIċ=L%qt5 LdH=wqyqHt fbL%qLdHxgLHb Rq qH)qIHq 9q#qH=8q1xgzHxxHqH9 H pHxt =Ȯ  Hg%HcHxg HH bHpIHHpclJpv H=g56H=o@qHoooHt`g_H=oHoHt`g).HofD-oAEAD-woIcHlHL4MHc}oA]L=oL-lHcHD$IfDHHHMtMgoEt$AA8uHT$LL`ufDLObHxg荧HHD$(dH+%(j LfDD%nAD=E9HcnIcH nH@HIHlfAH0D%YnE9t\H{tCtL3Et6A8uDD$HLHT$HL$_HL$HT$DD$uAD%m=nmD5nEDl$EHcmH nPHH8mH=mHu?fH=m^HcmP{mHnHm@Ɖ5m.L%lHx L%mDmHclH5mLEj^E1Aŀ}~L_Hxg<LHP^IL%lELD-l_HxgLH^H|$ HD$ ELl$ Lg1JAL-]L-FlEL]M9t L]L\5kL%kL_= lHkkH=kHg L-k/L_HtL`kHckH5kL&]RL^HxgݣLH\L%RkIfHjHD$H)kLc=kL%7kD$jD|$D@Mc D$tIA$8IHD$JDHHD$D5jtLLH+auH]HxgHHD$(dH+%(HXDgHH[H=wjHpjL%djHgO}~1Hg%IHgvLZ1iiHiHgiLc5iL-iD$qiDt$HLc@D$tFAEA8$9IJDHL D$D=)itLLL_uLy\Hxg跡HHD$(dH+%(LH8[]A\A]A^A_%ZfD hEH)HfJ_E1Aŀ}~ 9hH5ht~LL%hIELMdYYgFAf^DLLLY@L=QLHC莴IMUgt0L=1?@LLHaY%@L=@gjE1*f5"g"gdxn41Ҁx&mgE1gpM9t LXLXHѕH#gfDnE1fDH=fH>Hcf<-H5fgIHf ~-.H=pfL%qfHtL9j]WM[H5f1LgjH5JH4fIHH]HtL1H5Ogg IL%eLV5e1Hg HHf%YHxgcHHwW/HeIHYHL%eL1薪H=eIHegVL%eHgt#HHHzd5eL%e8epeH=XHxg{HHD$(dH+%(XH6|1LĩHdfA}eH}Ug A..fDIL1ghLHDUIH5BdHD%cEteL議IH=+dUL5dLTLTL%dHc%HdE1XHLH6IHt-0ct HݠnHbVfDATu*L%1H=RjLVH;WtXA\DL%H5H=6MUL1H=jVL A\H:jH5cW%YDLH5j A\%YfH5itBgG(:H "'@><=H@;|&(fP HYHff.HO5aATH AUD%!iSH-HD iH uHH9-@HUH…8tD[]A\fDHTHcH|g1HŅH HtDH@tHuH=hRRD[H-W]A\tDgə(:H "'@><=H0@;|&(fP [H؞]DA\f@HxH5\R@AWAVAUATUSHD/`dH%(HD$1Et&HD$dH+%(H[]A\A]A^A_H=L5Rg<&L-H-HH[HtLL=H=&HHeHƌHHЮ*ULH=UH5IH=TH5H=TH5H=TH5~H=TH5H=ڈTH5H=ڈTH53H=fTH5H=MTH5QH=È4THH=ÈTH5CH=TH5OH=SHH=SLH=SH5H=ˆSH5H=SH5H=xSH5H=_SH5H=FSH5H=-SH5H=SH5HH=RH5H=RH5H=RH5]H=RH5H=RH5;H=~RwAL%LLVLL^VL-HLHl$V 1Lf|$HSPL5SL91D$ LH0PL9L5@1D$HL PH;MH5 L{+VLH޿/VLL/ V~1Hft$LOHH;1M LH5q~UL@H57UL@H5UL$H5]UL$H5rUL!H5S]UL!H5HULgH5Y3UL*H5dULgH5/ U 1LfL$HNHH;PZHHH`H1HHLH-UH!HH5+HH]HV`TLvH5KTL@H56TLH\QLH*PLH=P=1aHHOH5C[1H HH+H @JHuHLH_HȞH51HH#HԗfSLH5QSLH5J{u $H[OL E1L=uHZf{u D9jELϹLDgzL d9|RHcA tFD@|u~A| >uDLϹLgyL $A9|HA<tA댋t$ LLgyE1҉l$0D$,L1fD95!t D95<Ht H=H=Ic< t< zAFH@H t tHvwgyH=aAʼng Eu1HHgZIl$0DA݋D$ |$,A<$tUEu9t$ |JD9l$, 9t$ t$LD9u|$,9|$ uA$A8D$DD$#D$t!L$DD$H|$t1Mt L;|$DRgxH5L<INjD$Du M/@"fD~sA9}kHf.HA9}TA t tET D9~@A| {DT$,t>LL$8LDD$0=DD$0LL$8HDT$,uET BLϹLDg.wL w9aHcA<SD@L=rLg5HH=5A$B7<<A<$`D$='L5Rr~DdH=tgH=ĆHDI‹l$0DvHtHD$ Hg HD$DD$EO$@;l$  D$,YD9PA<$u D$A:\A $ÄJ H HcDT$D$DD$`XD$D5At$ H=Lg葇;D$mD$E1G1gdAƅA |$,t D9CL$,A<$5D9,D$t;l$ H Hc< 7< *HڄHcD$,<D< < D$DD$D9MyH\$DLT$0LDL$,ILgxuD9LT$0D$HHH|$D$D$DD$LT$L$,IDH|$ Lg"uLT$HHD9A$D$<`='wLT$0LL;LT$0D$DD$LT$0LD$D11LH=yqgrtLT$0HGH\$DD9l$,hLT$8LT$0gT$0LT$8HvA:2A $%A$A8aLT$0LL:LT$0CD$A$A8(LT$LLd:LT$DD$D$AV8D$(fAVAUATUSuTHH=jDHt5H7Hxg}HH06HH6D71 D9fb5HHLc-CH+EtEL5CE&D:et^H[H+HuHkHHtD:euLHL5uH97Hxgw|[H]HA\A]A^%5IcHLY5u<[1]A\A]A^f.UuSHH=ACHt~4H6Hxg|HH5HCH6B+74HtMHcBH(tH=BE8uH4uHR6Hxg{H]H%431]fDrBHCtHH@HHDUa<HH讻HM5R7H951]ff.fAVAUIATUSHdH%(HD$1Lt$;1LLIAɋt$Lg(HHcAT:t0HcfATH:u1ҍsLLק…t$LgLI赺LHH4LH5GH^;H]21HT$dH+%(uZH[]A\A]A^fD:p1H5lS4LH1g蕚Ht H1Hus4UH:H1HH:AEu]ÐH5Dm13HH1g1]f.AUATUHt5}tH54H2I2f[H53IHx2IL9t L1MtI<$tH5L|L]A\A]7@"t@'E@@HHt1@HHHHHuff.1HtfH?Hu@ff.@Ht#HHHHuH1HfDH@ATUHSH>HtfHAf8Et0H{HHt@Et HgDtۋC[]A\HHL4tH{HHu[]A\ÐUH.Ht?H H.HHt,9~uH1Hxg,wH]H%?01]@AUATUHSHH>HtsAH^E18Et@H;HAHtHEt HgCtHD[]A\A]f.HHd3ufDHA[D]A\A]@ATIUHc)SHcڍ{HcgUvI4,HH3[]A\ff.AWIHAVIAUATIUSHHHT$ L$,0LD$ H0AD$(ۍ<AEE1E1Ld$LE|$I$Buمu E%Lg HtE߃DH[]A\A]Dff.@H.H@H(2fH57H>4-H57H>-H5y7Hs>j,ZH5I7H->$,H57H>1w,'6116%6g-H]%v'fDH6Ht8u/Hg5Hu(H6Ht8uHbH8uHT6HuDH5A6SH>+I1MH=6=a1H~+H==HGHa+H= =-HG+H=<H-+H=<H+p&v5Ht 0j511h$R5g[Dg"*H5C5HaHHDH=!5UHHt#HtMH%Hxg2kHHF$H4H4Ht8u]1]@gjH4AUATIUHSH#}TtnHEfD}EuH33Ht8uH=K:mH(I@M>D#EsH;1H5]I#LHH1gSb0fDH=2Ht>!ML|#HxghLH!8Ht2HHƿE1'HAu~;/H5\1#HH1ga "211!1g^HD[]A\A]ÿghH1A"1H18ta1fH=1Ht& Mt"Lh"HxggLH IH5h1L%i1H>L!xfH)1Ht8AH=.8Y1Hv&I!0Mt 0110g$H0Ht 8H=7H&IyD'(HIH5[1I%!LLHHE11g_fLA @'1H5ZI LHH1gz_DUH-6HgoHH-6H HgTH]HxAUATUSHHH?HH=6AHHt(t!u:MtA$HD$dH+%(H(L[]A\A]A^A_LHT$DLH4IMtD$A$f.u.LH5V1!MqE<$hDHt$LD$HVHŋD$H{XHDgL$ IH5TWHIؿ1!HfDE1fHHt!HHt.DH.HfDHgfHt8t HHga.fHff.@H=)0ATE1UHSHdH%(H$1HSD$A%=@ttH/Hu*0=$H҃0g.ukHH;Hu׾HAuGHqAD@EDDH$dH+%(uHĠD[]A\AZf.UHSHt<u t2t.HHxg+`HH[H]%9fH1[]AWAVAUIATIUHSH u >~)H1LgHHIM@!usAA@t@@udAA @E  J@@H=W)QE Et @HL[]A\A]A^A_A}.M<1LH=3Lg (H1LgiHInM9L" D^H=(P@@OfDLE1Ff.1Lg/(IƅM8.D$fDH=!(HtvH (fDL5,Mu17f.=!L҃0g*vII>HuLbHxg]LHH'?AWAVAUAATIUSHHdH%(H$19'gHcHt;uNLHxg]HH$dH+%(HL[]A\A]A^A_%Lt$ H=1H&LyHD$(HD$ HD$<+D$HD$fD!!Ht$HHHLLDHBHIMtaLuEH=&&Ht {H$dH+%(HL[]A\A]A^A_@L?Hcl$<+9L=%MtA tLGL=%tH=%E1H%l@g"D= gLH$dH+%(uHDL[]A\A]A^A_ ff.ATAUHH=GHgHtHpHt>u+HHxgZHHH]A\%DHDH]A\&fDS:èt n1[ff.HHff.@HHf.$fD@fDAWAVAAUIH=FATUSHgHH@*LgkDD$ H/E1@"$LL IHt "t D$ HL[]A\A]A^A_ÐLgŅtA1LgnLHxgYHL[H]A\A]A^A_%!Lg'aIHt "zLufLg`_Lfg$LHIIH LDL{AAEA8$t6utL#"LLgB_LLuff.AWAVAUATUSHT$ dH%(H$1t\Hc!D$ HH!HHtDt$ AD5!H$dH+%(H[]A\A]A^A_@H=p!IAHcY!~H=R!H14!Lg+H(!Ht$ H=+ $,H=Cg_D$HL|$HHcD$<LHHHtxLHL$ DHHIMtHc5 H= V;u tOi HcL4HH=c HtHM Hf* 1fF  g6Hc5 H HǍVHDLHH1H@DHD$(HD$ fg蛠H+yff.AW AAVAUATUSH9LЉt$11E1)Ņ1ҾD1 1ɉ *AH gRHǃHHgB-D1HIEH|$gH|$H‹@EJHBEzAp JH HH HHߴIUL-Դu{H[]A\A]A^A_fgH‹@JEHHBHHH|H}IEL-jEuA~ B t1 H1[]A\A]A^A_ 1D1 Ņ]11D1m AŅ>H5H1H1gN@HHHHHIEL-@HHHHHIEL-oA |$ E-1HgH0HHH"DAyEp  ff.AVAUATUHSH0dH%(H$(1IL]tiH1@΀Aąx1H$(dH+%(H0D[]A\A]A^ 8uADD$%=tH1AąxL$DLHu=$%=t*D$%=tLLHHgw6D^  X ff.@AUATUSHg@=HNj/tO1L-gLIgLgV;L$HgLg<HtGH}Hu%gcHIgHL[]A\A]DgE1H[L]A\A]ÐE1ff.AUATAUHSHHGu_wDAuVE1HZH5fE1 HH1gXHMHL[]A\A]%4@Hc{A uE1HAD$ApHEHcHH5EqH5DEYH5jEA=FH5DHHGH(H HxgNHH HI=H5D1E1a HfC|HH{ ot u GJIHC hLMH(@H[]A\A]DghHIDHH= UH1guFCwBv uuHC H(RHH=T[HH1]A\A]$FuHc{ gZhHlfHc{ g>hHI3fUHAWAVAUATASHHXDoLG HUDO DwdH%(HE1GDEAELIH8-u xLELg|LEACALsLLEg1ɾ HHLgLEILEoA MG EO AGLELEwDMCgLEDMAwoHBDHcH@AtRCH A>Dg=DgEu Lu Dg͓DgDl@E1HEdH+%(HeD[A\A]A^A_]DEtD%ELLEXD IEtDEaM =t LCH5(LEg< ίEt A uL|AHEL8@AC E9AtUCsAEwBDM11DlDMt#DϺ DMDEu uDMDg-DMCO L{DMIcI?gHe@(@XI?g,DMAADM1D1DM A A Cƒ((u0A~*A @t DM1ҾD1bDMfDAADDMgu}d}gC;E1vMgMMk A9AA@LL=LELgLEI8LEgLHE)EgLMELEMɉ A93LM1H=P1LEaA@LELMH‹M;tELHUEHUE}CA!ACE9t11DYDDYiDg訏C fDDDDDgAtAjDg׌E1LsHE1ɾ WHPLgLEILLsHug߸LEAEt HUHcH9D‰Aw?A AKLEH1LgLEI$@ALEH1LgLEIH I LD$ILLEgMo I}LEHHH)H|$HI8Iu2EoLEDHEfD1uLAHE8u1E u^ uDgNnHEfEHEL8A@]DDg= gDf 5ک]LgoAHEL8A@QExACAE" GuDE1gŌDECW E9tDEDDDEb A A- % At Al E9tAEDǃrA A|ArA PPE9?A fDELEA@A@E A@ID11DM D+E gYDEAfA0HËt ugbDEt`DDE1DǺ 1AEDED8X ACDE9M DE11DDE* DD,DEDfL=LE{ LgrLE1I8LEgO LR HEEg5LMELEMɉ A9 Ay/ Ay As ALMH}LEEULEHELMg LM11}LEwLELMHL93LMHUH=7LEgE5ULEHELMLM}LE}1HELHu}HMLML9LE"ҸDM;tMtUL*UU}H}H}HEU AD D1ɾ H} gHؠHHHʠDg1C'E9DDg袂APAFD1fE9wfHEL8@AfDAFDM1DDM@ 1D1fAUDENDEH541H1g:DUgbDEE`DM1DϺ 1AEDMD51DEH54yH1gn:@HC1L(LgÅLg#HH@)u1g HHt#?tHugDxHEAƅQADg躃DLEHM1LguLEIfLEH1LgELEIifDMDDDM<1H=1A~H‹d@H}HtULELMULEM9tMtULUHEHELELLLM} HMLML9LE)ҸDM99U} UU}HEU?DL/bfM;H}11ADž}H}vcH}D<nD1ɾ H]gHHHHDLHMHU1g] HHG(\DTL111g HFfDDEDg諃ADEH=@0DEH=@H=?g9DEH[DEIcH;gDEH@(@ H;giDEDMDDg}DM3H[IcH;gH@(@H;gDDgU}AA@AytmAyLELLMMLMLEIMIDEDDg|DEAyNA^fDM11DDMDDDDMPdfDM;0}D}ADEH=qBDEH=~qH=qqgKDEDED1ɾ H{gH֙DEHHHęLDMhL~ZDE1DDErHEALELg9LEIHEA C94D DAH5-1%H1g4}gEELELLMALMLEIHEHpIBDMD1ɾ HgIHrDMHHH`8LMLE1H=HE1HULEALMM9nKfL1g襳HH@(DHEL8DSDEDA}8APDDDEDE1DDAHEAL8HEAL}Lo1LgÅ_LgHdHEAzLA}M9tULUHE H]DU!H}gU_H]H}UH}@}U/UL!}Uff.AUUHSH dH%(HD$1t-H=HtgHѕH=tg!HtlLl$DH|$HtHmHtGLHHD$tHT$HD$ H|$D$ Ht>D$ 1HT$dH+%(u H []A]ff.@E1HtG@"t AH?Ht'GuO wHH6 tH?AHuDf.SH=z gun ~fH d L1HfIEH@AK<>uA}A1gpMcHIIH(Ht*H$HHxg]/HHqH$HHH,HI9uLHHD$LDb DbHP~H[]A\A]A^A_fHD$H@H1[]A\A]A^A_fg5pHHff.fATUHS1IgpLHL @gyC 1H][M ]A\USH1HgoH=hHH8gyE 1Hk H[]fUH1SHgoHg膞HH1HtgSyC C1H]M0H[]ff.AWAVAUATAUSHH|$tE1AGdd=xgoIHchƒHcډH)HL, HI9txHHHttD9`uH@LpL HxgI-LH]H5C IHHtIcG I7HxA L4I9uHD$LxH1[]A\A]A^A_ff.ffD1ffDUSH1HgmHg6-HEHgwE 1Hk H[]fDUSH1HgmHg覂HEHgwE 1Hk H[]fDSH="gH="gH="gH="gH="g|H="got a[ff.@AVIAUIATUDSHg&1Hg蛶LIg1Hg脶LII$g1HgiIIHt&DEA~D DA9t3HHuH=`!g諵H1g IEL[]A\A]A^H{Htg1Hff.ATIUHH=-uXHt6HH9Pz0%@uDt<2AuMH{AHtAL5m/HHH]A\%fttH=H:AHu=LHxgB*LHVH}HH]A\%5DMt uA $'tb"t]HufDHtMtA $8t]zLgViL5.@HHA:L$uA|$uH.LGff.fAWAVAUATUSHH4$HH$I@&?Ht\uHfH$HD$HD$18!IA~E1gDjAv Ią @IJ@(D'DD$W(HWE8LgL$IF@T$L$0H5 l$\AH|$ )H\$H,HT$AHI~@LI~@IHD$8[M/XHʼnMtJAIEH8Ht'?t"tt MmAMuDDzHcHcg6Iv@IHFHD$8AD- H(HLd$@Lt$H=HcLLB3H}t Hc҃AD L7HmHtVHEH8H HHDggIHWIƍDD9|D)LE|@IcgIt@Ld$@Lt$HHcL11ADgTHHH(gH|$8gLH= gH= gH= gH= gH= gvH= gi_H}gT1IELd$8Hc։Ll< u"8HcLlAEt< t<\u| u݃Hg՛AwIIcG N9I?HAO L$AE< DSHcfDHD< tYLd$8HcHH@LLgL 6LD$H|$( L LD$}f.UHHHtսH} HtƽH}(HtH}0HtH}8HtH}@HtH}HHt{H}PHtlH]%bf./u ffDff.@HXgH@H@H@H@ H@(H@0H@8H@@H@HH@PHfD/u fDff.@ATUSHXg.HkIHCID$HCID$Ht"HHxgHH HIl$Hk Ht"HHxgHHۼHIl$ Hk(Ht"HYHxgHHHIl$(Hk0Ht"H)HxggHH{HIl$0Hk8Ht"HHxg7HHKHIl$8Hk@Ht"HɽHxgHHHIl$@HkHHt"HHxgHHHIl$HHkPHt"HiHxgHHHIl$PL[]A\ff.H=tDHg HHDH1HtB ff.H=HtH5-ff.@H=QHt$HgJH7Hf.H@H5HtGU1gH1Ht+H}Ht /u H}H޹]ATIUSHHH5HtqL1g3HxHHt/uH][]A\LHxgLH H]HE[]A\g HHufD1H5:<LH1gnI4Lg,1Mff.fATL% U1SHgLHg莇t9t$atgd[]A\f.g []A\HuBHufDH8g蟀HHt7HCH8g:~HuHCH8gU g1f1u@AWAVAUATIUSHH DdH%(HD$81 H='E1E11gFH=L=g5JHH-Hhg誊HD$ HD$HD$HD$fDLLg$[P(wHcDHfgH=~gHD$HD$8dH+%(C|$HH[]A\A]A^A_J#fHAHD$ l@`H!HD$L@@H@HD$,@L-fH HD$@L5 ˀL=9 tH|$H&HD$(CIÀT\gozt Mt MBD$tHD$H@t H|$ tbHE1gCD$IGH8H=:nIHt LgCAD;t$|cHg"DLgDM?MH=:(HHuIGH8;H=t:D$IHu@D$D)~ADJ|EtHLgDxJ|g[~D9l$IuCfDH|$(t H|$(ݱH=igED$D$gB^ D1H5 H1gi@RHH`HHD$(RÀ1ֵ1 -1yLOo1LguHK81H5\ILHH1g+I9HH|$(HtQH=g|CD$ZH?HHHHD$@LHH}IHH51L53LH-H1ĴID$(\$LIHHH{H DHIEH1I9uI|$(\$t H=OLg@D$H\$HH|gHT$0HHHDHct$0HL$41HHH|$4uHH|$1D$#H;e HƬHD$(HHH= gADH|$ g5yD$ gxD$HhHD$(HBH!H=gLAD$*H.H5-1RHt$H1gH|$(HuvH5p1Ht$H1g[H=/g@D$HH51ԭHt$H1gHD$(HHH5LH1gD$H51mHt$H1gD$H=tg@D$H51'LH1ԱD$m\$WH|$gx8ATSHHdH%(HD$1HtHGHt H8?-D%uEt`HHgH$HHc KH9HNE15HD$dH+%(HD[A\f.:uͺH51"H1ggthH5#?g5Aqf.H5W1AHHCH8gvpf,߫ff.@ATSHHdH%(HD$1HtHGHt H8?-D%Et`HHgOH$HHc H9HNE1ѺHD$dH+%(HD[A\f.b9uͺH5j1ªH1gthH5%ì?gՏAqf.H51AVHHCH8g,f.DUSHgDu@H)Ht9HCH(HgT&Ht/H-PH;HιH[]fDH[]@HgAVAUIATUSHdH%(HD$1HtHGHt H8?-H=gJqIHt@(L`H=g'qHHt @(tiHhH=|gqHt#@(tLpMtANt HtUuhAHD$dH+%(HD[]A\A]A^fD1@E1lH5E4gADLgAŅHHMkAD$^HCHH8g~_LH4$g艆HIH$HpguLHH$HpgaMHHHILH51fA1Lg HIgH5HHhHHDMLD1L:{HCAH8gg]ATHISHH&H=LD1Lg萋E1HtF@(AAuLu6DEt*At"LH=gE1²HD[A\HAD[A\ff.@AVAUATUS1gH-oAHH= D5Ug/y1H=IHg躊Ht @(DEEu uIHDDt DEHtH9-t H[D]A\A]A^f@(tLH=gfH1gu!H1H$H-xfDH=wgHff.AVAUATIUSH54HLgZgHŅ/1Hg IL0IMtA}LĢ~3uZAH HËL3D+iD+E1Hr[D]A\A]A^fDʢHË$tE1H-[D]A\A]A^fHLE1 ULpuEugHgnAHס[D]A\A]A^Hg2If.AbH fH=HtvH=HgHHcLaH=]gHHt%H5>LH= HtH=$HgeHHt-ϠAI@L/'qfHAg!ff.AWAVAUATUSH(DLdH%(HD$1E-LHL%t\NAgRwLu{1LHgrPto=ug肇HT$dH+%(OH([]A\A]A^A_f.euD-رf1g봐gj mfD5=0E1HʵAŅt rtAptu ^HH;'HCH8?-u vgbu5KHCL LDAt,LgC:IHtHljL1LD(g|eHDHH=H1gL9p$HY$\H=ŎgLsH5fIHt4Hvf.H51,H1gqLgrIHHL@H=grH5IHtHPLGDH=g]rIHHHCH\$L D$ L'LHgcdHHLH<$D$gH<$ILt|$tLuH=HtLCLt@HATE1UH-SHgsHHg1ot\Lt7Ptt5g[]A\DA3D1@g蒃[]A\H=H5HuL,H~,t EE1H9-ǭt H[D]A\ 1gHH=Ht9HumHH=gHŸH r +t11H=1gZuH=7HHtH9tWHH=HtH=egkHWH1H=*1gZAHݬEtaH8HA1ff.ff.AVAUE1ATL%U1SHHgqDVuSLHgmtmptX&ug諁H[]A\A]A^fvu @gH[]A\A]A^AL%M0EucA A1ID$DH8gÅuEtID$H8gM$$Mu19~EuL-LgF,gsLHHXgHU0HHCEHB HH=\E1 g.HgLD$ g-D$ L-Lg+g:sLHHXgHU0HCEHB1cH=~gLfAUATL%Hg{H=LH1c)tGH 8AHt9uHA\A]DH=HLA\1A]%ifg1H5AH=<DH1)H?H6)u%f.ff.@ATIHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HLH$H=a$HD$HD$ D$0HD$-H56 HD$dH+%(u HA\ff.HH591H1g>g}?ff.fATIHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1k1H5"H=0H1 HLH$H=$HD$HD$ D$0HD$ҕH5 HHD$dH+%(u HA\ATL%?>MtA<$uKH1Hp CH=|H_H1eH=^A\%fD1H5/H=5LH1"HuP@UHgkH5NHgVgE1tt4AD]fg{A]Dff.@UH5H1XH]H1f.UH5qH1(H]H1jf.UH5_H1H]H1:f.UH5a~H1ȕH]H1 f.UH5 H1H]H1f.UH50H1hH]H1f.U?0Ht/H513HHH=1]nfDzMIIDJu!xuH51HH5Q1̔HUH5H1H]H1f.UH5H1xH]H1f.UH5ԮH1HH]H1f.ATIUHHt9HHtaH51HLHH]1A\>fDHtKH51ϓHLH]1A\ H51IH51Iff.@UH5!H1XH]H1f.UHt*HH51#H]H1eD1H5]H1AUHt*HH51ӒH]H1D1H5]H1UH5H1H]H1f.U8AH5]1HJH]H1ff.USHb8t4H5H1HHH[1]<@˜H5HʐrATAuIouUH="Lu`NuFH=g9uUDA\=g>tgl8f.gZ8=g>fj8H51I LAH1HH=g RH=~DA\HH1g$H7HHff.fAWAVAUL-;8ATAUHSH7AofDI}Ht!IEHHEL8LPHxg7LHHmIEHD I tHDu1I uuH[]A\A]A^A_&fDH=I7g軡HgbHH071g\7Et7u%HH9gt#lf.WpIbD1ff.AUATUoSH7H@H=6HtƌH6HPHHPH9uL%`6MtsID$L(LڎHxgLH,LH6H#6HH6I$g胠-5cH[]A\A]H=6f5f:f&D 6Ѕt@H H9 ߝuЃÐATUSHHtHHt[HCH8?-tZHgDuj Tt1HH9@ƃIGH8gƒtH1HfDIGL1L iHL1AM?M`HD$dH+%(H(D[]A\A]A^A_@H5IH|$qH|$L-@L5ZDH=4HDg2D$h+H51vLH1g9D$h@LtHD$HHD$rDH51vLH1gD$PLXtHD$HHD$+fD1Lg-vuD$01E1fDDd$ED\$\$`LELg=IHD$ $MD$ @^D$  D$03DT$@Ent$XLgIIE1MAA(%=AQ(D$D$ %DL$3IyHLL$@1g-LL$@vAQ(fD1fT$uXLg?BHP(LIDE1ADEOLg78Hu<$tDT$`1Lg2:T$`HIH(sA|$DH=1gGHxHHtqgmK(HCdDP(ELIE1DD$ DT$@DD$Et$u DD$`D$@ D$AA@tDT$`A!D|$1EEAmD=@A}tDA}t8DD$LL$xLL$pD\$lT$` sDD$L$xLL$pD\$lT$`A+t$HA@(uHA|) At A@@sD$ (D$ @4 DD$`LDT$Ht$0D\$g`D\$t$0P(IDT$HDD$`ЃDl$ DDD!ƁA ׉$!D @' $AQ(T$(D\$0LLLL$ gzLL$D\$0E1AQ(D$ t  DD ҉$D$!AQ(MtAt AD$DA!D$(Lgl@A܋\$@H51HD$qLH1gѯLL$IyHt nLL$Aa(E1IAD$`AH591pLH T$`g8T$`H; @t$XLg IIIy$LgD$hl$Dd$T1Dl$8@gu%M?Mt>IGDH8u(EugtIGH8ggH$dH+%( 1@HĘ[]A\A]A^A_DVDL$@EMEH$dH+%([ HĘ1[]A\A]A^A_jLL$Lg0LL$HII4A9D$,vt$XLgtBIUH5@1nLH1g:D$Pt$XLgpFI$DD$`D$ %DL$kЃD$@21AQ(A@t ED$HD$Lg5LL$IHt$0 t$LL$Lg/LL$Ht 9H,M!D$ @qH5$AQ(@HPAFT$b1H5IZLHLH1g I9t HuXLlXf1H5ZLH1gL]HD$H1LAgHaH5ޑ1I+ZLHH1gjI9HWH5e1YLH1g.D$N1H5Y1LH1g1AgD$$ D$t$H|$E15WL-~rL%r$LPgyLgyHHUHCH8gHt#Pu tt1gHCAH8gDLg9D$ILD$g!LHH2WLD$HLfoOBD{_HtLHHVbD|$-wD|mHcg轝H5vHHcvHH@HZH|$Ic1ɋvH4o&HHH@HH onhov p H9uHcH=vH@HHHH@@HvH9tUHZv-Pvg&H|$AXUH|$[Hgu2H=kHt+gH5EHH(HfDAWAVE1AUATUSHH|$H=I@t$ dH%(H$1gHHt @(QH=@E1gHHt @(OH=@gHD$(IHt @(H=jgjHD$Ht@(H@HD$H=ojg@HD$ Ht@(H@HD$ H|$11[ADžcT(HÉ+D$ t OT8t H|$g迒D$ \$ t;AH$dH+%(HD[]A\A]A^A_fSE18AA!ALpH@HD$(fLhHD$fHD$ fH$H\D$ D$<HߒHD$@$%=@|$ yH5=H$H=u HH$1DgLcLL$PRDHD$HL$XUL$XHT$HLL$PH$ MLL$`H|$h_TLL$`HL9E11H\$p\$gAHD$0HD$H8hHD$(Rt}D$$H=gRtW8D$ D$$H$dH+%(H[]A\A]A^A_--@1H=GQYNŅD$ ^dSHD$(Ht H=AgD$$=gwDE-D$ u[ tDEtH=g@g?8DgR?D1ɉH=gڊg4&uPD$ u D JEDjED$$H=:gTYH)@5D$$HUHH;KGt H;ZF= E_D$ zxgHyHD$(HKD$HD$(81H5~.EHt$H1gރD$ D$$=gug?DHD$(HH=}gHt$1ҿfBg>Ht 8SHD$(HL$H@H@H83HD$(HH@H@H0F@ gutH=^}IgH=NZL1gHt$(H=GW1gHt=t HD$(HH|$(>HD$(H@HD$(H@@=u(utH8uHD$(8DH|$(M1gfD$$H|$(gVLg~YH=w|gD$3g->S8nH|$(\HD$(H@H@HHD$(H@H@H@,HD$(HxMHD$(@>HD$(H@Hx*HD$(H@HxHD$(H@H@H8HD$(H@H@xHD$(H@H@xHD$(H@LhA}=t=1u`I} gf6=It= u-:Mtm1L1PGAƅxALgQLA?DDCADl$$LBgLgg~Lf?A1҃Lg6ATUHSHHL$Ld$@H|$T$$HzdH%(H$1nLC11L>1g7g9tg9HHH|$1D$4HD$g<7HD$@HD$(H:tZHD$81H=JGŅ@D$4HD$8Ht H|$8gSD$4HlHD$HH+\$HxHD$HtHH=ygD$4t&LP H$dH+%(H[]A\Ht$(1ҿ=1ɉH=$yg@gt&D$$@uwD$4H*fDH=gRHHk=0;gDg2:H+?gUH0e=H|$D$,D$(D$$D$$Ht$T$D$(u-T$Ht$H|$D$ D$$uTD$ H0]@=<D$,~9gg~N>D$ D$$tH=wg-D$(ttD$ H=;CH-!H=uwgH=gbHgT1HDD$(fgG(fH=vg2f.@AWAVL5&wAUIATE1U1S1HHg`LLgtoct*t3auNL%QDlu;@fgj"AHD[]A\A]A^A_fg芥AfL- QH=g|OHMDE(L11ҾgvH8Ig|MuMLgIHM9ut L):MI}:L{U<Hxg蓁L-IHx:LMu+<HxgiLH}:Hqg?L5D=t5hgֻ|J nD$  tg=JCxgLLLgQuAągAtMLg&q98!BH5t1I*;LLA~H1gcLE18 JMt LgMtL95=t LgglgAD$ g_,f.1Ag蒧igHIeMeLf:HxgLHHx-8I}7I](E1I}gW%Iqg!gH@LgvMg9HxgLH,8II}gt]k@Im1IH5 sp9LHA~H1g詟Mgg XI}AgDgf. tIP ItfDHH=rgH=rHff. SIHHHH9H9H9H;;~G~}HHH@HBH41(@u@t1ɃHH9t!HHHtRu̹HH9uߺH5qt*t=*6ubMu]6`H5q17H=H1=t1g+H|GHhG[Lg]VPgEDUHHtHGHtH8?-tF,t2&H#quKH=T1G=H=@r:H]AH5uh9ug)]fH5p16HUHHtHGHtH8?-tFu,H5p1x6H1g轜]fDH]H5gs8ug]f><AWAVIAUATUHSHH>AHH|u3BA\$uD+AD9MIcH|u7Et2AHIcEL)HH9H|AtE.A-DLA0< LHcO5AHHD$HAEtHDH0D:.uHT$L`3uHD[]A\A]A^A_f=YH+@D9 IcH|MtFfDE.E1A-=AFI~A0< :L$1 6L$ADžx;+tAx9SE1DDDA1Dd1EDHfE1AD$HHH|%ÃuAAtADDff.@AWE1AVE1AUE1ATL%mUH-DnSHH8dH%(HD$(1gRHGHD$D$HaGHt"H@H81?-1HgRLHgewHcDHf.gjAHD$(dH+%( H8D[]A\A]A^A_fDAHFNfDD$fDL5FAgA{D$fDL%QFMt A>-EIE1M LpgNwHHID$L8L1Hxg)wLH=0LHE1HxgwLH0HEMtLmM$$MIID$=H8 2HaM41HID$H8H<1H*HHL L01HxgnvLH/IHHH1Hxg@vLHT/IĐHSHsLMgLIs.HHuLb.f.IHmI}HtB.I}Ht3.L*.Hu1LH=Hyk6Mt/A<$t(LB0HID8 guLg}HD$(dH+%(H8L[H5wj]A\A]A^A_@H}HtEH1gH{21HdI}L1gHR2H5H|$?2H|$HH*1H5iR/H1g藕IHmI|$Ht,I|$Ht,L,HuA,1H5Zi.H1g1Huf.1HHH8D;=:RH@1ҐHуHxu)Eu)@;zHcHcHH)fHH90H<t1IƉD$9MID$T$HH8I$H:H@T$HމL$H8L$= Єt XH5h1A-H1gϓf.H1MH=Hh3f.A~A<$DDL$D$E]H1ID$Dd$D$H-vDl$A9D$ADd$fDD;d$&R7P7Et$IcL Åt? ILL$HH gHx1*2LL$IHbgHH1`2AD$ED$EADAECD;d$>fD H1H'FD2@g)D=Z6gLL$H L-LL$MT$zH.H*H+MLa+H|$ HS+H|gpLL$ MHHH1H N2H5eHgH-e)7Hg谻Ht$ 1H=pg謽Ht$ 1H=(g蘽11H=mg臽H=(gH|$ (gHAg*Em 1҃==у)΅1H5d1A*1HgǕ,LHDd$EDDd$9zDT$l$EDD$ŋ=5r1IʼnD$9D$lHT$ H=cgyHHu'830Hl$ IHH5c1.)LHH1gmH|$ H&1g,A +HHV11gcH(H|$ Hu=HbH|$ HbHD(HxgmLL$ IHWBHDHH|ƒuD$1DD$ID$1HEl$+gmHcD$HH9l$uI9uEH8l$_H|$ 9&H|$ 111I‰D$H8t|9l$~L$D$9N1҅IՉT$u|D$ 1H5ax'H1g轍]EHcЉD$H<uD$9l$D$뗋D$'H-b1D$D$L$AL$D$yfAUAATUSHHdH%(H$1HL$H)H-L)HL1I$HgŅ95HHHH@Eum@51 5g4fD1LA#H$dH+%(HD[]A\A]fgAŅx1Lt#f.tHtcHCH8g&q1LE15#n1H5j`\%uH1g螋)f1H52`,%Hq%UHHtHGHt H8?-3t`HgH=9HHHtHHu]DH@H8&u1x]@@1gP]fH5V&ig ]fD]ÐATIUSHtHGHt H8?-2tULgLAąH*8D1HDDHtHHuD[]A\f.A1g肐D[]A\f.H55U%lgADA[]DA\f.HHGWH5^H1(1HATUSHGHH8gH{IgLH59^HH1'HCL9 t L H9kt H [1]A\AWAVAUATUSHDc1EHE1E1E1gD$ H-]L=^$HHgdw IcL@gڊAHD[]A\A]A^A_f$L-Q6AH5D]1A!H1g+fgA{A*DD$ H5H`EuP $uQrM@Ņ@L/!LHgNAglH+L%\L-M\BHtHCLH1%LLHHHCH8gYnIHT$ tHCLLH1[%g HHK8BHg5 1H'E1HuL Lg/ tsA 'LH=zlH1geDHHHCL8Lgu@uLEt3gktLEg轉11LLg8lfDg*HuLgHuLgkLg HH$Hg/ L $L $LAg@H<$1H=i"fD,$D ueAH='HtrDO EtiDD$ H5EgvD$$AHCH8g跈$EHYH=YAHDg-T=Ft$ tE1=12.L%CH5Y1WHL1E1#LAgHH5{Y1 H1"H= H5}LAgɇL-1Lg@jH<$~AWHc1AVAUL,@ATIIUHSӺL}HH%<L$ Jt( nLHH <BD(LcNt-҃ USHcA>H1BD-H56_!;C$9Dd$ Dd$ D9HA9~AH5f D9uLcd$ Ha;1O$dIJt LHH:;BD ҃ USHcBD->HAH[]A\A]A^A_%H []A\A]A^A_%/ff.@AUHcATHUHSHH:HXHt[H+HtS}/t]HL-H;L%WH1HLLI1i HkHuH[]A\A]DH{u1H1 Aăt'xHǾgHD[]A\A]%8"H5W1I(YL[HH1]A\A]aAU11ATUHV Aăt D]A\A]'8!1H5VILHH1gDUH=1g0HY*HtdH591HH)HHHH@HHt ZH+H56VH1]@]ff.AWAVAUATUH-VSHHdH%(H$1gD$D$0D$ fdukD$0HHgWtlmt];uH$dH+%( H[]A\A]A^A_su D$ 랐gD$H_-HD$8HHD$8H@H8g/hD$(L57HD$81H@L8LD$ D$M.E11Mn#|$ HcT$LLubH37DD$0D$(HEt$Hp 1XLH58TH1D$ ŅL56H0AM,M"F="gJ":g|$ 4LL5= 1LLg;*mDHhHHuHt >/a1lH=HD$HM1L-6H5PSLHD$HHD$4E1+fH5`;HD$HB<0 tIHt B<0@uԿ H=RtHm51Ht LH5RI1TH=R/L$4KHuHHt?fD1HWH58RLI1HuHuH5` UH=JRL1H5f.HhHcH}Ht ?/aH|$HLH5P1UHD$HH1E1#HD$HB<( IHB<(H5)^@uHl$0fDfDH}HAƅHUHt$HgDXH={M1L-(3H5OLmL$HD$HL$4Hy H=O'H 21Ht fLIH5oO1H=hOf.HD$H1HuHH<(H5\@)HD$H<( uL1H52HD$HH5\H(mH|$He]D$ H|$H=81f1fH}0AƅHUHt$Hg$DL1H5NHD$Hl$0HmH=[]8H5O1LLLH1gxH\$8AH-SH@OH5aOH;H1HH1&HH5kAg1H5RMBHH1 H=/MH/1Ht LH5 MI1H=LuD$4EH=Z+s1AgH5L1H1<g‰w A(DO.JD$ WAD$E11HHD$(AD$D$0HHD$DHH.1Jt8 11HHD$Ht$HIoIcHt$H|$(I9HD$ LCt$gTHt$LhHIVLLHHDHLHv w HH9uLT$0LgLHcHT$HDpH-BD8 ED;t$0|HT$D>DHH5J1]-9L$ ىL$9E9~"AH5]X E9uLct$1KvHIH,Jt0 L11HHD$r Ht$HI9H9D$ LFD$LIPLD$C LD$LHHHDHLv@ w HH9uLƋT$0LgOLHcHT$H HHI,BD0 E;L$0|HT$D>DHH5fI1H I09\$ /1L$ Ht$PD1sg+"=gZ  H H+HH5HBD01 ~H} ` f.AWAVL5aKAUATL%JUHS1HHdH%(HD$81gYLHgawIcLf.gtAHD$8dH+%(HHD[]A\A]A^A_fDw o_L-ˀH@?/gA[ٸH-HI@ À1A}--@L HHHt$(Lg.3HkHt$0HgA}-HD$(BH~HcH)HD$(HHc fH9{-HT$0nH~Hc5H)HT$0HrH9i։gO=e9E1AHDPEu=IE1H\$0L-]HIH5SH|$0 H5S  H|$0HtHmHHEHH87yHEL1L  HL1AgofDgNHu (Ht}D-EtDD%bEu8[u$D`E~"DXEtD Et gNt-HgaHHgSHE1H=R7 H5VG1AH1gnl؃OD$ HHEH( gt/HH|LSAD-jD%;M 5RH1 /uD)D)E1A-H5$F1ALHgjsqHD$8dH+%( 1HH[]A\A]A^A_uHt$0Lg荾tA}-HD$0iHcH9w bHcH9c)ЉgILgLAHE1goMAH1HT$(HgxHD$(HyHHD$(s IHH8HT$("DIK|u1Hx Hc)H9OH=g2IHcHIH;BMdHD$0HD$L=DL5MauoHMtA}uhL LAHzL1IH* ID$Hlt=bgg輬HT$H HT$HHD$0LJMA<#H5C1ILL$LLL$LI1HA>L@MEL D$ HD$8dH+%(|$ lHE1AHAgqH=gH:H_ `9lH??f54HE1LAHD$(|HHc52HHT$0H9H5eB1AHHgoH|$H|$0HT$H.H%L꾀LnHc^HHcHD$(H91AWL=BAVE1AUE1ATE1UH-BSHHdH%(H$1g HHgl wIcLDgrkAH$dH+%(HD[]A\A]A^A_EAA념AyDAiDAYDAIDA9DgAcH-QEIH$HuAHcH<t}t1D1g贳@1H޿HmHtgL6LHHL1aHgytHHyHEAH8gnfDEAEHthHfDHHtUHCH8%uHgxx;E}HHL$MtHCH8LkIc|$gaIEL5>@LgÑg-HHXIg}2LH=HCIEH@AM  1g蓓Lg}LAgLgőDAtFAu5gkH5?1ALH1gf`gֲUg{JpAWAVL5t?AUE1ATE1U1SHH(dH%(H$1g faukLHgjtuht`>ugAH$dH+%(SH(D[]A\A]A^A_Ðru AggAfAHiHE1Lt$H$L=):fLL1Hh1HLHHCHt$H8gtHD$HcЉH9Hg'vǃtH1HtHCH8gkA1H1HHHD1guǃtIHʨx>Ht9;=O }1HcH<tEgXfDHk1LHS;= 8f11gvǃH<H;= HcH<b@g腗D 'DEtgE1g E1f.AWAVAUATUSH8dH%(H$(1H.HGIL(E}A-D$=cAH-(A1A-L$^MLt$LggM$$MtNID$L(AE<-uA}M}H5<1BLH1gbM$$MuT$1H$(dH+%('H8[]A\A]A^A_@AE߀Lu1A}u2D$M$$MID$L(E}DxHyhHcH<{H9$믉)MH"LD@fHc5H$HHxE1UL=!GAWAVAUATUSH8dH%(HD$(1HHGHHD3A-E1Ll$ fA-A+<AH==gZIH3AHgBLHc,;*H=' L,׍B1 EE1MCAiHc H HHtRHHt$L4HHHHH4H<HDHt$HL$"LLHLL(HtHD$ML8yHD$HD$ D$E1'1HuTHEH(HHxg&HLHIgAdr 5 gqHcHHH=g~UIHE1{f.UH dH%(HD$1PՁu1<-@Hl-Ht$gtqH|$HT$ D$ pT$ t(xL9F|DutH<HH@H=-gCHT$dH+%(uH ]D1ff.UHSHH~ t H[]fHcHH9}HxH9څ~_)u9HHcHH<HHxg!%HjHH.HH[]@ 1ff.AUAATUSH~QA11A%@g2HHHg袯9H~'HHH$H$H5lH$8u#DH?tHv< u<uH$H$H;FD$L$H-H$ H$LgW$IH H$ $L1Lg#FIH@(@MLgxHAg(H;HCL(Lg#tGH$8N1HLgEIHt @(@tH$I@$Lg(uLAg2H$fMtLH Lg'61LH$HgEL$HI@(@LLVugmH5Bgq1H=>H1gZD$t"1H=1gfZH={11gUZt$4|$HgWDD$Ew|$$H$1AA|$$1 DŽ$Hy=8$H|$8HHD$(HD$8D$XD$t1H5 1It$$LH1g,H=g?YD$ALL H-oH51#HH1ge,0H-AH5}ЋD$4D$ DŽ$H|$@gHH@(@tE(H}gH$H$1g:IHt1D$HEgZ6H1LgDeAL$~ D$= uꋄ$DD$D$H$HHxg HHHD$4D$HLt$PAD$E=,H5)g(e=I HDT$XEH5,AH|$8H=ALH=|$$g'`$_Hg1H=1HHgHH4HC(@C(H$D$H$H@H8gz'L$A>V$Hl$@tL$H$1LH@H8g?HH@(@H$H@H8gKc(Ht HnH$`\$$H$0g)'$hfo$0H$pfo$@H$`fo$Pl$XyHjH$$$ -6)$p)$)$g+H51Ht$@H1g(H$AuLt$PDd$ qD$ D$X$mHD$(D$XD$hA=gnjgCH$1H=g营HgBm|$$g&*H$$H@H8gH$H@H8gM+9A H$H$ H$gHH$8I$L$tvML5e=ZH5Wg %Xg3DŽ$O$MHLDA>Lg-1IH$LH@H8gMg2Mt*H-1H5HgHg1]@H-Hg`Hg1]H-t'gG+Hg@fug+HH-tG=tugcAHD$8dH+%(HHD[]A\A]A^A_vu @gZAfAAL%A!sD‰D$MsDD$ ؉\$D$ l$$D)D$/@ D$T$\$Ee1HgoHHDX(A EAA\$E_DL$(HϋT$D\$ Ht$0HL$gHL$D\$ DL$(AAuEtD GAE/M$$MID$L$H(tbE1Hgd$ E1HgzHDHAA DL$Hg DL$AAb@t$Hg諬t[HAsHPHT$0kfHgtHHDX(A jH18EHEDL$HgD|$DL$AA EEHgFAID$H8g赺HgD$ M$$fD$t8A1HgjmHHt @)Hg?AAfHg7yHHttX(EEEA@D$ E1AifDDL$HgD|$DL$AID$H8E1>H5e1HH1g^D$ M$$L=lH)H5 1LHH1g!D$ M$$PD$ fDA(DuL91D$ H5QLH1gM$$D\$(HHL$ Ht$Ht$HL$ D\$(HEAHDL$/ 1H5H1g[L=1Hxg让tfH[HHxg3HHGHT$011HHgbHHtT$Ht$0gAHWA)H{gAAID$AH8*A,E1A(2AEEABO(HAAt57EtaO(HBA@tAAO(IcHtAfO(IcHtAiO(IcHtAnO(IcHtArO(IcHtAtO(IcHtAxO(IcHtAcO(IcHtAlO(IcHЀt AuIcHDfDEtaO(HBA@tAAO(IcHЃtAfIcHDff.fAVAUATAUHSH dH%(HD$1ILqAG(t EEH߳IEH51E(u`@EuO uCH}Ht:gXAHUH5IH1LDtH}HD$dH+%(7H 1[]A\A]A^ *5u/HwH?AgִH%4H@MEt{LH51 1HgV1HgeFt4*H}HugKHDH5 1zHwH?gHUAu<$fAL&٥Aff.AVAUATUSg訡IMI}MuL%] H-F Hu@I>IHttHL9@H9 @;1g#tAL[D]A\A]A^@gZIMrE1[]DA\A]A^E1AV1AUATUSg莢HH8ILpL% H-} Hu^fDI>IHtLH=L9@H9 @s1g[tAL[D]A\A]A^@E1E1[]DA\A]A^ÐATAg5qHǸHt2HHH9H@H9D @1A\ATAgpHtXHǸG( t K9O,tA\@HYHrH9Hx@H9D @1A\A\ATAgpHǸHt2HHH9H @H9D @(1A\AUATUHSHtgjHH[]A\A]gڣIH@*HhHHHxgHHHI}1HgƆIHrAE(0%A D$(u =,'AD$,u AM( t AL$( I}A ](g脰HAT$( AT$(DP(! ډH(H[]A\A]HgfIHtGP(@,t AT$( AT$(fgHf.1HgcH~HH9w11Hg蘅IH^AT$(AT$($f.I}gFfI9tAM( AD$,HH[]A\A]%DAWE1AVE1AUAATE1UH-oSHHhT$ dH%(HD$X1gru$HHg qfAt{auNAfDntSptfDgHT$XdH+%(Hh[]A\A]A^A_fugEfDAeDAUD$D@HѳDHuD$ t DD$E|$L$ D$D$8D$LAHHL$<E Dd$(aHD$@L$K$HI,MdEA<$+LgmVE=1DL$(E DD$-gH Hf|$PEtD$Rrt$ t HcD$LDPxHD$@HL$0H|$PL$KT$,LPHcD$=}HHLAAt E1<-5t#LgHHHCH8gŃTAAug g 5gEt_D"E1EAHuGfDHHtBHCH8g~ǃuHCAH8g1ۉDcDuD[]A\A]A^NDgU=5t ( ޞH55<g8Dt E g8HCAH8gkgp8VH57gY8?1gwg %3"LgE|At'<-u:AFu1HHE1AHHALgUHAHhHGAF룾LAgzLH1LIwgiH1H5LH1H=#zgHlL^LPH=>Lp1H5yLHL1#ff.HAWIAVAUATL%8UH-ˠSHHK<--u;AFMnHcH1ҾHHg59HD$HdH+%(uIHP[]A\A]A^H=[̐EH L1@hւfDUHcHSHHH(dH%(HD$1Hvl|8~2uRH1HHT$dH+%(uLH([]Hox.H$HEHD$H1*뫸 AWAVAUIATUSHXdH%(HD$H1=uUaScHH5kfHRf>HH щHH@;@DғEÓE11L5gVLLgQŃHtY?tb?ukgAHD$HdH+%(ZHXD[]A\A]A^A_Stau,A{geA롋H=9}SHcЃHHH׉/HG1fDΒgHĒHcHgHHNj놐HE-vt]LiAIxA1DHjRf.H *A9u9GD/HLAfHtH@HI@f|۸Lt$0AcDHD$(L%ai1L=#\$H0D$taHt$(PI E~KEl$LHމbt}8tI4$LH1g Ht$0HD$HdH+%(HX1[]A\A]A^A_H51A^~DH1gZ۸\$L|$ EDd$E1ƃD$HD$(t$H$DMHFh1RIOt @H _9uDT$EM}H$L6AفrH$dH+%(u H]A\tfAVAUATUSH?HPH|$dH%(H$H1D$$D$HD$gIH|$HgDnt7t@fu{D$$D$$fDpucHHD$DD$fDgXAH$HdH+%(#HPD[]A\A]A^f.gHyH\$HD$HtjD%WHEDEg*uDHgrH|$gu&DqACvH=yAą g8!L$fHD$H<L$@L$HLHjtL~yLtLL1o*HHHtkP€u ʀAPHmHHEHt$0H8g1)tHD$0HcЉH9HgQtH]x Ht;C|HEH8gJD%oD%AgD$$t[o5sADoH|$g)H|$H"uXf<%LAgqD$8fD$<1oHD$HHD$H|$=HD$H@L A$PЀ wHt$(Lg'Hl$(HcʼnH9t$$g8l$8fD$9C~>HHH<t.L1ҿmt$$HT$8g;AtHD$H@H8gO1H$A\mHD$D$8fT$LAg**H|$8gOH|$Hct$8H|$gn^lAn@ATIUHHg%t91LHgRHtA@(@u E1HAHD]A\fHgHAD]A\fD=؁ff.@AWAVAUATUSHHdH%(HD$81Ht'HgBH5,Hg4>t?gAHD$8dH+%(HHD[]A\A]A^A_@H=iHt$gnHŋD$LuLeDhA:uSIED$ AH=wYgxg:H5sI1fDHAH HtIHH u޹PA HHt1AEHfHJHAH ILHHuIcHILg <DLLg^9LAi:L}Lg;HMDLHLH $HEg!9H $AHM:u D$ ' 0D$/AHt$ D$.L1H=|gPA?AAiAH51H=jgOLHt$Dl$D$AHifD$/Ht$ ALcIH#<)0Hu>gBPAmH5~H>G:LH5ROAH=g菁Cf.1H5'H<AtHH uA HH4$g:DH4$Lgi7AKgALH5KRAĀ:aCD$Ht$1H=D$gZNDLH51qA@H=g諀LH5QAFJif.1!}1f.Hgֲ1Hff.@t 71@HH=gEY1H@HgTu 1Hgu1HHg21Hff.@AVAUATUS"|AI1|aH _H5[{{{{{D/fH3HHt)A8uL0juHcH^HTmHtD&D~{Eu=o{tO ({g1H=|HHgLHTe[1]A\A]A^Ð5{uF {uKzuPzuU=z,=zHH,fD((k))\**M++>@vvvuobvnbܓoNbt 2,>d zTxn nqqq,yryfyqqLyqqqX{t@uxDxxxxxxxix wHeHcH@^xD6xD:xD&xDxDwDwff.fAU7L-<ATUH-ZSHgIĸfDL'dHxHgaLHubIDLmHcHMuIHL[]A\A]f.AWAVAUATAUSHHD/IHPZ1aH5H3HHMD8uLeuHcHYHTmHDEuELHЦH H5HD1gH1[]A\A]A^A_-@LHHH5HD1gL=YHHL L5vL-=H-:JDLHHH5HE1%gHJIWIIIHӋEuLLHIEο1ffDH5:1 bLH1gNH[]A\A]A^A_f.AWH=ѪAVE1AUL-ʪATUSH~XHHdH%(HD$81IHLHSHLHIDEEtaEEtHMuA~H-(XE1HcHLL->g螦I fIHtDHEIHHA<$tIcLIL_LaDDpHA:HuLEt AMcK7H- Hg(Ht`X(LHڃP(1gE5 P(уH(ttPHD$8dH+%(uPHHL[]A\A]A^A_%&^fD1LHgDP(уH( y ttP(o`ff.@AWAVAUATUSHHD$ H@HCL-VE1H5ͨL0aE&DIuIAHtoA8uLauIcHIH ,VHHP*HPHtH8HHuH=g='HtsD$ H[]A\A]A^A_úH5Z1,_LH1gnD$ D$ f.ATAUHg.1HgE/DHHHAgpHD]A\AWAVAUL-{ATL%U1SHHg3LHg-/txtcow3IcDLgAHD[]A\A]A^A_f.gjCAfL5'rD MBD$ IFL-mT1H5L8aE'fDIuIHA8uL_uHc˺HIH SHDET$ T$ @tmM6Mx|$ H[]A\A]A^A_QE1-f.IFH0gQM6DDMugL@tLHץHȥH5ǥHD1baYgt1Qg51:E1L=5L-HMu+LH޿1-`M6MtRIFH8g tHDD@uIVL @uH LLIEϿ1`DIFAH8g 뉺H51A[H1gQDH51t[LH1gD$ LHH H5ݞHE1_L5QL%H HL=בL-AL%HALӣAHQLL _L\L=ţHSHMHIԋA9uEufMu1S@HHLyH5uLE1L _MIFILIIąu@tYLH1IEH5$1^L͐L LVHL[]A\A]A^A_LLLIEʿ1r^L JLuL@@g>1CH LIE1^DAWAVAUATUHSHdH%(HD$1D$Ld$fLHg$IHt~E.HOaE1H5H3HAHtDA8uLZuMcH aOKHHPHPHt H8L[VnHD$dH+%(uH[]A\A]A^A_Xft wUH=g" Ht P(ƀtDt]Jf.HhH+XHxgiHH}VHHHUAWAVAUATUHSHD'AD$ DH=DGHuAD$A,$AD$D$#QkQuU؀PwH HcHfH51FDH1g`Q ^Q |ZH5mZE H=*Z4 H=9ZH=BZ HtH=-D P P H=Dg oL5YM[IFH8<'t <"l H<$DH<$Ht$HHJHD$H<$8}"IHYH|$H5H=[HHL$L$( DEYE t$H1t$T$4t$DD$$L$,LH|$^ M~YgZ2D=HgH\$PfHT$@1HHD$hHD$`)D$PLcD$@~Lt$pHlQ%LzHuN|HuDt$Ezt$H1t$t$4 AZA[\t$H1t$L$4T$<4<_AX4T$,LH1<L$$T$,EHt$1;LH1H=J1H5rgH=JHg~EH1C(@7E1HEH8goH-JJ0E13<$IFH8g:L5sJ]JgH=?9H 4@oLH1:t$H1t$^_H|$L1eT$$LH1:H|$D1-t$t$T$ H=G1g̰H=GHgg#71H,GH1GUH=F1HFHF ==gp?H=|6g0Hgu=7 fAWAVAUATUSHFHF9WOIIHFHD;EFHSEwFLHuFD2D%_{uDFHMFHA: ʉ Fx:tOHD[]A\A]A^A_DEHEtHcIր;-tEADHEHcEHte:t`HEEHEyD{A-tUEtEH@^uFA?<9t|PIƉ;EH8EfD{uEG@M.H511EH=2HL1A?7f ^u.HNlD%]E1HDA}:AGd:M61H5'0H=EHL16f-VDA8ff.@H=HDtHcGDHc0DHH-Dff. fuD%-f.H gAuHC@HCPCP HCHPCPHDHHCGCG CHGHCGxC%2-f.AW1AVAUATUHSHD.A+HHH9=oCHtzhCH=YCH=:CH'CLcM<$E7A-qA+oA+eAZAD5 \AB%fD=BHBALcI$McF4"H$D5BDA:pDt$DH.L$H$HM@p@w@Jt"H>tsH5dBHMBcBHD[]A\A]A^A_f<#xAG6BH<u$BHHAHADHHJH <:t<-t <+uA+u yuzfH AHUAW$H5^L/$-yAnHAHnAHGAf<;`HEA ?ZH=7Zg HAHBH!AAH<uxHA?@H@H@HHA?H@jDJT"t40< HH@H@8H}@HHtHH@ $1H8gV $t.H?@HHPHHH+@H4@ /YH='YA?g藕@H?D XH=XA?g/?H?jHu@H?AH?@H?AH_?HS?AHb?ff.fH%?H"?H/?-?@ATI<_tuQH57A\%|/@H58g,t_H5cL,tcH5bL,tLH5l1A\%&/fDH5&zA\% /@H5zA\%.@H5yA\%.ff.ATUSHtoHE1H-zHHtDHCH8g{muHCH1L )HL1AgHHuD[]A\@E1[]DA\ff.fAWIAVE1AUL-MzATE1UHSHzHXHT$HL$dH%(HD$H1g(H$LHgA5w HcHg芑HT$HdH+%(HX[]A\A]A^A_fIfAI@IMAGDMAfDH=<1Lt$L%Hl$ bH5 xL|$(HAAI4$IAHA8uH**uIcLt$Hl$ HBHL|$(HDH $ I@I@I@I@@I@I IIIHi;H;eDHQ;H;MDH9;Hb;5DH!;HR;DMrAGfH:H2;DH:5#H|$0D$8H:HD$0glL%:tH5^LI*HLgϐPDMAG jf.MAGJf.H1:HB:-DL:1Lt$L%Hl$ aAH5 qAL|$(LAfDI4$IAHA8uH'uIcHl$ Lt$H jHRL|$(L tg KHD$H $L0HD$HD,H=tg4g融H=tgg聍H5t1H,$$H4$H1g H=tgŽg,H=Wg襎gDHg跎hH=#tgpgڌK$f.AV1L5%tAUIATL%tUSHH5s(Hk@HsHI'HL1(HHt%HCHtHL1g(HHuL[ ]A\A]A^%!@AV1L5usAUATIUHH5usSH(Lm@HsfDHSHHt%HCItHL1'HHuLmaHL5sDHH;t.StLH#CtH1Lz'H;u@HrHL5r fHSHHt#CuLH#CtL1#'ѐH]Ht8HgHtrH5krIH1&L9t LH] Ht8Hg轻H=rH5*rIH1&L9t LH](Ht8Hg|HqH5qIH1k&L9t LeH]0Ht8Hg;H jH5qIH1*&L9t L$H]PHt8HgHqH5gqIH1%L9t LH]@Ht8Hg蹺HBqH5&qIH1%L9t LHM8HtH qH5p1v%L [1]A\A]A^HwHATUSHtH1L%+qfH8HHtGHCH8g#eHHCHuH(L1$ HH1gaHHu[]A\.D1[]A\f.AVAUATUSH0dH%(HD$(1HBHL$HHt$HD$HD$D$ HD$H$H3H3H3H3H3H3H3A=DD$H-73H=[\$EuN|$u?t$ Kt_HtqHD$(dH+%(\H0H[]A\A]A^BfH=*WgC1HgIŅtaHtqf.HƒH=E1gcHD$(dH+%(H0D[]A\A]A^DHAu"tMtLLAg0L$tpMt'LLAg/DD$HHD$(dH+%(EH0H[]A\A]A^H=U@Mt Ag^L%1HH$HCHD$HCMt"LmHxgbLHILcL%1Mt"L;HxgybLHILc L%o1Mt"L HxgGbLH[ILc(L%51Mt"LHxgbLH)ILc0L%0Mt"LHxgaLHILc8L%0Mt"LsHxgaLHILc@L%0Mt"LAHxgaLHILcPMtLE1AHEHH8g_HmEDHuLg-bE1)g^E1Af.g*A&E1Hx@AWAVAUATUSH(dH%(HD$1HHL$HT$1HD$HD$Hp/Hm/Hj/Hg/Hd/Ha/H^/YA=*JH.L5CVHt H@HtL0H=.t1H5kH1gʀH=.t1H5k\H1g血gZLd$L-.HHD$LeHEEMt"L2Hxgp_LHILmL-n.Mt"LHxg>_LHRILm L-4.Mt"LHxg _LH ILm(L--Mt"LHxg^LHILm0L--Mt"LjHxg^LHILm8L-~-Mt"L8Hxgv^LHILm@L-\-Mt"LHxgD^LHXIL=V(LmPE11ɋ?(E1LHH3(H5H(gtDL=((IH H A@ujAH5L`LIg$Lg;LIg?MI}tfAE t^1LE1g"ME1111LgNIHg2;LIgMtkAU [DI}uALg芟HgXHD$dH+%(uIH(D[]A\A]A^A_E1A@fAuAE1fAWAVAUL-ygATUHSHHdH%(HD$81D$4H\$0D$0gHD$4D$D$D$ HD$#f7DD$ LHgJ!HT$=*-HDӃE~IoH *Hl$ E1bH\$(L%H5fD9HDI@8t I4$IAHs@8uHBuMcHl$ H\$(HZIJD0A 3fD$g]~AHD$8dH+%(]HHD[]A\A]A^A_ÐD$gAfL$ H)H=QT$H=MD$u}HE1E1L5e+HgRP1DHgDPHHHCH8gYHHt$0D|$4D uHCHH8H=MgQ1HgIH us_@H-:$HDl$0Dd$4DD DHgO1DHgODg.OD1E1g OtMLMZLg&LHCL1AH(HH1g8zH5?e1AH1gzfHAg}H=-#H]HD$8dH+%(u'HH1[]A\A]A^A_阁HE1HWt{E1[t4w>!wHHuA@u1 HBtEHH€[uAfD\t#]uEtϸ(u@u 1HWf.HdH%(H$1HtF`xDD$%=t;=@H$dH+%(u"HĨ@븸Ҹ|ff.AWAVAAUIATUHSHT$$dH%(H$1ADžAH}HHLd$0DAGH\IH;HLuۋD$H%=@uL3LLIōpHD/AMHHÍ@LuADtHD$(LI<D$$wHt$0LaD$H%=@MHH/D3fH,$H$dH+%(H$H[]A\A]A^A_H}H$H1HtR CH|HHuH9 듿H$Hu H$rHEt#H $AD$HHlH;H H9uH<$ [ff.#t.>.ta3<uw1.t\1>.tfDD <EtՃ>.u1.t\u1.f.Vt.tO;u1DVt1.uN1f..aDDNEufDAWAVAUATIUSHHHg#c5"tIA<$.f(;u<.t<\ A<$.fE1HD[]A\A]A^A_ :tA<$.u<.t<\AHkH<*H1HLgVHH<$D'HWEttHE1AA[t<IAL$߃wLH@u8D"HBEt2HHA[uAfA\tzA]uEtAHD$dH+%(ueHDA\fHD$dH+%(uBHLA\fLxA~(_@DfEtHVGHE11fDHHt3HctAr<\uHc7uMcB@ff.@11Bf.HcL t6\uBL ApHHcʋLtAHuDHcff.fAVAUATUHSH dH%(HD$1gHHLl$1HLHgSHLd$Lt$L'LHLHD$HHt>HD$Htu.DLHD$dH+%(uBH []A\A]A^Ld$LHLHD$HgHXfDH8UHAWAVAUATISHH( dH%(HE1Ht ?H(H0 H%=@H H\$HHI{HZ HCMWIHSLItLHJHHHHH9uIMt-Mt(M9_LMmbMuDHEdH+%(sHeL[A\A]A^A_]zLHgL0H(LH%=@H($|IHcL{IHc=HMUH>HLLHHH(L$A}IcHHcA/L LLUL4H DžLl$IIEI]1ۋxHIH3LIދL%MtOMeE1LMt1M9MDI]LHt!H{IMuI}~MmMuE1DH(L5lIH=/5t  n t Dž DžHDž%ƒDE1Lf t gقÅLIHH8tIHvLLuLLJu t5H(Lg5wHH HL6HHL01E1MLHHLMLfIǿHCML`LDHL8MdMuˉHHLLHHIDHHIEvHHHHHHDhMcL:HHH[HLHHHxHHnf.A<$|IHrDž15DL5@Lf. t HL)LHgLHg =H LD$LHLHxIH?HHLKLLHHLHP^Hs~  HH HHH@LLH(DxMcLIIHML`HIEtBA$}xXHHZMIƅ|MH(LLmHHHHDH@kBLE1HDžHH 8H9mHf_ILHMt LFHVH߻/nLHMLLMtLMmMuHHTHt HMtLLLLMA<$DžIE1Mt LTHHBHLIHtH L Mt LHH+!LIDžH1PIff.fAWAVAUATUHSHt$ dH%(H$1H HIľ/HqHD$HDEHD$H)DpD$XLIHT AHHLHD$CD=HhL"ƒHD$x0LH} LD$ AA HD$x* DLHIHHI9D$d}D$L-D$ AAA*H5fDHxIH<H I9,AH=4IDT$ LIċD$H$dH+%( HL[]A\A]A^A_fD/HgTHD$H9@}D$L-4LIHVI$HH ALLL$xID$4fD}*}*1ۀ} D O D$ g AH5AfDT$L&T$HI  D$ LHHt$@LND$X%=@:LI$HHlLL)geE1T$<V8gdDDLHIH( I9MD$ T$ LLTIL0qD$ ƃ%D$8A}*LA؃HcÉHD$fx*u"x*u8/uJAHʃ~x/t9tAvHD$x*A@D$D$zDLLtL{zfDLgf.g蚜D="gĢ~D$LD$H8/uYLHHD$HHH H9:HD$L(M<DT$ED$ Lt$Ld$(MA%LEID$$1DL$8D|$$EtHD$x*A8uHD$x|$t ADLLIHHI9DD$H|$t$D$D$fH5 IELHvrLDp[HD$x*D$LFLd$(I<$1Htf2CIHHIDlM1]AAyI\!A?( t$ 8/A[[1D$H$Ƅ$H$fD$Ƅ$=D$DŽ$=]]A\$Ld$@Ll$HA[cD$(DpHD$8HT$hHD<fA AD$HMfInEMLl$HLd$@MIfwHt$hHD<0fA|$|_A ANHL$hHD|A4HT$hHD<fA AbHt$hHD<0fAAAHL$hHD<fAA HT$hHD<fA AHL$hHD<AHT$hHD<fA AsHL$hHD<fAASHT$hHD<A7HL$hHD<fA AeHL$hHD<fAADHD$PLL`1]E1D$|AL9d$w8IL9d$)A<$/uHt$L9DL$ HL$pE1LI|$DL$ LD$pIOLHT$!EMfInkD$ D$(HjY@AW1AVIAUATIULSHH9(HT$ HMoL9lLAYf$;t|$}|$t;|$u%DL$Ht$LLLD$pHAtbHH9s9D$tA?(t AwH=Hu A[{Hu@L|$pMLd$xL|$pMLd$xnIG E_HD$ CfDL9d$Hm2A|$/&T@D$ME(xD D$AD$H5.L5AąLL$HDŽ$ͼHHH{NIH`H|$pHLHt$pLHHSuLHLInM LE\$T-_Å ۉ\$lHMeM} (LMLt$0Ld$(MI|$[DAP=wHIrBAHIPt͉ILD]+|$;t \tAPMT$D$HT$/LL)HHY@M\$(El$0MLd$ II9LD$ 1LfDLl$1LHD$pLL)HD$/HHID@fDM1]AAHI\!A?(t$8/||$TEÃD$lHMeM} AH H\$pI.A<$/$IL9d$wDL$LUH[[Ƅ$=L$ƄH$f$tMPLLHcƄ=PHcƄ]PHcHƄ]1ƄEl$ID$ED$IE0D$DXHD$ D( MHD$@L8L`11ۃHt$L9DL$HL$XE1LI|$DL$LD$XIOLHT$!,2HD$D$MeM} 'HtkAUIATUSHHtIHHLIwHAL[Jt%ILHE1]A\A]f.H[]A\A]øf.H9t&1HtkAUATIUSHHtAHHLLlHAL[I LHE1]A\A];H[]A\A]f.H9tF1AWAVAUAATIUHSHHdH%(HD$81SHHg谍H1H|$LgHw|1H|$HgqHw[Ht$H|$DH|$AH|$HD$8dH+%(xHHD[]A\A]A^A_f.H|$]LDHAfLgHGLLt$ H7[Hx:HxuHp@IDIAG:u<]uLH)HH$L2H$aH5>D H6L$ H9H2H8uL$LH$H$L$uI"f.HD$8dH+%(uHHDHL[]A\A]A^A_f.@AWAVIAUIATUSHH8HT$dH%(HD$(1HM>LIHHE1H|$u5uA<\u-I\HM>IHL9d$tBLouLHLH HM>H)IM>uIHD$(dH+%(H8L[]A\A]A^A_L- HI듐IH<)LL|$HL$ HIEHt$HHD$ ZIHHHe:fAWAVAUATUSHhH|$(Ht$ dH%(HD$X1HHH|$ I(HD$PIHlHHkHD$@E1 HD$Lt$P@IL$D$@H9H HL$LH$H4'H$HL$H%HL$H4HH$HD$H$LD$HHL$HMŋD$@N|ICDILt@AD<\u0IL$D$@\H9@N|ICD\fDH|$LLrHHwaIL$H9jfDCDN|HD$(L(HD$ H(HD$XdH+%(HhL[]A\A]A^A_@L?H6HD$(IHHD$ HHD$(HtHHD$ IHtHuHD$PHT$811HD$HHD$HD$f.\LҮHL)8HD$HL|$@HHD$PHu A?\gH$11LD$Ht$@H$HIHD$8AHD$@HD$HHD$PNd-ID$H9wnHD$LD$HHHt$8L$H)L4LHL$HuwL|$8MeILtA?\$L|$8L H H9wH$H|$H4HH$HtIHD$_DItzL|$8LtHMuHD$(H\$HHH|$I<HD$fMTDAHuf.LL$@HD$PLL$8HD$HAAA9tZMyHLL|$8IδA?\HD$IIl$L|$8B\AII L(L)AWIAVIAUATIUHSHHH|$Ht$dH%(HD$x1\H@ M?HH4IHD$0HD$QfDH|$LDwHI9H9I9wYEEHIH)E'I9wLDH&HuDeMtIMwI9vƒjtH|$7@u{H|$tftgDH+l$IHD$L8HD$xdH+%(3HĈL[]A\A]A^A_Dd$0RfDHL$LEIHHUHtHtHL)H)ƒIɃ1I< I<9rEH+l$E1IHIE1Hl$0H\$(HD$(fEIIE/HHDHurITHD$L8fDH|$7uttE1;f.E1!<wHs E1(ADfAUATUSH/M߀;w+H@HHuv;t;±DL CDlt HBDCDlt HB,19H[]A\A]1@*H[]A\A]@(tσt.JDL CDlt -HBLCDlu@oF냐E1҄ATHWE1E1U1SHk <@D< ~"!<wHcHD(~HAHu[D]A\@<[t<\uAtGHWHGHWA.<[t\<:E]IIP<]t}ABHr AyI<\utBuA[]DA\Ð:.IЀ=uJAHr]u>BIAyIP<]ufDHA@AIP<.ut]tSHT<=?E6]uBE1*BE1@BAB1DA[]DA\fJHr]wBIAy4f.D@BHzE8E1!wHs E1(ADfATUSD'AL$AD;w(H@HHud;tmAt.t DЩt DkE19A[D]A\E1A*[]AA\DD(AuADgt/vt D_t DAE1A9[]AA\DDAuff.fATHOE1E1UE11SHl@@C ~ !wHcHD(HAHuDzD[t#\u؋GAtދGHO HfDWHOA:f[t[:E]IIH]tzA7Hy1AAI\utQu[D]A\f:.Iȃ=uqAHy]u@QIAAIH]uHA@AIH@.ut]tRHV=?E6]uߋQE1+fDQE1DQAfQ1fD[]A\fDqHy]yQIAA4@AHyE0AVE1AUE1ATAUSHHt,t%BK<wIr*9HCLDHu[L]A\A]A^f.(uMt&1H{LggHt"8u[L]A\A]A^ÐHoLtHCf.AVAUATUS?HgVHHtVH=HtԠLcMt"LHxgPLHdIL%[L]A\A]A^fDH=Jt.HgjHt@(t L`@E1[]LA\A]A^ÐL% MtHI$AHtILcfDE8t(I$IHtEuB<+=uNd+[DLHHuB<+=u@ff.USH?teH1g\Hc؀|=uPHHxg-HHA1HHtgHtP(P(1H[]ʟff.fATUSHtW?HtOIӾ=Hu:t&1LHg訅Ht6P(P(1[]A\HghHuJظfDU?t*H=|HuHg>1]f.]f."~DH!~ Hf@@Hff.HH~HѥHHD 1%f.@HE1H mZff.UE1 H dH%(HD$1Hg5ZHHHxgHHHT$dH+%(uH ]ǟH(E1 dH%(HD$1HgYH HT$dH+%(uH(rfHAH YfU AH dH%(HD$1HgRYHHޞHxgHH0HT$dH+%(uH ]@AVAAUIATUHSgIgHLD%IHy%8Hu DugD[L]A\A]A^ff.AVAAUIATUHSHLDIHu8uu[L]A\A]A^fDAUIATIUg}LL]A\A]%jf.HIH9JSHt4Ht/HtH.HJH #H 4[@H51HH~ Hޱ@Hͱ[ff.USHHHH9t5Ht0HtHHJH H H[]gzH5~fHSH~H?DH-H[]fDHH9SHt4Ht/HtHHJH H [@H5H9HG1nHH~HDH[HHfHH5eH+5fH!HVHCHfDH޺bHuHf.D%zf.H%f tDHH5U1=H5+ѿHff.uDHH1HwHfjt&HtHlHE1ff.fG G ࿀GǃGfG1ËF H F ࿀FǃFfF%5DHXdH%(HD$H1H'H1fofo HD$0 )$foD$8D$ )L$)T$ D$ $࿀$D$ǃD$fD$HT$HdH+%(uHXfcg 1ff H%>ff.HXdH%(HD$H1tjH+H1fofo HD$0fo)$)L$d$ D$8)T$ HT$HdH+%(uHX@ff.G'߀0G1ff.F&H0F%SHXdH%(HD$H1ƼtzHKH1fo fo HD$0.)$fo D$8D$$$߀)L$0)T$ D$ԜHT$HdH+%(uHXff.g 1ff H%~ff.HXdH%(HD$H1tjHkH1fo)fo 1HD$0fo4F)$)L$d$ D$8)T$ HT$HdH+%(uHX@ۖff.࿀GǃGfGG G 1ËH࿀FǃFfFF F %eDHXdH%(HD$H1HWH1fofo HD$0:)$foD$8$)L$)T$ $D$ǃD$fD$D$ D$ HT$HdH+%(uHXfAWfAAVAUATIUSHhdH%(HD$X1=:Ll$)D$)D$ L)D$0)D$@HD$@LxJ<HHJE1HLLLbt~LL%Ax Hc̗LIg`LgkL&HLTHD$XdH+%(HhD[]A\A]A^A_fDLL=(x HD$HcOLIgLgZkHT$ArMtYH@Z E1HcHD$fH1LڔJctBTL)LHcLH|$LgnIL;|$@vE1 E111LLADžLL%5Wx HcLIgLgjfAUATUHIAAgIĸ.M9fA$HI9!HAt }.xDHcgA4$@LHDHHH@r1@uI9s y/t/HW1Dt @4 H@utHD$LHD$H[]A\A]A^A_H=!gIHLƈM9AH0I9!G1L%E1/t IM9uH9A.L$A^Ht$ LuD$8L$%=@tL$~E1A.fDH|$/t+LM9tA/IFLp..f0MCHHALD$A$Ht$ L܇bD$8LD$%=@I$As}/D$AuE1ɀ}/A1I}/D$O,D$/AEMDHxg(HH<I/A/AGAIvH4$uL%Lg>tL%XDH=`H=jg>uH=QH=Rg>uL%ܗL%:ff.fAUATUSHHgIIHtHz}H=vJIMH LH1LHHL[]A\A]fDHs'tA$tTfAT뫐HI|$HHI$HLILLH) H)։HpfDH":@LE1Lz[A$TAT,fAVAUAATIUSHHgDHIH AtH2|H=vRIMH HH1nHMI,$H[]A\A]A^Hs'tUtTfTHH}HHHUHLHLHH) H)։HH3nD$ HyMD$ ^1SH@UTTff.ATUSxAŃHhH5jHDJIHt L[]A\f |L[]A\E1[]LA\DAUATAUSHHgտDHIHAtHgzH=vGIMH HH1H~HH[]A\A]fDHs'tUtTfTHH}HHHUHLHLHH) H)։HH3~HyHD$HDwHD$H[]A\A]@H@UTT!@ATSHg茾Iąu%H@AD$ HL[A\{gW A\$I$HDž~Hc1HzfDATUHHtbI9w|HL]A\H?vg IcT$I$9|H<1)LLyAl$HL]A\@H]A\fHtSHH?Ht g C [ff.@Ht#UHH?Htg H]%uHt+SHH?Ht'C u[fDg* tk [1D1[@AVAUATUSHITI$AL$IH1ۅ }DI$H,L4Ht'HjwHxg証HHuHAD$IUHJ,29IcD$ AMAE HtH[L]A\A]A^@IUfE1[]LA\A]A^ÐAWAVAUATIUSHHNH<$_ HF |D$ fH$I]E1@HN<J,Ht*H$HvHxgŻHHtH$HIEIJ,8D9HcHL$ LcHcE1JL<H$I$J,0Ht"HvHxgPHHdtHIEJ 8J,1IL94$u\$ HcHA] HHL[]A\A]A^A_{XH$D$ I4HtF 1ۍxD$ "I1IIE1IEz11AWIAVAUATIUSHHHt Lcn EuHL[]A\A]A^A__ B+pD$ IEHcI1L4IH,Ht"HtHxgHHsHI$J 0H,HI9uHcT$ HAT$ afDHRHH[]A\A]A^A_\$ HAWIAVAUATUSH(Ht$HT$HtgIHHt\_ tUHtA>t<~H~H$sMH$AtA>u4E1\@HD$Ht8uH(L[]A\A]A^A_E1H|$flH$sH$AD u'f.AH|$t HD$8uE1~Ic1H$|fDD$ AEf.A|HcgRHEIJ4 H$H<QqEuLIHJ< pIJ"A9o HA4E.HD$8xuHt$(~u8.t >. Ht$(H|$8PiLL$IpILD$+iLD$LL$1AH$PLEkgfATUHHfH|@HHciIHtHH1wHL]A\LE1,dHL]A\fSH^fH<g蘫;'t[' HP΅u9KHH΅t&@2'u\'HB'Hfr ΅uڹ'f [fD{u\'@f8[@AWAVAUATUHSH8dH%(HD$(1HD$ eLleHAeH|gΪ"MIHXL%L J6A~At9 HHHHtRA@t t\Httyǃ=tMLSL]IH LLHufD"fHD$(dH+%(H8L[]A\A]A^A_fAt HD HHLfDtyHD$ LL\$1LT$H)HL$ HHD$dLT$L\$L HvHD$HD$ EHLLHHE1HUfTHH9uTd@AWAVAULcATAUSHH(dH%(HD$1J/HD$H$A}AHcgͨIH@A"L5PPfDHŀ"u\HSr up~H59o$HE1D|$L}IATUHSHӅtzF>EAyE1LL+AAI0HAQuA0t A0IEI[]LA\EAsHLL AAIIH j0A9ILaH571HLHHFD+FIL[]A\D^UI0HAAuAAE0A#HH#)ƃ0AqIfD /DLH t fIHAAtHuAIHAAuAAA#AA6nDA-L[]A\@LL+E1AAfDHHHHIHHHHH)ǃ0@yHHu fHcλ@A_0IAQH9r'HH1HH vH#wQWIAQH9sAtcFu[Dƒ@AA0I XAA{H=w DH>DDlfA A!E;A#HH# )ʃ0AQ IHH#0AAfLL HA-AAHHA-sfHIIHHHHHH)ǃ0A9H9ATUHSHӅtzF>EAyE1LL+AAI0HAQuA0t A0IEI[]LA\EAsHLL AAIIH j0A9ILaH5G1DLHHBD+BIL[]A\D^UI0HAAuAAE0A#HH#)ƃ0AqIfD /DLH t fIHAAtHuAIHAAuAAA#AA6nDA-L[]A\@LL+E1AAfDHHHHIHHHHH)ǃ0@yHHu fHcλ@A_0IAQH9r'HH1HH vH#wQWIAQH9sAtcFu[Dƒ@AA0I XAA{H=w DH>DDlfA A!E;A#HH# )ʃ0AQ IHH#0AAfLL HA-AAHHA-sfHIIHHHHHH)ǃ0A9H9ATAUSHdH%(H$1Hx.HDg!xHމg订HHu1fH$dH+%(u H[]A\VAfDAWAVAAUAATE1USH(Ht$H\$dH%(H$1gHfDH| LHETCHDgIHtCIcIcHH9|)H $H%EIcgH $HfDAD$D9|D)HAHcg̅HIcDHD$HtQH(H$dH+%(uFH(D[]A\A]A^A_@HA=HD$HtHHu=?DUHSHH=zNdH%(HD$1tyyHD$dH+%(uyH[]fD1HT@u<$ftt$ftg++t$<$tCHt$EHtD$fH=9As6?fDH>>1Hf.DAWAVAUATUSH8Ht$L$ DD$dH%(HD$(1HUHHIL6AM0E1L|$'LDg迟HEIT$H9wIHHH9HD$HT$HH8g轃HT$HIHD$L0HUD$'C&I;D$ ~D$Dd$DbLDg&g|$GMt~HcAfDHHT$(dH+%(H8[]A\A]A^A_;fDHcۋD$Af.H:HDH|$HDHEfHEHuߋD$kE=DIIIH>PՁtc1)<.tl0< !HHHHPuMt HcHI0MtIMnI:D1<-G@Ht6ftHOATIU1S1AM܄0< HlHIH,huG5<HMt'HcH0< wAH0< vMt HcHI0MtI)MtI []A\1@Mt HcHI0MtIMtZI:1HcH=0HcHVMt;HcHHcHMt HcHI0MtI)MtM"[1]A\1IfDfHXdH%(HD$H1HT$ 1HD$HH$HD$HD$M?x)D$0H|$8HT$HdH+%(uHX:ATAUSHdH%(H$1H\$H<HiAIIH$Ai1111HD$:AR8Ey DDH$dH+%(uHĠD[]A\':AWAVAUATUSHxH4$dH%(HD$h1Ht?IuAg~HD$HD$hdH+%(THD$Hx[]A\A]A^A_fDHD$@g9HÉD$ R9|D$(Hcg~HD$%l$D$,E11E1f|$E|$@:|$D$A|$(\D|$8AA u$D;D:>AHt$IcAD<=G~?MH5dOiG39\$ 4-8HcLD}HtdDH5DuHL7P9~8)HL$HH|$IAIDB%A==McHF@>fDϸ>DAHHAw-H H16HH lH15 Hff.w@>AHDDE1x?HAȀFV?ʀV?ʀV ?ʀV?ʀVbfD?HAȀFDV?HAȀFV ?ʀV?ʀV?HA ȀFDV?ʀVD?HAȀFV?ʀV ?ʀV?ʀVoff. =v#v1v#@>HfDH ~Fff.AUATUHSHHXdH%(HD$H1Hw7H1t'HT$HdH+%(gHX[]A\A]R R1HHOuH=RHtHLd$ E1111L$$HD$Hl$HD$*H=bRHHT$Ht$LD$)HH$LH)$D)3f. *:HR RtQ:fDH=)AgSIH8.H+HL%QHp'L(Q@L+Hta\A؁w}H BHH11NDIL%QPASCIfPL-cLLp1HQHtk PH ̐HH1B1 LL%P'L'Py@LH=x0HyPy)fDAVIAUE1ATE1UH-ISHdH%(HD$1H$6)AÄukf.IIAtRD¸u1HHcL^)Ht"Hv L,$IL,$IAuHD$dH+%(uHL[]A\A]A^(fATUHSH7dH%(HD$1H$Y(MH>Lcu2eDLHgDHHtMHtHvqMHt5u7u1HLHa(Hu@1HT$dH+%(u#H[]A\Dg:H'DAWAVAAUIATE1UH-wS1H(Ht$dH%(HD$1HD$fHcItt=A=R6Du~86t4x+D9~HD$dH+%(u[H(D[]A\A]A^A_fLL$1L|$HL$I)LK'Hv L|$HufD&%*'f.%(f.fDtHu1@H@xItEE1D%=A9A@HAuDE1DfHHy/<W ~/.bashrc%s: invalid option%c%c: invalid optionlogin_shellINSIDE_EMACS,term: (term:dumbemacsetermPS1PS2/etc/bash.bashrc/etc/profile~/.profile~/.bash_profile~/.bash_loginFUNCNAMEBASH_SOURCEBASH_LINENOmaindebuggerdump-po-stringsdump-stringsinit-filenoeditingnoprofilenorcposixpretty-printrcfileUsage: %s [GNU long option] [option] ... %s [GNU long option] [option] script-file ... -ilrsD or -c command or -O shopt_option (invocation only) Type `%s -c "help set"' for more information about shell options. Type `%s -c help' for more information about shell builtin commands. Use the `bashbug' command to report bugs. bash home page: General help using GNU software: /usr/share/bashdb/bashdb-main.inccannot start debugger; debugging mode disabledcannot set uid to %d: effective uid %dcannot set gid to %d: effective gid %d%s: option requires an argument%s: cannot execute binary filepretty-printing mode ignored in interactive shellsdTD4timed out waiting for input: auto-logout PROMPT_COMMAND/%s TMOUTreader_loop ; ;|&syntax error near `%s'syntax errorreadline stdinTZ%a %b %d%H:%M:%S%I:%M:%S%I:%M %p%H:%M%s.%dHOMEPS0Use "%s" to leave the shell. esacdonethenelseelif#%^,~:-=?+/evallet"$@"COPROCexpected `)'-ncommand substitution---p&&||<&>&;;;;&<<-<<<&>&>>>|newlinefiforselectwhileuntildo[[coprocsyntax error near unexpected token `%s'syntax error: unexpected end of filemaximum here-document count exceededunexpected EOF while looking for matching `%c'unexpected EOF while looking for `]]'syntax error in conditional expression: unexpected token `%s'syntax error in conditional expressionunexpected EOF while looking for matching `)'unexpected token `%s', expected `)'unexpected argument `%s' to conditional unary operatorunexpected argument to conditional unary operatorunexpected token `%s', conditional binary operator expectedconditional binary operator expectedunexpected argument `%s' to conditional binary operatorunexpected argument to conditional binary operatorunexpected token `%c' in conditional commandunexpected token `%s' in conditional commandunexpected token %d in conditional command|4@@@@@@@@7????W7 }w|wwwwwwwwwwwwwwwwww2|{w#~yl%?Gj,l+\ f%5P ŞCĝEʈ[ʈٍύōw՜JBs6-TiϏN͎plʋ}.Њa1۟-ljyWǗ͇͇%IhtIIO6Plt8 SߘȘ {();&| '()   !  =>>>>>??@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@AAABBCCDDDDDEEEEEEEEEEEFFFFFFFFGGGGHHHHHHHHIIIJJJJKKLMMMMMNNNOPQRRRSSTTTTUUUUUUVVWXXYYYZZZZZZ[[\\\]]^^^_____`````aaabbbb 'F7=>@? % 5!" <F ;123  E CD739;~3z;3359;<93;2349393095EF33993292343339899!"8812348<8()*8()*!"234!"234#:/ =EF#$%&':<+,-./(<367/9 ;34:::;=AB I::::#$%&':+,-./: :3467<9; #$%&'+,-./234679; #$%&'+,-./3679; #$%&'+,-./679; #$%&'+,-./679; #$%&'+,-./67#$%&'3+,-./9;67#$%&'+./#$%&'67+./67;FyAB5Lx=.@ t/y>CO?d ,Gxe vi &.m=3 !HIJnyyopQRq:rAEs55fg4jk89;hBF~MNl55{|$# )*+~HIJI2HIJ9@ L <? !CD%!'GHK0(MNU 156 78 O>PSVXTWEYJ !- HIJ !  !     ! "D !w  !PQRSTUVWZ[\]^XY_`abc"#$z%&'()*+,-./012:u}K<346744ua444444H444444544f5444/456s7:<=AKEB?G@FHIJ5nj'!0*$-34 5;8>gelkt)#2 ,&/ ("1+%. ri9hmoxVWCDfcqb~y`LMXYdpaNOTUZ[uz{w|}RS^_vPQ\]9l444 k4Q^4q)HU\_b44di44A44'4<444444444444Ck4444]7h -'<44444444444444444444444444<4444444444444;444444>444<4<<4444444444444444444444444444444444444444%44LO4434<<344CC444#&444$44444444'4444340:4444444&44(.444W4>B44o44444444'?444r444444s4444444I 44L)444R/44S1444444431;<827695:  !"#$%&'()*+,-./04OLDPWD`%s': not a valid identifier/dev/ttyPROMPT_DIRTRIM=~:~COLUMNSgetcwd: cannot access parent directoriessyntax error: `;' unexpectedsyntax error: `((%s))'environmentclean_simple_commandsyntax error: arithmetic expression requiredmake_here_document: bad instruction type %dhere-document at line %d delimited by end-of-file (wanted `%s')make_redirection: redirection instruction `%d' out of range$$%u! ) && || {%s}<<%s%s>| %s<> %s<<< %s{%s}<&%d%d<&%d{%s}>&%d%d>&%d{%s}<&%s%d<&%s{%s}>&%s%d>&%s{%s}<&%d-%d<&%d-{%s}>&%d-%d>&%d-{%s}<&%s-%d<&%s-{%s}>&%s-%d>&%s-{%s}>&-%d>&-&> %s&>> %sxtrace_set: NULL file pointerPS4%s=(%s) ''%sfor %s in select %s in case %s in case %s in [[ '' ]] (( )) | time -p for ((if then else function %s () { } { coproc %s print_command do function () cprintf: `%c': invalid format characterxtrace_set: %d: invalid file descriptorxtrace fd (%d) != fileno xtrace fp (%d)print_command: bad connector `%d'\<\\\ |<6<;)<;;;;!;!;!;!;!;!;!;!;!;!;!;!;!;!;!;!;!;!;!;!;!;!;!;!;!;!;;{;!;!;!;\9;!;;!;;bNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJN{NJNJNJNJNJNJNJNNNJNNJNNJNJNJNPN |%5ldStoppedStopped(%s)RunningSignal %dDoneDone(%d)Exit %dUnknown status%*s(core dumped) & (wd: %s)[%d]%c %s: line %d: (core dumped)(wd now: %s) notify_of_job_statusstart_pipeline: pgrp pipe[%d] %ld [%ld: %d (%d)] tcsetattrSIGCHLD trapfork: retryforkchild setpgid (%ld to %ld)%s: no current jobs%s: job has terminated[%d]%s (wd: %s)job %d[%d] stoppedjob-working-directoryno job control in this shellbgp_delete: LOOP: psi (%d) == storage[psi].bucket_nextdeleting stopped job %d with process group %lddescribe_pid: %ld: no such pidwaitchld: turning on WNOHANG to avoid indefinite blockwait_for: No record of process %ldbgp_search: LOOP: psi (%d) == storage[psi].bucket_nextwait: pid %ld is not a child of this shellwait_for_job: job %d is stopped%s: job %d already in backgroundinitialize_job_control: getpgrp failedinitialize_job_control: no job control in backgroundinitialize_job_control: setpgidcannot set terminal process group (%d)declare -%s %s=%sdeclare -%s %s$($[<(>(?*+!@process substitutionread-comsub#%^,~:-=?+/@}#%:-=?+/@}%:=+/%s: invalid variable name%s: bad substitution%s: parameter not set%s: parameter null or not setarray assignno match: %s%s: substring expression < 0bad substitution: no closing `%s' in %scannot make pipe for process substitutioncannot make child for process substitutioncannot duplicate named pipe %s as fd %dcannot make pipe for command substitutioncannot make child for command substitutioncommand_substitute: cannot duplicate pipe as fd 1command substitution: ignored null byte in input%s: cannot assign list to array member%s: invalid indirect expansion$%s: cannot assign in this way%s: invalid variable name for name referencebad substitution: no closing "`" in %s?p>p>p>@p>p>p>p>p>>@p>p>p>>>p>p>p>?p>p>p>p>p>p>p>p>p>p>p>8?p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>x?܇<ԈĀĀĀĀĀĀĀĀĀĀTāwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwȲwww8hHH`You have mail in $_You have new mail in $_The mail in %s has been read trap_handler: bad signal %dinvalid signal numberSIGRTMIN+interrupt trapexit trapdebug traperror trapreturn trapEXITSIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGABRTSIGBUSSIGFPESIGKILLSIGUSR1SIGSEGVSIGUSR2SIGPIPESIGALRMSIGTERMSIGSTKFLTSIGCHLDSIGCONTSIGSTOPSIGTSTPSIGTTINSIGTTOUSIGURGSIGXCPUSIGXFSZSIGVTALRMSIGPROFSIGWINCHSIGIOSIGPWRSIGSYSSIGJUNK(32)SIGJUNK(33)SIGRTMINSIGRTMIN+1SIGRTMIN+2SIGRTMIN+3SIGRTMIN+4SIGRTMIN+5SIGRTMIN+6SIGRTMIN+7SIGRTMIN+8SIGRTMIN+9SIGRTMIN+10SIGRTMIN+11SIGRTMIN+12SIGRTMIN+13SIGRTMIN+14SIGRTMIN+15SIGRTMAX-14SIGRTMAX-13SIGRTMAX-12SIGRTMAX-11SIGRTMAX-10SIGRTMAX-9SIGRTMAX-8SIGRTMAX-7SIGRTMAX-6SIGRTMAX-5SIGRTMAX-4SIGRTMAX-3SIGRTMAX-2SIGRTMAX-1SIGRTMAXDEBUGRETURNtrap handler: maximum trap handler level exceeded (%d)run_pending_traps: signal handler is SIG_DFL, resending %d (%s) to myselfrun_pending_traps: bad value in trap_list[%d]: %pcannot reset nodelay mode for fd %dcannot allocate new file descriptor for bash input from fd %dsave_bash_input: buffer already exists for new fd %dunwind_frame_run: %s: frame not foundunwind_frame_discard: %s: frame not found%s: integer expression expectedxhX@0000p0@000000000000000XX`p00800(0Ȉ`8Ї0Іargument expected%s: binary operator expected%s: unary operator expected`)' expected`)' expected, found %smissing `]'syntax error: `%s' unexpectedtoo many arguments5.1%s.%d(%d)-%sreleaseGNU bash, version %s (%s) Copyright (C) 2020 Free Software Foundation, Inc.License GPLv3+: GNU GPL version 3 or later This is free software; you are free to change and redistribute it.There is NO WARRANTY, to the extent permitted by law.@(#)Bash version 5.1.16(1) release GNU ;|&( ;|&()%s: cannot convert indexed to associative array%s: invalid associative array key%s: cannot assign to non-numeric index%s: %s: must use subscript when assigning associative array'()'bad array subscript%s[%s: %s[%s]: %sbrace expansion: failed to allocate memory for %u elementsbrace expansion: failed to allocate memory for `%s'brace expansion: cannot allocate memory for %s%0*d#;&()|<>500%s: cannot create: %s%s%s%sC-xC-e%s %dinput-metasymlink-hook "'$include /etc/hostshostname_completion_file no closing `%c' in %s \"'@<>=;|&()#$`?*[!:{~fc -e viREADLINE_LINEREADLINE_POINTREADLINE_MARKbash_execute_unix_command;|&{(`completion-ignore-case"'\comment-begin$@$Bashshell-expand-linehistory-expand-linemagic-spaceshell-forward-wordshell-backward-wordshell-kill-wordshell-backward-kill-wordshell-transpose-wordshistory-and-alias-expand-lineinsert-last-argumentdisplay-shell-versionedit-and-execute-commandcomplete-into-bracescomplete-filenamepossible-filename-completionscomplete-usernamepossible-username-completionscomplete-hostnamepossible-hostname-completionscomplete-variablepossible-variable-completionscomplete-commandpossible-command-completionsglob-complete-wordglob-expand-wordglob-list-expansionsdynamic-complete-historydabbrev-expand'"$<>_InitialWorD_()<>;&| _EmptycmD_%s: missing colon separatorFIGNOREfc -e "${VISUAL:-${EDITOR:-emacs}}"%s: first non-whitespace character is not `"'fc -e "${VISUAL:-${EDITOR:-vi}}"bash_execute_unix_command: cannot find keymap for command`%s': cannot unbind in command keymapUTF-8utf8/usr/share/localePOSIX"" "%s" setlocale: LC_ALL: cannot change locale (%s)setlocale: LC_ALL: cannot change locale (%s): %ssetlocale: %s: cannot change locale (%s)setlocale: %s: cannot change locale (%s): %s#: %s:%d msgid %s%s msgstr "" redirection error: cannot duplicate fd%s: cannot overwrite existing file%s: restricted: cannot redirect outputcannot create temp file for here-document: %s%s: cannot assign fd to variablefile descriptor out of range%s: ambiguous redirectsh-thd/dev/tcp/*/*/dev/udp/*/*8h PTTTlĽĽĽĽCOMP_LINECOMP_POINTCOMP_TYPECOMP_KEYCOMP_WORDSCOMP_CWORDgen-shell-function-matchesCOMPREPLY_DefaultCmD_completion: function `%s' not foundprogrammable_completion: %s: possible retry loopprogcomp_insert: %s: NULL COMPSPEC%s: cannot allocate %lu bytesxmallocxreallocRead lines from a file into an array variable. A synonym for `mapfile'.Read lines from the standard input into an indexed array variable. Read lines from the standard input into the indexed array variable ARRAY, or from file descriptor FD if the -u option is supplied. The variable MAPFILE is the default ARRAY. Options: -d delim Use DELIM to terminate lines, instead of newline -n count Copy at most COUNT lines. If COUNT is 0, all lines are copied -O origin Begin assigning to ARRAY at index ORIGIN. The default index is 0 -s count Discard the first COUNT lines read -t Remove a trailing DELIM from each line read (default newline) -u fd Read lines from file descriptor FD instead of the standard input -C callback Evaluate CALLBACK each time QUANTUM lines are read -c quantum Specify the number of lines read between each call to CALLBACK Arguments: ARRAY Array variable name to use for file data If -C is supplied without -c, the default quantum is 5000. When CALLBACK is evaluated, it is supplied the index of the next array element to be assigned and the line to be assigned to that element as additional arguments. If not supplied with an explicit origin, mapfile will clear ARRAY before assigning to it. Exit Status: Returns success unless an invalid option is given or ARRAY is readonly or not an indexed array.Modify or display completion options. Modify the completion options for each NAME, or, if no NAMEs are supplied, the completion currently being executed. If no OPTIONs are given, print the completion options for each NAME or the current completion specification. Options: -o option Set completion option OPTION for each NAME -D Change options for the "default" command completion -E Change options for the "empty" command completion -I Change options for completion on the initial word Using `+o' instead of `-o' turns off the specified option. Arguments: Each NAME refers to a command for which a completion specification must have previously been defined using the `complete' builtin. If no NAMEs are supplied, compopt must be called by a function currently generating completions, and the options for that currently-executing completion generator are modified. Exit Status: Returns success unless an invalid option is supplied or NAME does not have a completion specification defined.Display possible completions depending on the options. Intended to be used from within a shell function generating possible completions. If the optional WORD argument is supplied, matches against WORD are generated. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Specify how arguments are to be completed by Readline. For each NAME, specify how arguments are to be completed. If no options are supplied, existing completion specifications are printed in a way that allows them to be reused as input. Options: -p print existing completion specifications in a reusable format -r remove a completion specification for each NAME, or, if no NAMEs are supplied, all completion specifications -D apply the completions and actions as the default for commands without any specific completion defined -E apply the completions and actions to "empty" commands -- completion attempted on a blank line -I apply the completions and actions to the initial (usually the command) word When completion is attempted, the actions are applied in the order the uppercase-letter options are listed above. If multiple options are supplied, the -D option takes precedence over -E, and both take precedence over -I. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Formats and prints ARGUMENTS under control of the FORMAT. Options: -v var assign the output to shell variable VAR rather than display it on the standard output FORMAT is a character string which contains three types of objects: plain characters, which are simply copied to standard output; character escape sequences, which are converted and copied to the standard output; and format specifications, each of which causes printing of the next successive argument. In addition to the standard format specifications described in printf(1), printf interprets: %b expand backslash escape sequences in the corresponding argument %q quote the argument in a way that can be reused as shell input %(fmt)T output the date-time string resulting from using FMT as a format string for strftime(3) The format is re-used as necessary to consume all of the arguments. If there are fewer arguments than the format requires, extra format specifications behave as if a zero value or null string, as appropriate, had been supplied. Exit Status: Returns success unless an invalid option is given or a write or assignment error occurs.Set and unset shell options. Change the setting of each shell option OPTNAME. Without any option arguments, list each supplied OPTNAME, or all shell options if no OPTNAMEs are given, with an indication of whether or not each is set. Options: -o restrict OPTNAMEs to those defined for use with `set -o' -p print each shell option with an indication of its status -q suppress output -s enable (set) each OPTNAME -u disable (unset) each OPTNAME Exit Status: Returns success if OPTNAME is enabled; fails if an invalid option is given or OPTNAME is disabled.Display directory stack. Display the list of currently remembered directories. Directories find their way onto the list with the `pushd' command; you can get back up through the list with the `popd' command. Options: -c clear the directory stack by deleting all of the elements -l do not print tilde-prefixed versions of directories relative to your home directory -p print the directory stack with one entry per line -v print the directory stack with one entry per line prefixed with its position in the stack Arguments: +N Displays the Nth entry counting from the left of the list shown by dirs when invoked without options, starting with zero. -N Displays the Nth entry counting from the right of the list shown by dirs when invoked without options, starting with zero. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Remove directories from stack. Removes entries from the directory stack. With no arguments, removes the top directory from the stack, and changes to the new top directory. Options: -n Suppresses the normal change of directory when removing directories from the stack, so only the stack is manipulated. Arguments: +N Removes the Nth entry counting from the left of the list shown by `dirs', starting with zero. For example: `popd +0' removes the first directory, `popd +1' the second. -N Removes the Nth entry counting from the right of the list shown by `dirs', starting with zero. For example: `popd -0' removes the last directory, `popd -1' the next to last. The `dirs' builtin displays the directory stack. Exit Status: Returns success unless an invalid argument is supplied or the directory change fails.Add directories to stack. Adds a directory to the top of the directory stack, or rotates the stack, making the new top of the stack the current working directory. With no arguments, exchanges the top two directories. Options: -n Suppresses the normal change of directory when adding directories to the stack, so only the stack is manipulated. Arguments: +N Rotates the stack so that the Nth directory (counting from the left of the list shown by `dirs', starting with zero) is at the top. -N Rotates the stack so that the Nth directory (counting from the right of the list shown by `dirs', starting with zero) is at the top. dir Adds DIR to the directory stack at the top, making it the new current working directory. The `dirs' builtin displays the directory stack. Exit Status: Returns success unless an invalid argument is supplied or the directory change fails.Common shell variable names and usage. BASH_VERSION Version information for this Bash. CDPATH A colon-separated list of directories to search for directories given as arguments to `cd'. GLOBIGNORE A colon-separated list of patterns describing filenames to be ignored by pathname expansion. HISTFILE The name of the file where your command history is stored. HISTFILESIZE The maximum number of lines this file can contain. HISTSIZE The maximum number of history lines that a running shell can access. HOME The complete pathname to your login directory. HOSTNAME The name of the current host. HOSTTYPE The type of CPU this version of Bash is running under. IGNOREEOF Controls the action of the shell on receipt of an EOF character as the sole input. If set, then the value of it is the number of EOF characters that can be seen in a row on an empty line before the shell will exit (default 10). When unset, EOF signifies the end of input. MACHTYPE A string describing the current system Bash is running on. MAILCHECK How often, in seconds, Bash checks for new mail. MAILPATH A colon-separated list of filenames which Bash checks for new mail. OSTYPE The version of Unix this version of Bash is running on. PATH A colon-separated list of directories to search when looking for commands. PROMPT_COMMAND A command to be executed before the printing of each primary prompt. PS1 The primary prompt string. PS2 The secondary prompt string. PWD The full pathname of the current directory. SHELLOPTS A colon-separated list of enabled shell options. TERM The name of the current terminal type. TIMEFORMAT The output format for timing statistics displayed by the `time' reserved word. auto_resume Non-null means a command word appearing on a line by itself is first looked for in the list of currently stopped jobs. If found there, that job is foregrounded. A value of `exact' means that the command word must exactly match a command in the list of stopped jobs. A value of `substring' means that the command word must match a substring of the job. Any other value means that the command must be a prefix of a stopped job. histchars Characters controlling history expansion and quick substitution. The first character is the history substitution character, usually `!'. The second is the `quick substitution' character, usually `^'. The third is the `history comment' character, usually `#'. HISTIGNORE A colon-separated list of patterns used to decide which commands should be saved on the history list. Execute conditional command. Returns a status of 0 or 1 depending on the evaluation of the conditional expression EXPRESSION. Expressions are composed of the same primaries used by the `test' builtin, and may be combined using the following operators: ( EXPRESSION ) Returns the value of EXPRESSION ! EXPRESSION True if EXPRESSION is false; else false EXPR1 && EXPR2 True if both EXPR1 and EXPR2 are true; else false EXPR1 || EXPR2 True if either EXPR1 or EXPR2 is true; else false When the `==' and `!=' operators are used, the string to the right of the operator is used as a pattern and pattern matching is performed. When the `=~' operator is used, the string to the right of the operator is matched as a regular expression. The && and || operators do not evaluate EXPR2 if EXPR1 is sufficient to determine the expression's value. Exit Status: 0 or 1 depending on value of EXPRESSION.Evaluate arithmetic expression. The EXPRESSION is evaluated according to the rules for arithmetic evaluation. Equivalent to `let "EXPRESSION"'. Exit Status: Returns 1 if EXPRESSION evaluates to 0; returns 0 otherwise.Resume job in foreground. Equivalent to the JOB_SPEC argument to the `fg' command. Resume a stopped or background job. JOB_SPEC can specify either a job name or a job number. Following JOB_SPEC with a `&' places the job in the background, as if the job specification had been supplied as an argument to `bg'. Exit Status: Returns the status of the resumed job.Group commands as a unit. Run a set of commands in a group. This is one way to redirect an entire set of commands. Exit Status: Returns the status of the last command executed.Define shell function. Create a shell function named NAME. When invoked as a simple command, NAME runs COMMANDs in the calling shell's context. When NAME is invoked, the arguments are passed to the function as $1...$n, and the function's name is in $FUNCNAME. Exit Status: Returns success unless NAME is readonly.Create a coprocess named NAME. Execute COMMAND asynchronously, with the standard output and standard input of the command connected via a pipe to file descriptors assigned to indices 0 and 1 of an array variable NAME in the executing shell. The default NAME is "COPROC". Exit Status: The coproc command returns an exit status of 0.Execute commands as long as a test does not succeed. Expand and execute COMMANDS as long as the final command in the `until' COMMANDS has an exit status which is not zero. Exit Status: Returns the status of the last command executed.Execute commands as long as a test succeeds. Expand and execute COMMANDS as long as the final command in the `while' COMMANDS has an exit status of zero. Exit Status: Returns the status of the last command executed.Execute commands based on conditional. The `if COMMANDS' list is executed. If its exit status is zero, then the `then COMMANDS' list is executed. Otherwise, each `elif COMMANDS' list is executed in turn, and if its exit status is zero, the corresponding `then COMMANDS' list is executed and the if command completes. Otherwise, the `else COMMANDS' list is executed, if present. The exit status of the entire construct is the exit status of the last command executed, or zero if no condition tested true. Exit Status: Returns the status of the last command executed.Execute commands based on pattern matching. Selectively execute COMMANDS based upon WORD matching PATTERN. The `|' is used to separate multiple patterns. Exit Status: Returns the status of the last command executed.Report time consumed by pipeline's execution. Execute PIPELINE and print a summary of the real time, user CPU time, and system CPU time spent executing PIPELINE when it terminates. Options: -p print the timing summary in the portable Posix format The value of the TIMEFORMAT variable is used as the output format. Exit Status: The return status is the return status of PIPELINE.Select words from a list and execute commands. The WORDS are expanded, generating a list of words. The set of expanded words is printed on the standard error, each preceded by a number. If `in WORDS' is not present, `in "$@"' is assumed. The PS3 prompt is then displayed and a line read from the standard input. If the line consists of the number corresponding to one of the displayed words, then NAME is set to that word. If the line is empty, WORDS and the prompt are redisplayed. If EOF is read, the command completes. Any other value read causes NAME to be set to null. The line read is saved in the variable REPLY. COMMANDS are executed after each selection until a break command is executed. Exit Status: Returns the status of the last command executed.Arithmetic for loop. Equivalent to (( EXP1 )) while (( EXP2 )); do COMMANDS (( EXP3 )) done EXP1, EXP2, and EXP3 are arithmetic expressions. If any expression is omitted, it behaves as if it evaluates to 1. Exit Status: Returns the status of the last command executed.Execute commands for each member in a list. The `for' loop executes a sequence of commands for each member in a list of items. If `in WORDS ...;' is not present, then `in "$@"' is assumed. For each element in WORDS, NAME is set to that element, and the COMMANDS are executed. Exit Status: Returns the status of the last command executed.Wait for job completion and return exit status. Waits for each process identified by an ID, which may be a process ID or a job specification, and reports its termination status. If ID is not given, waits for all currently active child processes, and the return status is zero. If ID is a job specification, waits for all processes in that job's pipeline. If the -n option is supplied, waits for a single job from the list of IDs, or, if no IDs are supplied, for the next job to complete and returns its exit status. If the -p option is supplied, the process or job identifier of the job for which the exit status is returned is assigned to the variable VAR named by the option argument. The variable will be unset initially, before any assignment. This is useful only when the -n option is supplied. If the -f option is supplied, and job control is enabled, waits for the specified ID to terminate, instead of waiting for it to change status. Exit Status: Returns the status of the last ID; fails if ID is invalid or an invalid option is given, or if -n is supplied and the shell has no unwaited-for children.Display or set file mode mask. Sets the user file-creation mask to MODE. If MODE is omitted, prints the current value of the mask. If MODE begins with a digit, it is interpreted as an octal number; otherwise it is a symbolic mode string like that accepted by chmod(1). Options: -p if MODE is omitted, output in a form that may be reused as input -S makes the output symbolic; otherwise an octal number is output Exit Status: Returns success unless MODE is invalid or an invalid option is given.Modify shell resource limits. Provides control over the resources available to the shell and processes it creates, on systems that allow such control. Options: -S use the `soft' resource limit -H use the `hard' resource limit -a all current limits are reported -b the socket buffer size -c the maximum size of core files created -d the maximum size of a process's data segment -e the maximum scheduling priority (`nice') -f the maximum size of files written by the shell and its children -i the maximum number of pending signals -k the maximum number of kqueues allocated for this process -l the maximum size a process may lock into memory -m the maximum resident set size -n the maximum number of open file descriptors -p the pipe buffer size -q the maximum number of bytes in POSIX message queues -r the maximum real-time scheduling priority -s the maximum stack size -t the maximum amount of cpu time in seconds -u the maximum number of user processes -v the size of virtual memory -x the maximum number of file locks -P the maximum number of pseudoterminals -R the maximum time a real-time process can run before blocking -T the maximum number of threads Not all options are available on all platforms. If LIMIT is given, it is the new value of the specified resource; the special LIMIT values `soft', `hard', and `unlimited' stand for the current soft limit, the current hard limit, and no limit, respectively. Otherwise, the current value of the specified resource is printed. If no option is given, then -f is assumed. Values are in 1024-byte increments, except for -t, which is in seconds, -p, which is in increments of 512 bytes, and -u, which is an unscaled number of processes. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Display information about command type. For each NAME, indicate how it would be interpreted if used as a command name. Options: -a display all locations containing an executable named NAME; includes aliases, builtins, and functions, if and only if the `-p' option is not also used -f suppress shell function lookup -P force a PATH search for each NAME, even if it is an alias, builtin, or function, and returns the name of the disk file that would be executed -p returns either the name of the disk file that would be executed, or nothing if `type -t NAME' would not return `file' -t output a single word which is one of `alias', `keyword', `function', `builtin', `file' or `', if NAME is an alias, shell reserved word, shell function, shell builtin, disk file, or not found, respectively Arguments: NAME Command name to be interpreted. Exit Status: Returns success if all of the NAMEs are found; fails if any are not found.Trap signals and other events. Defines and activates handlers to be run when the shell receives signals or other conditions. ARG is a command to be read and executed when the shell receives the signal(s) SIGNAL_SPEC. If ARG is absent (and a single SIGNAL_SPEC is supplied) or `-', each specified signal is reset to its original value. If ARG is the null string each SIGNAL_SPEC is ignored by the shell and by the commands it invokes. If a SIGNAL_SPEC is EXIT (0) ARG is executed on exit from the shell. If a SIGNAL_SPEC is DEBUG, ARG is executed before every simple command. If a SIGNAL_SPEC is RETURN, ARG is executed each time a shell function or a script run by the . or source builtins finishes executing. A SIGNAL_SPEC of ERR means to execute ARG each time a command's failure would cause the shell to exit when the -e option is enabled. If no arguments are supplied, trap prints the list of commands associated with each signal. Options: -l print a list of signal names and their corresponding numbers -p display the trap commands associated with each SIGNAL_SPEC Each SIGNAL_SPEC is either a signal name in or a signal number. Signal names are case insensitive and the SIG prefix is optional. A signal may be sent to the shell with "kill -signal $$". Exit Status: Returns success unless a SIGSPEC is invalid or an invalid option is given.Display process times. Prints the accumulated user and system times for the shell and all of its child processes. Exit Status: Always succeeds.Evaluate conditional expression. This is a synonym for the "test" builtin, but the last argument must be a literal `]', to match the opening `['.Evaluate conditional expression. Exits with a status of 0 (true) or 1 (false) depending on the evaluation of EXPR. Expressions may be unary or binary. Unary expressions are often used to examine the status of a file. There are string operators and numeric comparison operators as well. The behavior of test depends on the number of arguments. Read the bash manual page for the complete specification. File operators: -a FILE True if file exists. -b FILE True if file is block special. -c FILE True if file is character special. -d FILE True if file is a directory. -e FILE True if file exists. -f FILE True if file exists and is a regular file. -g FILE True if file is set-group-id. -h FILE True if file is a symbolic link. -L FILE True if file is a symbolic link. -k FILE True if file has its `sticky' bit set. -p FILE True if file is a named pipe. -r FILE True if file is readable by you. -s FILE True if file exists and is not empty. -S FILE True if file is a socket. -t FD True if FD is opened on a terminal. -u FILE True if the file is set-user-id. -w FILE True if the file is writable by you. -x FILE True if the file is executable by you. -O FILE True if the file is effectively owned by you. -G FILE True if the file is effectively owned by your group. -N FILE True if the file has been modified since it was last read. FILE1 -nt FILE2 True if file1 is newer than file2 (according to modification date). FILE1 -ot FILE2 True if file1 is older than file2. FILE1 -ef FILE2 True if file1 is a hard link to file2. String operators: -z STRING True if string is empty. -n STRING STRING True if string is not empty. STRING1 = STRING2 True if the strings are equal. STRING1 != STRING2 True if the strings are not equal. STRING1 < STRING2 True if STRING1 sorts before STRING2 lexicographically. STRING1 > STRING2 True if STRING1 sorts after STRING2 lexicographically. Other operators: -o OPTION True if the shell option OPTION is enabled. -v VAR True if the shell variable VAR is set. -R VAR True if the shell variable VAR is set and is a name reference. ! EXPR True if expr is false. EXPR1 -a EXPR2 True if both expr1 AND expr2 are true. EXPR1 -o EXPR2 True if either expr1 OR expr2 is true. arg1 OP arg2 Arithmetic tests. OP is one of -eq, -ne, -lt, -le, -gt, or -ge. Arithmetic binary operators return true if ARG1 is equal, not-equal, less-than, less-than-or-equal, greater-than, or greater-than-or-equal than ARG2. Exit Status: Returns success if EXPR evaluates to true; fails if EXPR evaluates to false or an invalid argument is given.Suspend shell execution. Suspend the execution of this shell until it receives a SIGCONT signal. Unless forced, login shells cannot be suspended. Options: -f force the suspend, even if the shell is a login shell Exit Status: Returns success unless job control is not enabled or an error occurs.Execute commands from a file in the current shell. Read and execute commands from FILENAME in the current shell. The entries in $PATH are used to find the directory containing FILENAME. If any ARGUMENTS are supplied, they become the positional parameters when FILENAME is executed. Exit Status: Returns the status of the last command executed in FILENAME; fails if FILENAME cannot be read.Shift positional parameters. Rename the positional parameters $N+1,$N+2 ... to $1,$2 ... If N is not given, it is assumed to be 1. Exit Status: Returns success unless N is negative or greater than $#.Mark shell variables as unchangeable. Mark each NAME as read-only; the values of these NAMEs may not be changed by subsequent assignment. If VALUE is supplied, assign VALUE before marking as read-only. Options: -a refer to indexed array variables -A refer to associative array variables -f refer to shell functions -p display a list of all readonly variables or functions, depending on whether or not the -f option is given An argument of `--' disables further option processing. Exit Status: Returns success unless an invalid option is given or NAME is invalid.Set export attribute for shell variables. Marks each NAME for automatic export to the environment of subsequently executed commands. If VALUE is supplied, assign VALUE before exporting. Options: -f refer to shell functions -n remove the export property from each NAME -p display a list of all exported variables and functions An argument of `--' disables further option processing. Exit Status: Returns success unless an invalid option is given or NAME is invalid.Unset values and attributes of shell variables and functions. For each NAME, remove the corresponding variable or function. Options: -f treat each NAME as a shell function -v treat each NAME as a shell variable -n treat each NAME as a name reference and unset the variable itself rather than the variable it references Without options, unset first tries to unset a variable, and if that fails, tries to unset a function. Some variables cannot be unset; also see `readonly'. Exit Status: Returns success unless an invalid option is given or a NAME is read-only.Set or unset values of shell options and positional parameters. Change the value of shell attributes and positional parameters, or display the names and values of shell variables. Options: -a Mark variables which are modified or created for export. -b Notify of job termination immediately. -e Exit immediately if a command exits with a non-zero status. -f Disable file name generation (globbing). -h Remember the location of commands as they are looked up. -k All assignment arguments are placed in the environment for a command, not just those that precede the command name. -m Job control is enabled. -n Read commands but do not execute them. -o option-name Set the variable corresponding to option-name: allexport same as -a braceexpand same as -B emacs use an emacs-style line editing interface errexit same as -e errtrace same as -E functrace same as -T hashall same as -h histexpand same as -H history enable command history ignoreeof the shell will not exit upon reading EOF interactive-comments allow comments to appear in interactive commands keyword same as -k monitor same as -m noclobber same as -C noexec same as -n noglob same as -f nolog currently accepted but ignored notify same as -b nounset same as -u onecmd same as -t physical same as -P pipefail the return value of a pipeline is the status of the last command to exit with a non-zero status, or zero if no command exited with a non-zero status posix change the behavior of bash where the default operation differs from the Posix standard to match the standard privileged same as -p verbose same as -v vi use a vi-style line editing interface xtrace same as -x -p Turned on whenever the real and effective user ids do not match. Disables processing of the $ENV file and importing of shell functions. Turning this option off causes the effective uid and gid to be set to the real uid and gid. -t Exit after reading and executing one command. -u Treat unset variables as an error when substituting. -v Print shell input lines as they are read. -x Print commands and their arguments as they are executed. -B the shell will perform brace expansion -C If set, disallow existing regular files to be overwritten by redirection of output. -E If set, the ERR trap is inherited by shell functions. -H Enable ! style history substitution. This flag is on by default when the shell is interactive. -P If set, do not resolve symbolic links when executing commands such as cd which change the current directory. -T If set, the DEBUG and RETURN traps are inherited by shell functions. -- Assign any remaining arguments to the positional parameters. If there are no remaining arguments, the positional parameters are unset. - Assign any remaining arguments to the positional parameters. The -x and -v options are turned off. Using + rather than - causes these flags to be turned off. The flags can also be used upon invocation of the shell. The current set of flags may be found in $-. The remaining n ARGs are positional parameters and are assigned, in order, to $1, $2, .. $n. If no ARGs are given, all shell variables are printed. Exit Status: Returns success unless an invalid option is given.Return from a shell function. Causes a function or sourced script to exit with the return value specified by N. If N is omitted, the return status is that of the last command executed within the function or script. Exit Status: Returns N, or failure if the shell is not executing a function or script.Read a line from the standard input and split it into fields. Reads a single line from the standard input, or from file descriptor FD if the -u option is supplied. The line is split into fields as with word splitting, and the first word is assigned to the first NAME, the second word to the second NAME, and so on, with any leftover words assigned to the last NAME. Only the characters found in $IFS are recognized as word delimiters. If no NAMEs are supplied, the line read is stored in the REPLY variable. Options: -a array assign the words read to sequential indices of the array variable ARRAY, starting at zero -d delim continue until the first character of DELIM is read, rather than newline -e use Readline to obtain the line -i text use TEXT as the initial text for Readline -n nchars return after reading NCHARS characters rather than waiting for a newline, but honor a delimiter if fewer than NCHARS characters are read before the delimiter -N nchars return only after reading exactly NCHARS characters, unless EOF is encountered or read times out, ignoring any delimiter -p prompt output the string PROMPT without a trailing newline before attempting to read -r do not allow backslashes to escape any characters -s do not echo input coming from a terminal -t timeout time out and return failure if a complete line of input is not read within TIMEOUT seconds. The value of the TMOUT variable is the default timeout. TIMEOUT may be a fractional number. If TIMEOUT is 0, read returns immediately, without trying to read any data, returning success only if input is available on the specified file descriptor. The exit status is greater than 128 if the timeout is exceeded -u fd read from file descriptor FD instead of the standard input Exit Status: The return code is zero, unless end-of-file is encountered, read times out (in which case it's greater than 128), a variable assignment error occurs, or an invalid file descriptor is supplied as the argument to -u.Evaluate arithmetic expressions. Evaluate each ARG as an arithmetic expression. Evaluation is done in fixed-width integers with no check for overflow, though division by 0 is trapped and flagged as an error. The following list of operators is grouped into levels of equal-precedence operators. The levels are listed in order of decreasing precedence. id++, id-- variable post-increment, post-decrement ++id, --id variable pre-increment, pre-decrement -, + unary minus, plus !, ~ logical and bitwise negation ** exponentiation *, /, % multiplication, division, remainder +, - addition, subtraction <<, >> left and right bitwise shifts <=, >=, <, > comparison ==, != equality, inequality & bitwise AND ^ bitwise XOR | bitwise OR && logical AND || logical OR expr ? expr : expr conditional operator =, *=, /=, %=, +=, -=, <<=, >>=, &=, ^=, |= assignment Shell variables are allowed as operands. The name of the variable is replaced by its value (coerced to a fixed-width integer) within an expression. The variable need not have its integer attribute turned on to be used in an expression. Operators are evaluated in order of precedence. Sub-expressions in parentheses are evaluated first and may override the precedence rules above. Exit Status: If the last ARG evaluates to 0, let returns 1; let returns 0 otherwise.Send a signal to a job. Send the processes identified by PID or JOBSPEC the signal named by SIGSPEC or SIGNUM. If neither SIGSPEC nor SIGNUM is present, then SIGTERM is assumed. Options: -s sig SIG is a signal name -n sig SIG is a signal number -l list the signal names; if arguments follow `-l' they are assumed to be signal numbers for which names should be listed -L synonym for -l Kill is a shell builtin for two reasons: it allows job IDs to be used instead of process IDs, and allows processes to be killed if the limit on processes that you can create is reached. Exit Status: Returns success unless an invalid option is given or an error occurs.Remove jobs from current shell. Removes each JOBSPEC argument from the table of active jobs. Without any JOBSPECs, the shell uses its notion of the current job. Options: -a remove all jobs if JOBSPEC is not supplied -h mark each JOBSPEC so that SIGHUP is not sent to the job if the shell receives a SIGHUP -r remove only running jobs Exit Status: Returns success unless an invalid option or JOBSPEC is given.Display status of jobs. Lists the active jobs. JOBSPEC restricts output to that job. Without options, the status of all active jobs is displayed. Options: -l lists process IDs in addition to the normal information -n lists only processes that have changed status since the last notification -p lists process IDs only -r restrict output to running jobs -s restrict output to stopped jobs If -x is supplied, COMMAND is run after all job specifications that appear in ARGS have been replaced with the process ID of that job's process group leader. Exit Status: Returns success unless an invalid option is given or an error occurs. If -x is used, returns the exit status of COMMAND.Display or manipulate the history list. Display the history list with line numbers, prefixing each modified entry with a `*'. An argument of N lists only the last N entries. Options: -c clear the history list by deleting all of the entries -d offset delete the history entry at position OFFSET. Negative offsets count back from the end of the history list -a append history lines from this session to the history file -n read all history lines not already read from the history file and append them to the history list -r read the history file and append the contents to the history list -w write the current history to the history file -p perform history expansion on each ARG and display the result without storing it in the history list -s append the ARGs to the history list as a single entry If FILENAME is given, it is used as the history file. Otherwise, if HISTFILE has a value, that is used, else ~/.bash_history. If the HISTTIMEFORMAT variable is set and not null, its value is used as a format string for strftime(3) to print the time stamp associated with each displayed history entry. No time stamps are printed otherwise. Exit Status: Returns success unless an invalid option is given or an error occurs.Display information about builtin commands. Displays brief summaries of builtin commands. If PATTERN is specified, gives detailed help on all commands matching PATTERN, otherwise the list of help topics is printed. Options: -d output short description for each topic -m display usage in pseudo-manpage format -s output only a short usage synopsis for each topic matching PATTERN Arguments: PATTERN Pattern specifying a help topic Exit Status: Returns success unless PATTERN is not found or an invalid option is given.Remember or display program locations. Determine and remember the full pathname of each command NAME. If no arguments are given, information about remembered commands is displayed. Options: -d forget the remembered location of each NAME -l display in a format that may be reused as input -p pathname use PATHNAME as the full pathname of NAME -r forget all remembered locations -t print the remembered location of each NAME, preceding each location with the corresponding NAME if multiple NAMEs are given Arguments: NAME Each NAME is searched for in $PATH and added to the list of remembered commands. Exit Status: Returns success unless NAME is not found or an invalid option is given.Move jobs to the background. Place the jobs identified by each JOB_SPEC in the background, as if they had been started with `&'. If JOB_SPEC is not present, the shell's notion of the current job is used. Exit Status: Returns success unless job control is not enabled or an error occurs.Move job to the foreground. Place the job identified by JOB_SPEC in the foreground, making it the current job. If JOB_SPEC is not present, the shell's notion of the current job is used. Exit Status: Status of command placed in foreground, or failure if an error occurs.Display or execute commands from the history list. fc is used to list or edit and re-execute commands from the history list. FIRST and LAST can be numbers specifying the range, or FIRST can be a string, which means the most recent command beginning with that string. Options: -e ENAME select which editor to use. Default is FCEDIT, then EDITOR, then vi -l list lines instead of editing -n omit line numbers when listing -r reverse the order of the lines (newest listed first) With the `fc -s [pat=rep ...] [command]' format, COMMAND is re-executed after the substitution OLD=NEW is performed. A useful alias to use with this is r='fc -s', so that typing `r cc' runs the last command beginning with `cc' and typing `r' re-executes the last command. Exit Status: Returns success or status of executed command; non-zero if an error occurs.Exit a login shell. Exits a login shell with exit status N. Returns an error if not executed in a login shell.Exit the shell. Exits the shell with a status of N. If N is omitted, the exit status is that of the last command executed.Replace the shell with the given command. Execute COMMAND, replacing this shell with the specified program. ARGUMENTS become the arguments to COMMAND. If COMMAND is not specified, any redirections take effect in the current shell. Options: -a name pass NAME as the zeroth argument to COMMAND -c execute COMMAND with an empty environment -l place a dash in the zeroth argument to COMMAND If the command cannot be executed, a non-interactive shell exits, unless the shell option `execfail' is set. Exit Status: Returns success unless COMMAND is not found or a redirection error occurs.Parse option arguments. Getopts is used by shell procedures to parse positional parameters as options. OPTSTRING contains the option letters to be recognized; if a letter is followed by a colon, the option is expected to have an argument, which should be separated from it by white space. Each time it is invoked, getopts will place the next option in the shell variable $name, initializing name if it does not exist, and the index of the next argument to be processed into the shell variable OPTIND. OPTIND is initialized to 1 each time the shell or a shell script is invoked. When an option requires an argument, getopts places that argument into the shell variable OPTARG. getopts reports errors in one of two ways. If the first character of OPTSTRING is a colon, getopts uses silent error reporting. In this mode, no error messages are printed. If an invalid option is seen, getopts places the option character found into OPTARG. If a required argument is not found, getopts places a ':' into NAME and sets OPTARG to the option character found. If getopts is not in silent mode, and an invalid option is seen, getopts places '?' into NAME and unsets OPTARG. If a required argument is not found, a '?' is placed in NAME, OPTARG is unset, and a diagnostic message is printed. If the shell variable OPTERR has the value 0, getopts disables the printing of error messages, even if the first character of OPTSTRING is not a colon. OPTERR has the value 1 by default. Getopts normally parses the positional parameters, but if arguments are supplied as ARG values, they are parsed instead. Exit Status: Returns success if an option is found; fails if the end of options is encountered or an error occurs.Execute arguments as a shell command. Combine ARGs into a single string, use the result as input to the shell, and execute the resulting commands. Exit Status: Returns exit status of command or success if command is null.Enable and disable shell builtins. Enables and disables builtin shell commands. Disabling allows you to execute a disk command which has the same name as a shell builtin without using a full pathname. Options: -a print a list of builtins showing whether or not each is enabled -n disable each NAME or display a list of disabled builtins -p print the list of builtins in a reusable format -s print only the names of Posix `special' builtins Options controlling dynamic loading: -f Load builtin NAME from shared object FILENAME -d Remove a builtin loaded with -f Without options, each NAME is enabled. To use the `test' found in $PATH instead of the shell builtin version, type `enable -n test'. Exit Status: Returns success unless NAME is not a shell builtin or an error occurs.Write arguments to the standard output. Display the ARGs, separated by a single space character and followed by a newline, on the standard output. Options: -n do not append a newline -e enable interpretation of the following backslash escapes -E explicitly suppress interpretation of backslash escapes `echo' interprets the following backslash-escaped characters: \a alert (bell) \b backspace \c suppress further output \e escape character \E escape character \f form feed \n new line \r carriage return \t horizontal tab \v vertical tab \\ backslash \0nnn the character whose ASCII code is NNN (octal). NNN can be 0 to 3 octal digits \xHH the eight-bit character whose value is HH (hexadecimal). HH can be one or two hex digits \uHHHH the Unicode character whose value is the hexadecimal value HHHH. HHHH can be one to four hex digits. \UHHHHHHHH the Unicode character whose value is the hexadecimal value HHHHHHHH. HHHHHHHH can be one to eight hex digits. Exit Status: Returns success unless a write error occurs.Define local variables. Create a local variable called NAME, and give it VALUE. OPTION can be any option accepted by `declare'. Local variables can only be used within a function; they are visible only to the function where they are defined and its children. Exit Status: Returns success unless an invalid option is supplied, a variable assignment error occurs, or the shell is not executing a function.Set variable values and attributes. A synonym for `declare'. See `help declare'.Set variable values and attributes. Declare variables and give them attributes. If no NAMEs are given, display the attributes and values of all variables. Options: -f restrict action or display to function names and definitions -F restrict display to function names only (plus line number and source file when debugging) -g create global variables when used in a shell function; otherwise ignored -I if creating a local variable, inherit the attributes and value of a variable with the same name at a previous scope -p display the attributes and value of each NAME Options which set attributes: -a to make NAMEs indexed arrays (if supported) -A to make NAMEs associative arrays (if supported) -i to make NAMEs have the `integer' attribute -l to convert the value of each NAME to lower case on assignment -n make NAME a reference to the variable named by its value -r to make NAMEs readonly -t to make NAMEs have the `trace' attribute -u to convert the value of each NAME to upper case on assignment -x to make NAMEs export Using `+' instead of `-' turns off the given attribute. Variables with the integer attribute have arithmetic evaluation (see the `let' command) performed when the variable is assigned a value. When used in a function, `declare' makes NAMEs local, as with the `local' command. The `-g' option suppresses this behavior. Exit Status: Returns success unless an invalid option is supplied or a variable assignment error occurs.Execute a simple command or display information about commands. Runs COMMAND with ARGS suppressing shell function lookup, or display information about the specified COMMANDs. Can be used to invoke commands on disk when a function with the same name exists. Options: -p use a default value for PATH that is guaranteed to find all of the standard utilities -v print a description of COMMAND similar to the `type' builtin -V print a more verbose description of each COMMAND Exit Status: Returns exit status of COMMAND, or failure if COMMAND is not found.Return an unsuccessful result. Exit Status: Always fails.Return a successful result. Exit Status: Always succeeds.Null command. No effect; the command does nothing. Exit Status: Always succeeds.Print the name of the current working directory. Options: -L print the value of $PWD if it names the current working directory -P print the physical directory, without any symbolic links By default, `pwd' behaves as if `-L' were specified. Exit Status: Returns 0 unless an invalid option is given or the current directory cannot be read.Change the shell working directory. Change the current directory to DIR. The default DIR is the value of the HOME shell variable. The variable CDPATH defines the search path for the directory containing DIR. Alternative directory names in CDPATH are separated by a colon (:). A null directory name is the same as the current directory. If DIR begins with a slash (/), then CDPATH is not used. If the directory is not found, and the shell option `cdable_vars' is set, the word is assumed to be a variable name. If that variable has a value, its value is used for DIR. Options: -L force symbolic links to be followed: resolve symbolic links in DIR after processing instances of `..' -P use the physical directory structure without following symbolic links: resolve symbolic links in DIR before processing instances of `..' -e if the -P option is supplied, and the current working directory cannot be determined successfully, exit with a non-zero status -@ on systems that support it, present a file with extended attributes as a directory containing the file attributes The default is to follow symbolic links, as if `-L' were specified. `..' is processed by removing the immediately previous pathname component back to a slash or the beginning of DIR. Exit Status: Returns 0 if the directory is changed, and if $PWD is set successfully when -P is used; non-zero otherwise.Return the context of the current subroutine call. Without EXPR, returns "$line $filename". With EXPR, returns "$line $subroutine $filename"; this extra information can be used to provide a stack trace. The value of EXPR indicates how many call frames to go back before the current one; the top frame is frame 0. Exit Status: Returns 0 unless the shell is not executing a shell function or EXPR is invalid.Execute shell builtins. Execute SHELL-BUILTIN with arguments ARGs without performing command lookup. This is useful when you wish to reimplement a shell builtin as a shell function, but need to execute the builtin within the function. Exit Status: Returns the exit status of SHELL-BUILTIN, or false if SHELL-BUILTIN is not a shell builtin.Resume for, while, or until loops. Resumes the next iteration of the enclosing FOR, WHILE or UNTIL loop. If N is specified, resumes the Nth enclosing loop. Exit Status: The exit status is 0 unless N is not greater than or equal to 1.Exit for, while, or until loops. Exit a FOR, WHILE or UNTIL loop. If N is specified, break N enclosing loops. Exit Status: The exit status is 0 unless N is not greater than or equal to 1.Set Readline key bindings and variables. Bind a key sequence to a Readline function or a macro, or set a Readline variable. The non-option argument syntax is equivalent to that found in ~/.inputrc, but must be passed as a single argument: e.g., bind '"\C-x\C-r": re-read-init-file'. Options: -m keymap Use KEYMAP as the keymap for the duration of this command. Acceptable keymap names are emacs, emacs-standard, emacs-meta, emacs-ctlx, vi, vi-move, vi-command, and vi-insert. -l List names of functions. -P List function names and bindings. -p List functions and bindings in a form that can be reused as input. -S List key sequences that invoke macros and their values -s List key sequences that invoke macros and their values in a form that can be reused as input. -V List variable names and values -v List variable names and values in a form that can be reused as input. -q function-name Query about which keys invoke the named function. -u function-name Unbind all keys which are bound to the named function. -r keyseq Remove the binding for KEYSEQ. -f filename Read key bindings from FILENAME. -x keyseq:shell-command Cause SHELL-COMMAND to be executed when KEYSEQ is entered. -X List key sequences bound with -x and associated commands in a form that can be reused as input. Exit Status: bind returns 0 unless an unrecognized option is given or an error occurs.Remove each NAME from the list of defined aliases. Options: -a remove all alias definitions Return success unless a NAME is not an existing alias.Define or display aliases. Without arguments, `alias' prints the list of aliases in the reusable form `alias NAME=VALUE' on standard output. Otherwise, an alias is defined for each NAME whose VALUE is given. A trailing space in VALUE causes the next word to be checked for alias substitution when the alias is expanded. Options: -p print all defined aliases in a reusable format Exit Status: alias returns true unless a NAME is supplied for which no alias has been defined.alias [-p] [name[=value] ... ]bind [-lpsvPSVX] [-m keymap] [-f filename] [-q name] [-u name] [-r keyseq] [-x keyseq:shell-command] [keyseq:readline-function or readline-command]builtin [shell-builtin [arg ...]]command [-pVv] command [arg ...]declare [-aAfFgiIlnrtux] [-p] [name[=value] ...]typeset [-aAfFgiIlnrtux] [-p] name[=value] ...local [option] name[=value] ...enable [-a] [-dnps] [-f filename] [name ...]getopts optstring name [arg ...]exec [-cl] [-a name] [command [argument ...]] [redirection ...]fc [-e ename] [-lnr] [first] [last] or fc -s [pat=rep] [command]hash [-lr] [-p pathname] [-dt] [name ...]history [-c] [-d offset] [n] or history -anrw [filename] or history -ps arg [arg...]jobs [-lnprs] [jobspec ...] or jobs -x command [args]disown [-h] [-ar] [jobspec ... | pid ...]kill [-s sigspec | -n signum | -sigspec] pid | jobspec ... or kill -l [sigspec]read [-ers] [-a array] [-d delim] [-i text] [-n nchars] [-N nchars] [-p prompt] [-t timeout] [-u fd] [name ...]set [-abefhkmnptuvxBCHP] [-o option-name] [--] [arg ...]unset [-f] [-v] [-n] [name ...]export [-fn] [name[=value] ...] or export -preadonly [-aAf] [name[=value] ...] or readonly -ptrap [-lp] [[arg] signal_spec ...]ulimit [-SHabcdefiklmnpqrstuvxPT] [limit]for NAME [in WORDS ... ] ; do COMMANDS; donefor (( exp1; exp2; exp3 )); do COMMANDS; doneselect NAME [in WORDS ... ;] do COMMANDS; donecase WORD in [PATTERN [| PATTERN]...) COMMANDS ;;]... esacif COMMANDS; then COMMANDS; [ elif COMMANDS; then COMMANDS; ]... [ else COMMANDS; ] fiwhile COMMANDS; do COMMANDS; doneuntil COMMANDS; do COMMANDS; donecoproc [NAME] command [redirections]function name { COMMANDS ; } or name () { COMMANDS ; }variables - Names and meanings of some shell variablesshopt [-pqsu] [-o] [optname ...]printf [-v var] format [arguments]complete [-abcdefgjksuv] [-pr] [-DEI] [-o option] [-A action] [-G globpat] [-W wordlist] [-F function] [-C command] [-X filterpat] [-P prefix] [-S suffix] [name ...]compgen [-abcdefgjksuv] [-o option] [-A action] [-G globpat] [-W wordlist] [-F function] [-C command] [-X filterpat] [-P prefix] [-S suffix] [word]compopt [-o|+o option] [-DEI] [name ...]mapfile [-d delim] [-n count] [-O origin] [-s count] [-t] [-u fd] [-C callback] [-c quantum] [array]readarray [-d delim] [-n count] [-O origin] [-s count] [-t] [-u fd] [-C callback] [-c quantum] [array]unaliasunalias [-a] name [name ...]breakbreak [n]continuecontinue [n]callercaller [expr]cd [-L|[-P [-e]] [-@]] [dir]pwdpwd [-LP]truefalsedeclaretypesetlocalecho [-neE] [arg ...]enableeval [arg ...]getoptsexit [n]logout [n]fg [job_spec]bg [job_spec ...]help [-dms] [pattern ...]disownkilllet arg [arg ...]readreturn [n]readonlyshiftshift [n]sourcesource filename [arguments]. filename [arguments]suspend [-f]testtest [expr][ arg... ]timestype [-afptP] name [name ...]ulimitumaskumask [-p] [-S] [mode]waitwait [-fn] [-p var] [id ...]time [-p] pipeline{ ... }{ COMMANDS ; }%job_spec [&](( ... ))(( expression ))[[ ... ]][[ expression ]]variablespushdpushd [-n] [+N | -N | dir]popdpopd [-n] [+N | -N]dirs [-clpv] [+N] [-N]shoptprintfcompgencompoptmapfilereadarray-- alias %s, line editing not enabledbind_builtinlvpVPsSXf:q:u:m:r:x:`%s': invalid keymap name%s: cannot read: %s`%s': unknown function name%s is not bound to any keys. %s can be invoked via "%s"%s`%s': cannot unbindx`H@( --helploop countonly meaningful in a `for', `while', or `until' loopNULL%s %s %s OLDPWD=chdireLPHOME not setOLDPWD not setCDPATHpvVcommand_builtin%s: usage: %s: numeric argument required%s: not found%s: invalid option nameinvalid octal numberinvalid hex number%s: %s out of range%s: no such job%s: no job control%s: restricted%s: not a shell builtinwrite error: %s`'%s: ambiguous job specSIGJUNKUnknown%2d) %s%s: invalid signal specification`%s': not a pid or valid job specerror setting terminal attributes: %serror getting terminal attributes: %s%s: error retrieving current directory: %s: %s -a-A+acfgilnprtuxAFGI%s %d %s %s: reference variable cannot be an array`%s': invalid variable name for name referencecannot use `-f' to make functions%s: quoted compound array assignment deprecated%s: cannot destroy array variables in this way%s: cannot convert associative to indexed arraycan only be used in a function`LxIxIxIxIpLMxIPLxIxIxIxIxIxIxIxIxIxIxIxIxIxIxIxIxIxIxIxIxIxIxILxILxIxILLxIXMxIxIhMxIMxIIxILxIMMxIxI@M2MHHHH?MHHHpKHHHHHHHHHHHHHHHHHHHHHHHLMHYMHHfMsMHMHHMHMHHHMHMMHHMneEadnpsf:enable %s enable -n %s BASH_LOADABLES_PATH%s: not dynamically loaded%s: cannot delete: %scannot open shared object %s: %scannot find %s in shared object %s: %s%s: dynamic builtin already loadedload function for %s returns failure (%d): not loadedgffgfgfffffffffffff_builtin_unload%s: is a directory%s: not a regular file%s: file is too large_evalfileparse_and_execute toppe_disposeparse_and_executeparse_string topparse_stringevalstring%s: ignoring function definition attemptcla:%s: cannot execute: %s~/.bash_logout/etc/bash.bash_logoutThere are stopped jobs. There are running jobs. exit logout not login shell: use `exit'${FCEDIT:-${EDITOR:-ed}}${FCEDIT:-${EDITOR:-vi}}:e:lnrsno command foundhistory specificationbash-fc%s: cannot open temp file: %s %cfc builtin\\\\\\\\\\̒currentjob %d started without job control%4d %s builtin hash -p %s %s -d-thashing disableddlp:rthits command %s: hash table empty %s ` Ȣ P @%s: cannot open: %s%*s%s %s: %s dms%ls%c%s %ls ' %*s%s - SYNOPSIS%*s%s DESCRIPTIONSEE ALSO%*sbash(1) IMPLEMENTATIONThese shell commands are defined internally. Type `help' to see this list. Type `help name' to find out more about the function `name'. Use `info bash' to find out more about the shell in general. Use `man -k' or `info' to find out more about commands not in this list. A star (*) next to a name means that the command is disabled. Shell commands matching keywords `Shell commands matching keyword `no help topics match `%s'. Try `help help' or `man -k %s' or `info %s'.acd:npsrw%s: history expansion failedhistory position%s: invalid timestamp%5d%c %s%s cannot use more than one of -anrwtdTLD %2d %s%s: invalid argumentno other directorydirstackersa:d:i:n:p:t:u:N:read_builtinread error: %d: %s%s: invalid timeout specification\D,\h|can only `return' from a function or sourced scriptediting-modeallexportbraceexpandoff%-15s %s set %co %s fnv%s: not an array variableerrtracefunctracehashallhistexpandinteractive-commentskeywordmonitornoclobbernoexecnoglobnolognotifynounsetonecmdphysicalpipefailprivilegedxtracecannot simultaneously unset a function and a variabledeclare -%s %s -%s aAfnp%s: not a function%s: cannot exportshift countfilename argument required%s: file not foundcannot suspendcannot suspend a login shellunknowntrap -- %s %d trap -- %s %s %s is aliased to `%s' alias %s=%s %s is a shell keyword %s is a function %s is a shell builtin %s is %s %s is hashed (%s) -type-path-allafptP%s is a special shell builtin P54444444444444444@5444485444444444(54445(%s, -%c) (-%c) %-20s %20sunlimited%s: cannot get limit: %shardsoft%s: cannot modify limit: %s`%c': bad commandreal-time non-blocking timemicrosecondscore file sizeblocksdata seg sizekbytesscheduling prioritypending signalsmax locked memorymax memory sizeopen filespipe size512 bytesPOSIX message queuesreal-time prioritystack sizecpu timemax user processesvirtual memoryfile locksu=%s,g=%s,o=%s agourwx -SSpumask%s %04lo `%c': invalid symbolic mode operator`%c': invalid symbolic mode characterfnp:OPTARGautocdassoc_expand_once-s-ushopt %s %s %s: invalid shell option nameBASHOPTSpsuoqcdable_varscdspellcheckhashcheckjobscheckwinsizecmdhistcompat31compat32compat40compat41compat42compat43compat44complete_fullquotedirexpanddirspelldotglobexecfailexpand_aliasesextdebugextglobextquotefailglobforce_fignoreglobasciirangesglobstargnu_errfmthistappendhistreedithistverifyhostcompletehuponexitinherit_errexitinteractive_commentslastpipelithistlocalvar_inheritlocalvar_unsetmailwarnno_empty_cmd_completionnocaseglobnocasematchnullglobprogcompprogcomp_aliaspromptvarsrestricted_shellshift_verbosesourcepathxpg_echoOOOOOOOOOOOOPOUUUUUUUcannot set and unset shell options simultaneouslymissing hex digit for \xmissing unicode digit for \%cwarning: %s: %s#'-+ 0v:hjlLtz[[[[[[[[[[[[[[\\\\\\\\[[[[[[[[[[[[[|\[[[[[[[[[[[[[[[\[[[[[[ ][[[[],]<][|\\][[[[[[[l][[[|][]\][]nPkPkPkPkPkPkPkPkPkPkPkPkPkPkPkPkPkPkPkPkPkPkPkPk$lPkPkPk$l$l$lPkPkPkPkPkPkPkPkPkPkPkPkPkPkPkPkNmPkPkPkPkPkPkPkPk$ln#nn$l$l$lPknPkPkPkPkpNmPkZpPkoPkNmPkPkNm`%c': invalid time format specification`%c': invalid format character`%s': missing format character%s: illegal option -- %c %s: option requires an argument -- %c -D-E-Ibashdefault-r%s: invalid action namecompopt -o %s +o %s arrayvarcomplete -%c -A %s -G%s %s -W-P-X-C-F+o:DEIdirnamesfilenamesnoquotenosortnospaceplusdirsbindinghelptopicgrouprunningservicesetoptsignaluser%s: no completion specificationabcdefgjko:prsuvA:G:W:P:S:X:F:C:DEIwarning: -F option may not work as you expectwarning: -C option may not work as you expectnot currently executing completion functionllL,ćlllllll|lldlllL4llllllll$ĆllԆlll l܅̅lascii?*+@!alnumalphablankcntrlgraphlowerpunctupperxdigitNULSOHSTXETXEOTENQalertBSbackspaceHTLFVTvertical-tabFFform-feedCRcarriage-returnSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4IS3GSIS2RSIS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusdashperiodfull-stopzerotwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscoregrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELjN- 1alnum?*+@!asciiwordNULSOHSTXETXEOTENQACKalertBSHTtabLFVTFFCRSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USspacecommahyphenminusdashperiodslashzeroonetwothreefourfivesixseveneightninecolontildeDELbackspacenewlinevertical-tabform-feedcarriage-returnexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signhyphen-minusfull-stopsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscoregrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracket@PBASH_REMATCH/dev/fd//dev/stderr%s: bad network path specificationsocketconnect%ldm%d%c%03dssh_makepathsh_realpathTMPDIR/var/tmp/usr/tmpshtmp%s/%s.XXXXXXw+BAAAABAAAAAAAAD$C$C$C$C$C$C$CAAAAAAABAAAAACAAAAAAAAAAAAAAAECAAAAAA`>> ?4?6?=? >@><@>T@A@C@0EAFDA@G`AG|AJAJAK$BLXBMtBMBMB`NBNB0OBOCPC@P,CPdC0QCQCR$D0SdDpSDSDTD U EpU0EUDEU\EUE`VEWE0XFpX0FXLFXhF0YFYF ZFZFZF[G@[$G[DG\|G]G]G^8H_`H`HaH`bIb8Ic|IdIeIeIfJpf(Jg`JPhJhJhJ@iKiLKitK@jKjK k$LnLPnLnL0oMoPMo|M@pMpMpN0q$Nq@NrNuN w8OPxxOxO yOyOzPP {dP{Pp|P`PQPtQ Q4RpRpR SPShS`SS0S`T\TTT`TВUUP4UГlUUЕUV@LVVХV V0WhW@WWWW(XXЮXX X@Y`Yp0Yp|YгY Zй4ZlZлZ0[@,[pp[[@[` \L\\p]]0]PH]`]] ]p]] ]`^^8^X^ l^0^`^^^^@_0_ d_ _@_P_p__08````a`a b@hb!b@*c*@c1c6(d@?xdP?d`?dp?d?d?d?d@e@@e`@,ep@@e@Te@hePAeAe BepBf0C@fDfDfDfDgElgEgFgFgFh0G0hpGXhGhHhHh`IiI4iJ\i`JiKiKiNjN,jODjOXj0Olj@OjOjPPjPkR`kRtkSkSkSk@T$lUHlUxlVlVlpW m0XLm Ym`YmYmZm`Zn [Ln[xn\n\n](o^Ho0^ho^o_o@`p`Xp axpPappapapbp0bqpb qbDqPcdq`dqpeqer0f0r`fDrf`rf|rgrpgrgr hrh sh0sPj|sjskskslt@ltPptpt@qtqu0r@uvu|uP}vlvPv`vv`(wDwww x@Dxxxx ydyyPyy z`>@?H?`?t BBCC0F<PFT GlPGpG`HI J @J8KtKNT`U<0VP WtPWWY[8p[T0\pp^^`@`,p`@`X`x@abcd0dL0epk0ll m8pmtnn@ooD@pp0qq PrXrsstvx0wxxy@z{{|\|}@$t0p|ThЍP@Pp`, T$@P<p0 pLPl0,P|PT`@`8о@H0\P0P4H\pP@`Lp`0@p(<P|`04PH@ p<p d`pD0\` P h 00|(P\x ( X#$P%%D&d@&& '''<@(h()p))P*D*p,@- @0H2@BB<pC\E0M@MPM$`M8@NTNpN@OR``bbcPcd@ e`eef0f`ff0g8gh jl`ltmm0nn`q,qHrh`s0xpx ylz@||| |4}h@~0hЃ 0@tЈЋ@ 8h  0ЬlЭ0 P |   P `@ pT h | б   P( `  @ P p< h  0 P( x  4HP\Pp(<h@8@P| l`$P0@D  @ T0h@0  0`Dphp0,`Hd Pp (H@hp@ T      $ P0 d0pP0Dp@p4Hpx3 34 4`7`AA Ip0JJJJJK @M\M| NNOOP$`WtY@[_ 0`8 aX 0b| b b @e!qp!s!t!pu("u@"vl"0{"|#}x#0~#~#@$x$$%x%0%@&0&D&`&&з('L'`'p''((`8(P(d(((()$)D)d))))H*@`**@+PP+P++,,`|,, ,p -@p--@-.. |.... /8//0/@000`00 1d102`D2p2p22!p3#3$4*H4*|4+4P/4p/4/ 5/$5/85 0X5@0p5153545 567t68697 :87?7@8A(8`Dt8D8PE8G8G(9HD9PL9M9`N :f:hD;hX;hl;h;@i;i;m;n<nD<`o|<t<`u=Px@=`xT=y=p}=H>>0>>0?D?@??P$@8@ L@ @@pA$A8AAAB@B0tB`B0\CpCPDDDD`EpEEPEPFpF0F@Fp,G@GGG(HxHHpHH@I(I@IXIlIpIIIPI$J `JPJJJK0K8KLK`KxKPKKKKKKL,L@LTLpLLL`LLLLHMM`MM 8Np LN `N tN0 N NNN HOO0O00P@TPPPPQhQ Q Q Q R0!8R"R#R$4S'S'S'S(T(PT(hT0)T@)TP)T`)Tp)T)U)U)0U@*\U+Up+V0,LV,`V-Vp.W 2XW2W 3W 5W7HX7hXp:X<Y =XY=lY >YEY0EYG0Z`H|ZHZI[pOh[`S[PW[W0\@Y\Z\ Z\[]]p]`^]_]f^gT^gh^Pi^`i^pi^i_ j$_jD_@lX_ll_o_`p_Pq `Prp``r`pr`r`s`t``t`taPu0apuDaupa0vapwa0x@bpybzbz8czRx p6/D4X7oDeLL7BBB D(D0 (A BBBA (I EDBT`:JEE E(G0F8R@ 8A0A(B BBBA ;xAK A ;@L\ F A A 8tBDA A(N0J(J ABB"\>)Ac<"p>IEE O(D0{ (H BBBI 4"@BBA A(G0(A ABBH$#@BEB A(A0c (A BBBK A(A BBBdp#@PBBB B(A0A8D` 8A0A(B BBBH ` 8J0A(B BBBE #N4Do#NGD}$4OAd$$(PBBB B(D0A8FP6 8D0A(B BBBJ  8D0A(B BBBO $pR_Ac L n$RAFq$RM<$ SKIK A(G0](A ABBF,%SGGA jABD\L%SrKAD R DBH X DBJ  DBH A %V2A_ P A% V/Ah%0VAV&4VAR$&8VAM@&BFD kDB 6hBG  EC 46HhBG y EI $X6<BDD kDB$6ABDD sAB 6BJ0s ED 6PBJ0F EI H6BBB B(A0A8G` 8A0A(B BBBE <7P7&JJh7|7747kBGG Z EBO fBB07BDA D0n  DABH $8\ADD DAH88BBB B(A0A8Dp 8A0A(B BBBA 8884N8p(8lBDD ` ABC X8BBD F(G0Q (D ABBA D (H DBBD D(D DBB H9I[ D L L ,l9gBEA M BBG 89 BDF c ABF s DBG 9&TQ<9KIH D(D0j(A ABBA<0:\JAD fOAS @ DAK Dp:MAG W CBO M FBK tCB:3FkA:AS]:\At K ,;$JGDA wABA48;DHAE  ABJ TAE(p;BAD t ABB (;PBFG h DBC 4;gBDA D DBG JABH< BED F(D0f (D ABBD ~(A ABBL<,DY C Gl<,DV F G8<BDA D DBG P ABE H<BBB E(A0A8D@ 8D0A(B BBBG (=AAG S AAB 8@=BDA D DBG P ABE |=`TD} G G=0An=DP=[D G E ="DN F D >*DX D D,> 2Dm D>HwAy F K M h>VDq K PL>BBD A(D@D (A ABBI \ (A ABBF 8>BAD v AHJ p ABM ?x\DE G G4?TD} G GT?#h?%Ac?(%Ac? BBB B(D0A8I 8D0A(B BBBK (DksAAF * AAD pkL-\Lkdkp kl!kkYATk~BBB D(A0G@ 0A(A BBBH  0A(A BBBI HLlBBE E(A0A8G`O 8A0A(B BBBH HlBBB B(A0A8QP 8D0A(B BBBE HlxvBBB B(A0C8Gp9 8D0A(B BBBG L0mBBB E(A0A8D 8A0A(B BBBH dmL=BBB B(A0A8D\ 8D0A(B BBBI  8D0A(B BBBC 4m$\ADF R FAD a DAB d nLBEE E(D0A8D  8D0A(B BBBG ] 8G0D(E BBBE Hn|BBB B(A0A8G` 8D0A(B BBBG \n(BEA A(G0 (C ABBI  (F ABBF V (C ABBB (4oQAG mAAA4`o\ BBD A(D0w(D ABBLo BBB A(A0DPXL`^XAPa 0D(A BBBD @o$ BBB D(A0D@P 0D(A BBBF ,p NL@p m BEB E(A0A8DF 8D0A(B BBBI Lp,BBB E(D0G8J5 8D0A(B BBBF HpNBEB E(A0A8Gpt 8A0A(B BBBK L,qmBBE E(D0C8D} 8A0A(B BBBH H|q$BEI I(D0D8Gpo 8D0A(B BBBD HqD'BEE B(A0C8J 8D0A(B BBBG $zRx , Pr|+dr+"4xr+IBDD T DBD WDBHr+BBB B(D0A8DP 8D0A(B BBBK r-Ls,BBE E(A0A8G 8A0A(B BBBD L`s|5fBBH B(H0C8J? 8D0A(B BBBA Hs:BBB B(A0C8Gpr 8D0A(B BBBF HsP>YBBB E(D0D8Fp 8D0A(B BBBH dHtdABBB B(A0A8D 8C0A(B BBBL  8A0A(B BBBE `tGBBB B(A0A8DP 8A0A(B BBBI F 8D0D(B BBBJ (uHAC DHc E @ulI TuhImA H (puIAC DHc E ,u0J3AC DGD A Lu@K(BBB B(A0A8G 8D0A(B BBBA (v PBDF j DBD 4HvPBAC { FBG DAB vQAm R r F (vQTBDD e DBK vQLAJvQwQ HwQBBB B(A0A8Dp 8D0A(B BBBH `wSBBB B(D0D8D`_ 8D0A(B BBBH X 8F0A(B BBBI X 8D0A(B BBBK ] 8F0A(B BBBL hNpYhA`$xV.BDD XDBL,xVBBB B(A0A8D 8D0A(B BBBB |x`[,TWHxx[BBB B(A0D8D` 8D0A(B BBBH (x]IBDD b DBF ( y]hBDA ]AB$8y4^7BDD fDBL`yL^BEB B(A0A8D  8D0A(B BBBH Hy_BGB B(D0A8DPB 8D0A(B BBBK LyaBBB B(A0A8D 8A0A(B BBBF LLz hBBB A(A0} (D BBBA L(A EBBlzhUAID a HAH k AAK D EAN _ CAM s DAH s KAI DCAH {iBBB E(A0A8DP 8D0A(B BBBC XX{tjBEB E(A0DPh 0D(B BBBI  0G(B BBBH H{kBBB B(A0A8DP 8D0A(B BBBH |Ll9FjH|pl"0|laD|l^Xf\|0mp|,m|(m5HK E \|Hm|TmD|`mKKB D(C0 (A BBBF p}nB(}Tn(<}`n|HHA gABHh}n BBB B(A0A8Gp 8A0A(B BBBE L}w1BBB B(A0A8Dd 8A0A(B BBBD ~~!D\L~BBB B(A0C8G1 8A0A(B BBBB Hl~/BEE B(D0D8D` 8D0A(B BBBA H~dBBB B(A0A8DP) 8D0A(B BBBD 8HD0} A  l 4hED0z A HPBBE B(D0D8Dp 8D0A(B BBBG p1BBE E(D0A8GN 8D0A(B BBBK T`BrTbAPRA H_ JlAJLjAW{B\d BBB B(A0A8J,I}H 8D0A(B BBBE 4Ā()BAD@ DBH h CBF H BBB B(A0A8G 8D0A(B BBBA 4HBHG } DBL D CBA GO A lGW J C A (āBDF@ DBA 4cLAD j DBO DCBG(0<VBAD v DBE GDBpiBU I H0LVBAD v DBE GDB(Ăx BAD@ DBB 0lVBAD v DBE GDB8$BBA A(D` (A ABBB L`\BBA A(D0 (D ABBA T (D DBBA 8PBBA A(DP (D ABBA LBEE D(D0G`}hEpbhA`a 0D(A BBBD L<08BBD A(D@f (D ABBD L (D DBBH H BEB E(A0D8G 8D0A(B BBBG \؄ BBB E(A0D8GrRTB: 8D0A(B BBBH \8BBB B(A0A8DrTTB 8A0A(B BBBK \dBBB B(A0A8DmWTB 8D0A(B BBBF XtBBB B(A0A8Dp]xWaxAp4 8D0A(B BBBK LT8 wBBB E(D0D8G 8D0A(B BBBB h(A Z  L Ȇ4*܆0*7\* X* T* ,P*APHT*+TV`l*!(t*qZCD HABDL* PEE D(K0r(A BBBFH08+6HBA  EEL  BBE <,,KAA  DBF AABA4l -BAA X ABA nAB- H-vBBB B(A0A8D`$ 8A0A(B BBBD .A.HH,0/BBB B(A0A8DP 8D0A(B BBBB \x0KDB E(A0A8DP8A0A(B BBBACPL؉1BED A(F0 (A ABBG  (A ABBH L(2KBE B(A0A8D@8A0A(B BBBAxD3APDH3iGBD A(D0{ (A ABBE P ܊p3AJr AB L3BBB B(A0A8G 8A0A(B BBBA Pl5D  A l5DS5O4$6BBA A(D0{(A ABBЋ|6YBV06BHA D0  AABA  7d47BIE B(A0A8G? 8A0A(B BBBL  8D0A(B BBBI :"A` :(T F  F ,܌=[BHG= DBD 0 0@BHH G0p  AABC $@|@7AHI bAA8h@HBE A(A0(A BBBL(ABBA C(G (A ABBJ  (E ABBM BB4HCBBE B(D0A8D` 8A0A(B BBBB LhEBBB B(A0A8G 8A0A(B BBBG I̎I6QeLJ.Ae`J>Qe؏JJ+l K!BBB D(C0G 0C(A BBBJ  0A(A BBBD K 0A(A BBBM pL-L L0LiJOG0JABCH08,MxBII A(H0S(A BBBpM6P0MBDA D0R  AABG |  AABH   AABH OAi N Y O @OBEA D0y  ABBF h  FBBN ,0P\AD0J AH  AJ `Q80\QOBBD A(D@t (D ABBF lpR!R0Q^RC,RxBHH F ABE ,S (S $SLR B H H ,S@STShS|SSTT̓ TF\TZDB R A8THAA N ABE B DBH 4< VADD W FAI Q AAE tW6W)W68 XBBA C(G (D ABBC HX BBB B(A0A8Dpj 8D0A(B BBBK 8Z'DT H F(XZAFDD nAAB(Z[GAG zAB4[xBAA U ABF RABd[ p[_Pf J XA< [qLBB A(D0[ (D BBBF `\|tO E T L (L]IBDF U LIJ p]|]\Ԗ]BLD A(K0 (A ABBF  (M ABBF D(D ABB4x_&DaL_UGt M \h_BBA A(D0 (M ABBJ  (A ABBA D(D ABBȗa(ܗa]ADG } AAE DaPa0\aQRdHa$\aYAAD PAA,a\EOE ABHbBBB B(A0A8GP 8A0A(B BBBI cXHcBEB B(A0A8G`f 8A0A(B BBBD H`LiBBE B(A0A8Dp 8D0A(B BBBH jPjRBB B(D0A8DP1 8A0A(B BBBL 08lBCD v DBK cDBHHltBBB B(A0A8GP 8A0A(B BBBH nAAj E P(o Ț$o Dܚ o`BBB A(A0X 0A(A BBBD $8p08DpBAA G{  AABF lpDhqFtq/A G (sG J W I w I At0$tBBA I  ABBJ 0,tYBBB B(D0A8G`vNJxvLw!D\w$wGW J E S Hx|BBB B(D0D8I 8A0A(B BBBC 0y(DDy#A8\zbBBD D(FPO (A ABBI 4{"M\P{Ae J F J a G o I | L G I L L L L I O L L L E  }1Gy H 4(GAD K AG n DF \ KE ` t؄O N g Q .Oq H n,̞ 6O[ N  I ` P L G \0AJD  DAA m AAA F AAA D AAE D AAE \jBn H xBn H $6AD f AA ,ЋbIN I DP P(N0MBDBHF  ABF D(a0K8B@J {AE48Aa N P !d(+TV|@CPU K FpCP^ B FLBBA D(G0 (A ABBF  (A ABBJ , RCD f ABF W<QPpTȏB p|[Mq R CELBBB B(D0A8Dp 8A0A(B BBBK ZBW,LqGDA ^ABC(0QGAG kDB8\ЗYGBA D(D0y(A ABBG@5BAD  ABB G DBC t DBA ܢ 8sGDA K ABF ACBJ8,0sGDA K ABF ACBJ8htsGDA K ABF ACBJ8sGDA K ABF ACBJ4kFDD A AAG DCAH(4aBAD VAB4DxBAA  ABB DAE8|BEA D(G0b (A ABBE 4DKDC DBHH  )FVx KEA G(G0 (F ABBF a (A ABBA E (A ABBE D (C ABBD i,rF H PHj A N̥4BDA sABHPBBB B(A0A8DP 8D0A(B BBBD LzBBB B(A0A8D( 8D0A(B BBBE LHBBB B(A0A8DU 8D0A(B BBBH HtBBB B(A0A8D`F 8D0A(B BBBG (BDA vJR(BDA JR`<<BBE B(D0D8DP 8D0A(B BBBI D 8G0A(B BBBL 8BEE D(D0{ (D BBBG 8ܩ@qBGE D(D0z (D BBBF \BEE D(A0z (I BBBF F (D BBBH r(D BBBx$ $ OBa M J F NpHBBA D(F0u (D ABBC D (D ABBK a (D ABBN z (D ABBM 8(įtBED A(G0M (D ABBG HdBEB E(A0A8G 8D0A(B BBBH $īȳHBHG pDB`BBB B(A0D8D`a 8D0A(B BBBI  8D0A(B BBBK dP,9KBB B(A0A8G` 8A0A(B BBBJ `A`4xBDA p DBK NHR4LxBDA p DBK NHRL(BJA D(D0T (A ABBA ` (C ABBH 8x$BEG A(D@ (D ABBG dBDE B(A0D8G 8A0A(B BBBI g 8A0A(B BBBG (lDHD WBB(HKBBD ~BBt{BBA D(G0~ (D ABBI @ (D DBBD d (D ABBC q (D ABBF { (D ABBD `BBE E(I0D8D@~ 8A0A(B BBBI d 8A0A(B BBBB H`lBGE E(A0A8Gp 8D0A(B BBBJ HBBB E(D0D8Gp 8D0A(B BBBH 0FBAD f DBE GDB,@<TBEF A(DP (D ABBH HBBB A(A0x (F BBBF C(D BBB!FO, zBGL Z ABA ,@\uBGL P ABH pBDn N ACL[ I FL KEA A(D0` (D ABBA D(C ABBALLKEA A(D0` (D ABBA D(C ABBALPKEA A(D0` (D ABBA D(C ABBALKEA A(D0` (D ABBA D(C ABBA8 cGDA I ABA ACBAH,@'BBB B(A0A8DPY 8D0A(B BBBD Hx$BBB B(A0A8D@ 8D0A(B BBBC HijBBB B(A0A8D@ 8D0A(B BBBF HLBBB B(A0A8D`Q 8D0A(B BBBD H\ EBBB B(A0A8D`1 8D0A(B BBBD $ HдeBBB B(A0A8DP 8D0A(B BBBA L@BBB B(D0A8DR 8A0A(B BBBC HlBBB B(A0A8Dp 8A0A(B BBBA H4%BEB B(A0A8I 8A0A(B BBBE !d4BBE B(A0A8F 8D0A(B BBBA [ 8A0A(B BBBF ,\BAD ` CBD 8IGI H(H0k(A BBB 78LBBD A(F@ (A ABBH <bA`X3l@I|NDDA` G ]̷@DTH)Ad(\LAAF x FAA @,BAD w DBD G DBK J DBH 0p (BAA GG  AABJ QK Y AJ lȸ[BBB A(J08K@8A0O (A BBBJ o (A BBBJ O (A BBBJ H8vBBE B(D0A8DP 8A0A(B BBBH 4ADD { AAJ Y AAE @zBBB D(A0F@W 0D(A BBBE .Di4 ,0&BcL@7`l(thACG V AAE @ BEB D(A0D@a 0D(A BBBB AD P CH L1BJB E(A0D8I` 8D0A(B BBBB X4ljBDA M ABI AFB08vBDG0u GBE WGBdػBEB E(A0C8D`: 8D0A(B BBBC O 8D0A(B BBBL d@BBBB E(A0A8GP& 8D0A(B BBBI x 8A0A(B BBBF .AlļDRܼDR(ADG AAH < BGB A(A0 (C BBBJ 0`< SBGD e GBM DDB$h 2BCD bDB( BAG0j DBF H BIB B(A0A8K@ 8A0A(B BBBJ P4 OBBB A(A0m (C BBBB | (D EBBF , IVH J ABD H HII H(H0 (A BBBD `(A BBBx LtBIB A(A0[ (A HBBI 6(C MBBhDQ8BHA ? ABC k ABB L@BIB B(A0A8G 8A0A(B BBBA  VKh E H(cBBB B(A0A8DP 8D0A(B BBBJ tDD@KPrxyArGAi F (KBGG  ABE H4BGB B(A0A8G` 8D0A(B BBBG HTBBB B(A0A8D`& 8A0A(B BBBB H\ BBB B(A0A8Dp 8A0A(B BBBG H&(BBB B(D0A8D@H 8D0A(B BBBJ 8'.0L']AHD e AAD WDD'hG[ @(\Eg D `H |(_Ea J XP0(OBAG o DBA DDB0(IM J H H H H p P H,L)IAA A ABA H| *ABBB B(A0A8G 8A0A(B BBBD $$-U[ H pH@-BHD M ABB ] ABP ACG048.bBAD z CBJ IFBht.7D` D N.7D_ E N0.qAAD C CAC YFA(/WBTH uAB(4/WBMH |AB(4h/WBTH uAB(`/WBTH uAB(/WBTH uAB(0WBTH uAB(80aBHA RAB(|0aBHA RAB(<0aBHA RAB(h1aBHA RAB`H1BBA A(D0? (C ABBG I (F ABBD @ (C ABBH 42BBA A(D0(A ABB80,3BAA # GBH z DBH `l5vBBB B(A0C8D@y 8E0A(B BBBI  8D0A(B BBBI d 8zBBB B(A0D8Dp 8D0A(B BBBC 7 8A0A(B BBBO $8$GBh F w Y Q`GDA K sP HRJM U ABG b HBD q HEJ i HEJ HXIBBB B(A0A8DPt 8A0A(B BBBD  ,Q 4(QH$Q \ QD C xQ\Au(R-\P(@RaKAD MAAA@RxBEE A(D0F@6 0D(A BBBH dU'BGB B(D0J8Gv 8D0A(B BBBK  8C0D(B BBBE HcBBB A(A0 (D EBBI \(C BBB\dA L Id;(e3Aq@ LemBBE A(A0D@ 0A(A BBBG dxfVAm B e(fHBA }BBg(g"Dg!`g,4xgBAD J ABD ^FB<gLAw P CH\gBBA D(D0O (D ABBK \(G DBB(Dh4BDF dAB`XhBHE B(D0A8D 8D0A(B BBBB {8D0D(B BBBH8jtBBE E(A0A8D`2 8D0A(B BBBE 8lFtl<lPIA H(F0l(A ABBF lnI^ I Z F ZAuHBBB E(D0A8Dp 8A0A(B BBBE <(DJH F Q G F J \DP` H FHh1BEB I(D0H8D`\ 8D0A(B BBBE HBBB B(A0A8DP} 8D0A(B BBBH \'D[ A F l/D^ F F@|,DgX ,lyBJJ J BBD $wA^ F g A |HBBE I(H0H8J 8A0A(B BBBE  8A0A(B BBBF  8C0A(B BBBF Dh(Xd~Al K e C ]L~BBB B(A0A8G` 8A0A(B BBBF L BBB I(H0C8GpG 8D0A(B BBBK $X$JDl P ILD$$BBE B(A0A8GU 8D0A(B BBBJ $h,BBFD oDB$,BBFD oDB, ,DKx, (,A]8D,+BBA G(I0o (A ABBF .pU A ~L/OQg H E|/XQ[ D g/AN A |$,0A_ H X H q G (0YDl H [LH0XBBB B(A0D8I8 8A0A(B BBBH 47XBAF Gp  AABD :rAD@e AE Lh;BBI E(D0C8FPq 8D0A(B BBBC D?Tlb\?[G2 A |0AAY F ] C (A~AH G D L ]B HAqBDE B(A0D8DP 8D0A(B BBBC d,0D BEE E(H0H8Gp 8D0A(B BBBG  8I0H(B BBBJ 8xPBEA A(J (D ABBC 0 RA] J S M N J a G FDRBDA k ABK R ABK oAEL@S)Dd(dXSpBFA aCBHSBBB B(A0A8DP 8D0A(B BBBC `pXBGB F(H0D8OP% 8A0A(B BBBM D8F0A(B BBBX@YBEE E(D0o (A ABBF t (D ABBF f(D IBB(PZ[BFA U BBA ZAv I AHZv BBB B(A0H8J 8A0A(B BBBD d4(h9 BBI B(H0D8Fs 8D0A(B BBBG } 8A0A(B BBBF Hq@BIE E(D0H8Jw 8D0A(B BBBA HsBBI E(D0C8Jn 8D0A(B BBBB d4vWBBB B(A0A8G  8A0A(B BBBE N 8F0A(B BBBF ,{AAD@x AAH \|BHE E(H0D8K 8D0A(B BBBG N}A$,0WBAD IDBThfHhăKBBB B(A0A8Dp 8A0A(B BBBJ HȈIBBB B(A0A8DP 8A0A(B BBBG H̋BBB B(A0A8Dp8 8D0A(B BBBE LAI0 AF 4pLADD R AAC y AAE Pԑ BEA A(D0 (D ABBG g (D DBBM  $DZ(JDE@ܒTHH\ DZt($LDBEE B(G0H8N 8D0A(B BBBI 6TaAW H $Ap G M K HmFE E \h4`Dd H o$tDd H ^ B j F 9X(BQA C(K0Y (D ABBL O (F ABBF J(A ABBH :BII I(H0C8K@ 8A0A(B BBBJ l[IQDشBBI B(A0F8K@8D0A(B BBBX`!KOE I(G0A8KP 8E0A(B BBBI hH(4 BJB B(D0C8K@ 8D0A(B BBBG HtBNE I(A0A8Kpt 8D0A(B BBBL 0yBAA G0c  AABA 0BAA D0l  AABH (=`<йiBBB B(A0A8D`p 8A0A(B BBBH  8C0A(B BBBJ Hܼ_BIB E(D0C8Fl 8D0A(B BBBH S@ 8A0A(B BBBA  8A0A(B BBBB  8A0D(B BBBA ddsBBB B(A0A8Gj 8A0A(B BBBK O 8A0A(B BBBG |̆8BDE B(D0D8F> 8A0A(B BBBA  8A0A(B BBBB  8A0D(B BBBA dBBB B(A0A8GR 8A0A(B BBBC w 8A0A(B BBBO PhvGEA A(D0c (G QBBO D(F ABBA0 P,vGBD A(D0e (G NBBH D(F ABBI$X h8T2BBB E(D0D8D 8D0A(B BBBK D 8J0A(B BBBE H(BBE E(A0A8Gp 8D0A(B BBBI L|BBB B(A0A8D 8D0A(B BBBE P@,BEE B(H0D8JO 8D0A(B BBBH 'LBBA A(D0 (A ABBD M (A ABBE Td(PKC G DBE  AEB  AEC pH P<'DdXBAA  DBA H AFI P AFI H0/LKF  DBC  ABG hH PBEE G(C0u (D BBBK d (D BBBB LLp,BBB A(A0_ (D BBBG l (A EBBB P(LAAD d AAD ,zBAA H ABA  CAd K R,0DTY C SL`+TVdx| iAQ0O AA دND0C A  $lAT0O AA 8 `tBEE A(D0X(D BBB8HJBEE A(D0n(D BBB(&BED QBBOt E |4,ACG B AAA GAAOt E D(<QDm G X\PpLHDToNTy30;,D` J   ܳ4D` E PldxxD` H  D` E 0;D` J L'BLB B(D0A8F 8D0A(B BBBG <lBBA D0_  ABBK  FBB<BDJF ABG  ABF }D@r A L 9BBB E(A0A8D 8D0A(B BBBB \Hp;HE&IA) F о{8<LAD e(M0E(A AABLпHBEB E(A0D8DP 8A0A(B BBBI LlBEB B(A0D8G 8D0A(B BBBE LBBB B(A0D8GAY 8D0A(B BBBA D @BAA  ABK | ABA GAB TE\ G Q G 8x>BBA C(L0l (D ABBG @dBBE D(A0L@z 0A(A BBBD @[BAA v ABC L ABA DAEL<0LBBD A(L@n (A ABBG  (A ABBE (0jBAK h DBD <t~BAF Q DBH } DBE DCB!FYA)FU(0<FS G OAHCH\BBB A(A0 (D BBBE L(A EBBHtBBB B(D0A8DP 8D0A(B BBBD `BEB B(D0A8DP[ 8D0A(B BBBD  8D0A(B BBBF HX tCBEB B(A0A8D`z 8D0A(B BBBH < xqGBA D(D0N(A ABBJ, AGAD mABD!!H(!BBB B(A0A8GP| 8D0A(B BBBF t!h0!pHBAD g GBI DAB! ! ! ! "| $"x/8"1NaA(T"IFDD hDAd"KBB B(D0A8D@M 8C0A(B BBBE a8F0A(B BBBHH"4bBEB A(A0y (D BBBB G(A EBB84#XBEA A(D0 (D ABBH p#|D#HBGB E(D0A8G@8D0A(B BBB\#BBB B(A0A8D@ 8F0A(B BBBI F8D0A(B BBBL,$`BBB B(A0D8JAV 8A0A(B BBBI 4|$gBAG x DBH PDB$Ap G SH$hBBB B(A0D8Dp 8D0A(B BBBC H %BBB E(D0A8G` 8D0A(B BBBK l%A G HL%0BBB E(D0D8DD 8D0A(B BBBH H%BBB B(A0A8Gp 8D0A(B BBBF P(&JDD Y KCG [ AAC D FAE DHA|&&\CL&BBB E(A0C8GV 8A0A(B BBBA &8H'DaBBB B(A0A8D`6 8D0A(B BBBA HT'hBGA F(D0t (D ABBG M(D DBBH'BBA A(D0W (F ABBL G(D ABBL' BEH B(H0F8F@K 8D0A(B BBBC L<(BBE B(A0D8G7 8D0A(B BBBE D(BAD w AED  ABF  ABE D(BAD w AED  ABF  ABE 4)PBDC G o  AABA LT)[BBJ H(D0A8G  8D0A(B BBBE ,)ADG0s AAG )HDLL)PBBB B(A0A8Dp< 8A0A(B BBBD T<*DC FBIv NCBAC K*h}D`d H 0*BDC G  DABA L*HBBB B(A0A8DQ 8A0A(B BBBG @4+BJB A(F0G 0D(A BBBA x+4 d+@ BBB B(A0A8GB 8A0A(B BBBC b 8C0A(B BBBE +x ,t ,p ED@4, [H, eGp I dh,D |, t8,L BBA D(GA (A ABBI @,BEE D(H0D@ 0D(A BBBA 0-lBAD D0  AABF LD-(BBE E(D0H8F` 8D0A(B BBBC ---,-W-8-4JAH(.hwACD@f AAA @.eT.(h.$yACD@h AAA .x1\T4.?BKA DP  AABD |.KFE B(D0D8G@C 8D0A(F BBBE D 8F0A(B BBBE G8E0A(E BBBA\d/3BBD D(D@ (G ABBH T (A ABBF V (A ABBA L/BBE E(D0D8IPI 8D0A(B BBBK D0eFIE E(D0H8G@n8A0A(B BBB\0@`R b b c c c abefhWihkmlnpTr\tu|vtxpBVCELH`PdTPhz 0z 8{ z y A|  ؏ ( x Р p X  P ( 0 p 0  @ P P p p    # ) x+ . / 0 4 (5 5 H8 ? @ D H pJ J 8Q S S @T T 0V 0\ ] p_ x` Pa h 0i R ȏ cՏ d e  fڏ i  l$ m6 nF pQ [ q e _ rz s t ͏ u v  x Ð 0 @4    Ș Ϙ ט an   b c) d @x O eE f;   g%{ @jr k  s 3x  Ai  @ub v ̚ ؚ ޚ 2 ~  o  x 1 1 1 y 1 hP1 1 1 2 2 2 2 hP@{ \ӓ t, WuDZ a B>1 `  e7 E@ TJ hR H [ r]  ] Wr kz m C n f xT b u t P H2  Ȍ pӓ v} `  ӌ xZ La tT 4X 8XǑ Wё Pۑ (W [ \ [  [ [  [  [ & [ / ,\B T L TU Q] pXf u ` ~ |Q xP D 0\ u xQ ʒ TՒ T |T 4\P T D W ' @0 T8 dI `1 \ X Fa Ty \  D h^ X |P X ͓ Zۓ u dX  * ++op5 .t q؊ oopooaoKD  E  0k P0 )7 ,7 /7 27 !N7 "G7 #57 $87 &;7 '?7 (>7 )B7 *F7 %J7 +M7 , -Q7 .:6 /n] 0K7 >H7 <T -\ {w }<7 ;*l (T )g |/h &T7 6 6 6 6 \7 2~ 6 _7 c7 j7 p7 v7 6 1 ; Ï \ {w }֚ y7 w |7 0 0 ] ] e^ P^ Po^ ] O^ |] pz^ ] ^ ] ^ [ h] ^ ^ ^ ^ ^ ^ ^ ^ P] P^ P\ X tz @0 pt ^ ^ ^ _ p6 @D_ r] +@)t t t $t ,t 3t ;t Ct Jt Qt Yt at it qt yt t t t t t t t t t t t t t t t t u u u !u *u 5u @u Ku Vu au lu wu u u u u u u u u u u u v v v 'v 2v =v Hv Sv ^v iv tv }v \ v O^    3] p  o^   ]a@_Paa`[`_0[]p]ZZY_P]] B H ## L g 05`2Hk 'u P%P2/u By @2hk Lu  02Ru \u  2eu  @2l ru 2yu ^ %1u u %1u  1 u %1u u %1u %1(l u U1Pl u U1l u Up1l `1u u P1l 6  @1u u %01m Y 10m  1v   1v  %0pm W @# %0v W $ %0)v ̑ % 0m y @. 0;v ; 0m i E %0@n Uv @H 0xn \v 0K %p0n 6 P `0av sv 0k %P0n i @0xv nz p 00ho \ 0o O p 0o v 0o v /v v  /v b  /v /v v /v -l /v v p /v h @ /0p b  p/w #w `/Xp *w p %P/0w Gw %@/Lw _7 0/p eU  /p c7 /p Ï /iw 2~ .q 6 .Xq j7 .q p7 .q |7 .r ; .(r |w .w w .w w p.w w `.w w P.`r w 0b @.w x ^ 0.x ۘ Y  .x 3x .r 9x .r ( -r @x , -s Hx 1 -(t Px Q -Xt Xx Q -t ?- \ l |     ̞  8  `  $ 0 < H T d t     ğ ԟ      , < H X d t  !h " #أ $ %@ &h ' ( )( *P + , -x -̠ - - . . / /, 0@ 1P 2` 3x 4 5 6 7ȡ 8 9 :إ ; <@ =p > ? @( [x \ \ ]8 ^h ^ _ ` {H { |Щ } } ~$      # -^ ' - 0 : L = T7 @ C P S ] ` p s w {           [      Gt ~ !ɛ "؛ # $ % & ' (# )5 *> +H ,N -U -\ -b -g .n . / /x 0g 1} 2 3 4 5 2 6 7 8 9 : ; < =ǜ >ٜ ? @ [ \ \# ]8 ^C ^U _` `m {x { | } } ~ ?GCC: (GNU) 11.1.0.shstrtab.interp.note.gnu.property.note.gnu.build-id.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.init.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.comment 88@&xx$9 Go1Q 55طYpp.taoaaRnopp}qq؊  ) * * 0 0   2` ` p0+++P D4E5 P@1 q 0qr