ELF@`@8@BBCCC-hAPJPJPJ$$CCCPtdxq=xq=xq=ܿܿQtdRtdCCC\\GNU9vL/=@h߇|rKqQ*AD@`D% @" DBP!2@"F,  P*Q8 @!! uBB@8H  B $$%(@@@@BPB   PZXj@-#*Т@ 0E0 P @2!j$@Ā0"X  4 B@0$D &xd2Bf 8I30@@  QDP0͎BC#Xp@#@-D0 ! #I ."A@"R(BPB1   JC0PR *",@!@@ @H  "@!PJ AA@CpĀ H@ P 2h (4*MS"A $@i@AJDqT -@@@"$xB0P(H0  " bqD&)Ȁ0PqFT@A (@ @B@2bbL @@$`P "`b("@H@! UH2" !( *H2@ Ę@ P0)#XDAȄ4 I"d B0D@C!!@@@@ !2"! "@'CLH  BBh( &@ 0 ($ED r8M#XhPH  2(/PIgabaz @"aB5!$! I@$PD  0$Bld 8h Q ( C@8 @ D 'PP$8 J,@!ȑHQA@"  `B@aB RX@! @  " %Q BH!@)*@ D@Q @! `Ph &)`H@(F $@" @ (! ` h, @@F":0@VB Q B@B:@ R@JBA  0H0$!D(Pp: 8(@$*"PBB $ ! 0P $&#ÊЈ4BH"DMD@@  D@P@ @H ,0@@p@ (0i B(DR*@ ܬ@J$J!P!@iA8  B @@i@£Afqrtxz|   #%'()*+012367;=>?BEFGIMQRSVZ[\]bdeikmnoqrtuvwz{    #()*+,/23479:;=?ACFGHIKMOQSVY[\]^abcefghimpruwz}~    !%*+,/1589:;<>?BCFGHJKLMOTUVW\]`bdfijmpsvy{|   %).3567:?@CDEIJKLMOPQRSTUVWZ\aefghnopvw|~ !"#'()+,./1467:>@BCDHIKLQVXY[^acdefgklmostuvwz}   !"$%&)*+,/23678:=?@ABCDGJMPQTUY[]_`bceimnprswxy{|}   #$%&'()*+8(.I)FZguh #D[țW?H vy屌C.bPСO^$V t`8ms%8$rf=T?bD_j_# ].VKxd}bm2b`5Nc*dysˁ8i?,BdhIdWkm{֧lwW4D0g,q}5d;L'gV,w^Xӿ@r{΁Y=PGӁVxD)ھw}+>o(Ǡ#,U>wԡ$jXn ( ha2O@R 06ΛhsZ ΏDgIAAm`,5 %zH7#qBڌrXW JBa ~*=)ݕaRia&iĻJuhl[Pb8vv.'V q2/rIӦmڰ>`Nh6?W@txB^V$( r}Ю4H>C{͜P5bKmFrao9UNgL!}02 x]ۼͱ;1ʵ˘R^m<+peH:2P꒑s/w<X%kТ(t^Y@?R4өApZ-[C cW"Cyóh}dtEr/y"#/8 ߤ GOG"V*j9a8~!|COp $ D@ GVO ӏ/#a%ziQLcߺ6Nc ,z.keTpo,hK9Ncy(UJ5 Z}$4g}uR=NcG3UI}FEreQ~=iNI<~Ej( m@rK4cg/ #޻dWq2y¾k֜sI7߷}ЌI攀+#De9]LǺ^.cD㤘7Lf'#5?Ǣ&h3p9(*^PpUȻ u,*h*mRXna΀* 8n]-ϋ0-wm*HubK?lb1 Hmڨ@Ƒ1R*TԈ+|X>(zFT}%Ȓ,s&CTr3ԥ”:o).[V]<˜EM[ڬ`5ԟܚɁ< ٍ^C=B# dۙ]G쯺NΧWȺo_6Ғ9 >7mZ$N)Q<۶1jں9)Y.,F7 p?Y̨j+}~B@Ic6W"Y~*\aUFō; <@cՍcuuao=L\҃塓F]Ī 3MDh6q6Q:ILZLe7j:ڀYSQmm9/OpfС'.m] -e"@y(YGᵇ}2!/UR1Z}5 d$˾"Vs(ήP9ƨK:dqwˎ T<4\P{Q;;.w[_ҮnӀdȄ3(4\e96ь蔸 "23Btn#a 'Bp' Vm {L_Cij݁Q*4^qv$'9}Kj]C ru(N驉Wwm;2VJ9 8f)Q2mT4svnr 'ny`W~;D}O] ڔFNX UIĀ_all5RRz!jFU ,Q `p>`-GiwݳԃQ!j#goPI 2 f,ʋ!["[(u9 bSYW͘VEb(& 'GbmMo3Y7/Y$i:=I;^s /-M=q1v- 'ׅ_78M Vzy( `GaPN ѷ̈́_mdkTc?炌6O~(-z I` a?'|Zd?ICX%}fޘ\fuM~ǥJ=h]IG&&Un`*P;̘/Pݐ}<~ YmUO%#u_Kk0O^p™3 d`P\"!p5cLXr,@:Q|xꫳiєd5xV.:ԞpރZϲbN81*butx7s=Ho:WH$L fueDo]ɍ;)hg -,V~0Alۂ<#gѿĐSÕ\$:恡#f>ͮV8V}`/ӜÁыXgQbJKufRŃ$ ZNځϜeW5̊4hݣ`s jYZ"H)R07쇠ߣqr5C||T{>)sQ@FFga?%ecN8pc J.Itz+M"pX(6 T<ix@z&>O1^#o$pꯌ, z)V]~ܪga&+pj$(tt?^)wgIq&i0T ]I~"#=1#g8nu"?^1'q t&ق9/6ou410!zràbveiK+hsZ`vB`1TlIu®Աz)XOƉ Ky W]4Dr }_oUGר D)+W0Cʎ'.IE3,qS>6׸x%clX5nj=F1y 4l\C %~GCkhYVflC2஌k+y{-'@^V:|kAC^\f|WUĚB5Mяt63f*<QAC[oШU[9B]̒,Z(kNJL6NZx*RrI8~Lϲcs#5+ᰀ([H(ȂBźZZVy8P#Qui2z3yU?r@,[],좦 H$ZmB* }ۮ3i D훗5۹<8Z:<;NfD=1nkXDYqvAӍn@];N֋'Es&$?% Su]+\dȬ%d#'L7WQ~T#@ %HOM sv2z&RVm])?uj׍缥4VJm8kH4|nXqj(n΅snBEcꗪ7A'ԂWؽ Y"I$c26ZF^XUǧY\罏 vjjgGlwH#%%lX$SYSl+-g/oP-%KE+dWAZ:/SeESjO.\ul3sΗ X.YlČ?+0rZ"$sarx W؝uyy*J"=z>G锛d{e*M1Zxj>6Km]M5H :[Hc\zOw %EOs:hɷ4I&8hr_hW6$Uqq{8b0YB>+`Q0w*#f}TQS*5_a/d0wN>G1f]>!xqF1Qj=g:UX,A" Kfwu&xD'\`{o!5>ukaJj4.WIÙKfѶ(N*BwKfA=?|k XϦ+Z_"%QCyޢ" GƒyFL QGM e^;65Yl&1j mN{x _tg=NMX3КqG<.gk;/NO2P,̖ܗgq 8 Kg=J68q{+߃D<D ):\ӉSƉlƆry|q݉ Ygy85C [<4K 1@f  A)^Nb =4f0tw+9‹>0X]6 AA48;Gf#0wGj:K1rA*JM$4F"BRLKvz^L )w~XXp^B:3OJ/, .41e[W'J4K 4_>m^ 6;?05lYl l;~PTj+J.-3E FyPU74I<?)D(KMRCXW +JE+ԉ_v*J@\N1‚.H6=1';3ZM@ <d* ;5+&0?P ː]*e  3D 3 WK ;C4<~͇{m5~XY=]%9W(.J)U41\=sXLփ 4ZJ.>DقX *.J]t"wޏ]rtW*NLq+;*#9U<bц/ `( @#(Z#h@Y= T*A ;," Pz! j P} |\@`n LR (VO   %PU Y !` - dTi& d&P`  $t* `&TX) 4&8y`@Ys, `!9 0)$ >< vY ri @> *1 i" 2 ( d <D| ,H@Y<p`a lt) /!9UW4 (\?  PL 4 (4 (;9 )w }G /. X mU h4{1 `(Ki 8]  k 0# 9Z ssZ s $Xow dHw Lf bl $ Y 0s0 @ +wm dC - +"tWMh L| `tWeF -)8*-S tX  #`t 8{ |;z $(@ P+djt _(; )*V p%q ̣: 9P@YY І#ttA "l' $! #pe |W2I dsE -|2 p(v  ? D -2 T($ `#DqS X HA tZ.<' &0# z D, `'$ [ \< @"HO e  d? y WT ] Hb l D[q }H8@YjH % @ lZ u'M \Y xrq! %U hjHX PT.  eL 2A `,K  B #8 %4+0 T&(@0: )`M >{ P9i x8# 0_N  _h`$ , i (D T\p 4y< dE  8 W0s tx~ }\(  7@ +, v$E 4-$)} `Wt ({/` i $/T ]_ H) :!X p #Dzv xdW=YU`BXm @Y HY tr5 #d $ p$Mn ' &| i ~ Ĝ#P $Hh  p/ Vy@rW w 2" %L1 n(hrf kp $p,FJ 7{ n <- p'hj @WA> *l" `Wn ( &6 "( PYef PkZ uR W<t q[ #x @{ p `) &S~ @X} t6 " SW h9؍W)PW t~H`  (q| ؿ8 p) n@Ye L" %d ;? P+` h4# pr (X`s W 4$<oYF $$ ?W  5 @{"LM8aW @sxm + .'HG /.h Bj 1 R(N }# v ,Ut HLPl ne S,pu Dl P_W@ ,$q y@q[ T8/(?Y @ 0+< PvT`F #i `@K 84= ,F w#Y `s l x <, !J 6c1 @`(\8 @)@ dw T[ th  )c @ @ ̷x `$g Ԉ 4 ( f `u  $~ hYk  le `O WA p(VW p> p*E -?3 p"^ LdyN `$x p$ m D`I :.> $`Y q8o ^$ 0N ; #<^ lw @#^ V8?Y dPJ |6Pg H * e @T\3 v" @~Xb P) .!X7D -HZ z L+?Yz \W. P' @#4ci 8] <  |Dr~ B( `We UG- 'fh Ȓ8P`] ^ bw |vتYV l' t !4 #oQ QC% ` 6 g)'{ Ģf $ dr $3@ +H2 (- 'x:u 8c p^ #L  @Yj^  o @`} U HjU@@YO \P 8@) $& JW 89 }V kZ < L*B ,d#G *.` tc W*h Б|BO Ll0 P;(: WM  B ,k 0 Ԥ# $M _ A7 "5 P%&04Y qx-9Y| x+ &'x 5( -D'i  [ ((`  WDk Ds \L 4 T%0 D#LZk l(W _ `0 $?(<ja $WI5 )x5r Xa5 )l & [&d! %4- $ ` Tk V l  WR `W$/ h DQ RC& g P$@5 (T; t3*E -h ܡL, # Ҏ 3H pF%T/q 8z@~ سD  0:$Z t@ +|r S H\w 4} \%    $O"W;1 ^(`0 $({``A G,t7g ]| (sn <xs% t =T ]7 ԏ)e @$ i `T aLT X`y_ D8 )n te #,O' |&g tU DbU> * f _,- "peR UP4 6!@=. ' x `(oL  Y ؖ i a  ?YN mq d~4s E @9 @Y> `* #sD --d ; :YG! o f ,_M `tp cH8 T) 3| Ⱥ)Q Ip| l< E*p 8V 0x#( u L`d= q*O@ 4+ W e tKn P4ەPGW ) { ̮dII D9.T=  Q 0RT2L = *<O 0!  0%O_ \| YT |aHNU h a xS Xt; 7* P4P #Q ST[ #z l $@r , 1 $8 p)8j d@ ,>= dn* 7 -b k ' Ps&P+ !.  `J o $9v Tr+ P"'$H x E~ lF@6/ @(w   Xx~ 0$Ȋ EX Lnl H |{. 'j& d&}[ 4v 8 A P W t$ @ P PVc x@\ 84O Yx& m&T  : *4xWF, C't Y1 k"fr X4L  dD Z ds I ;.pur (<  4 ` $+ '4 pc @HL * & 0W s @$Tx X@h#, $!f hl3  09! P%LbK Xa | D#O 40uU h =L 4k* 0&, Wb Dxi @ 8Yb ,D_Yw ,P w,bB Pa,^ <: $%* _ <8= Di*T L}HY-6 "w 4- <l p^ 9%$œ j L5 b)X p=H  P\"iO T ? +YU j-t`UR S? +0f_ Pj P ,v ,a H C4Q L9XV 8l< O*@7 q)Xk S p8"5 `(xT 4aH* &:B `V,t' &Ly ? *J `L.n @# \L$ pX n$\ l8+ & =W PlH dDu xAU |h 8WQ, D!? ~ DT| 0k (` 8057 `r)dD p-B 0S,A <,?d ,Y& @ @~(@`#R \S4x 8NK `Pw > - 0'p4 (N $x# j{ HTa DDa7WW xm pM 4LC y,{ t̒ HNT ]N  > `*q nB n,l @d9pwWB :*9WR W,,8 )Li   "/ ( 8=  P,\ 4d[ , ! %x |P8 T)xn `ZW #4x BB ĭ, Tx`x Dp Pp4=[ \ PAj g !# r Lg  `(4~ HH% ; A*`.X 'xn 8`zd 0p $ ' &>`do t.6 T! %<R HX @M # @  2F -h $g J0 '( 4W pmL ] T 7e L8FF -T I .ld`c  0`S 8\%1 S(6 `k)p\ 8k8 )8pI :. @o cx E w pPxF 4-+ T*'Es 7 $p[ 0. 'z ̞(8t@W" % o LD T(-b V l 3 Л(P 0Wm 4Kw 4( $xTQ XK @ p 'Z s,m 7 )Xk] 40 @R(`u < ~ <*x  #D8WY0 T'(T3 (*( (!~ 6x # Z6 P"(ʑ p  ydj k t( 4  "(S \ O C? +c @@"$ c)4,8YUd l H~? +dP #Pn4 d(WH P0.x PAQ  *Sl " p&L F$ "&x0 `;(<% G&pk @o -|G /.Ld $1`g/ $(TCq }H+`W. @"~e T, > "(H # #` `64w  M R: " y )H *`~ C >p@Y Pr H ]W^9W $( $D& p&4H '1 Pk(U h NL @Y9( &d3H |#`Nr ; hy E A ,T= *,oz@9Y5 c)) `H!@y F@  # #(; =*T _  $,{0@Y[z LW @lcWn <l| Tw @WS `XK4 @(,+ '  %0 @1 b(= s*pP ]  XW& Pq&6 Є"X p$ :e! %0 L( $#hn lL 0${8 4) .y hIXB t: * (Dp xt \x PW0 >(."yWЪY_U h  |v #U {.= $b*1 d @  5 V) > $ Y r 0W@\WI ;.(<   2hK  V  \ p  x- # w + !r7 z)4 @2 p( $Xq` V D \t hr7 )f }dw T$h `1 CM C ,<Z xWBq y# G /.)& `&>' w&s lv @] ?Y" $t mL} | >pW. 0"PO H _ ``[ 0G x? T+f X$ۑ |y pZ._ <s h, '1] \D\ (W $# F \ ,k 0V.9_ t ps`mW-f X` AW&A 4,LF - ?c 8@? lTL!$ E TR#Pc @c2 (  t (d \h@ "pd =tT{ Tz L@]? +x! o  $`l# pv pkdx W 64 D|E -pKE K#Y 8`@ X@Yf (  : )0% $-j D=: )tK 0. A2 (l" L 4.   JW_ TPPy R $  $ M D$m b(D (#; d@*l o |2(j $ T  e xV] P 0oc @} ! | Ĺ$ #- "D -9 ) ^@Y; \do? 0+$fm L] $Q Hh8YN 4J . ($ԁ TH# u 0 ]"% )p @$</! @k <3 (# 0 z"pWp> *-W 0`t y OX'WH 1.S |]  t#* б!lXYm 0hr Wxr h m PZ T F   >n (9R S  `=C @,c 0] | C(a }k  _ 4 | [ <__gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalize_Py_trampoline_func_start_Py_trampoline_func_endPy_BytesMain__stack_chk_guard__stack_chk_failPyConfig_InitIsolatedConfig_PyConfig_InitCompatConfigmemset_PyRuntime_Initialize_PyRuntimePyConfig_SetBytesArgv_PyRuntimeState_InitmemcpyPyConfig_SetString_PyMem_SetDefaultAllocator_Py_PreInitializeFromConfigPyThread_allocate_locksem_initperrorPyThread_init_threadpthread_condattr_initpthread_condattr_setclockPyMem_RawMallocPyMem_SetAllocatorPyThread_tss_createpthread_key_createPyPreConfig_InitPythonConfig_PyPreConfig_InitCompatConfigPyThread_get_thread_identpthread_self_Py_PreInitializeFromPyArgvsetlocalePy_IsolatedFlagPy_IgnoreEnvironmentFlagPy_UTF8Modestrcmpwcschrwcscmp_PyMem_RawStrdupstrlen_Py_SetLocaleFromEnv_Py_ResetForceASCII_PyArgv_AsWstrListPy_DecodeLocale_Py_DecodeLocaleExnl_langinfombrtowcmbstowcs_PyWideStringList_Clear_Py_get_xoptionwcsncmpwcslenPyMem_RawFree_Py_GetEnvgetenv_Py_ctype_table_Py_ctype_tolowerstderrfwrite_PyMem_RawWcsdupPyStatus_Exception_Py_LegacyLocaleDetectedPy_InitializeFromConfig_Py_HashSecretPyImport_InittabPyConfig_InitPythonConfigPyConfig_Clear_PyWideStringList_Copy__errno_locationstrchrPy_NoUserSiteDirectoryPy_BytesWarningFlagPy_InspectFlagPy_InteractiveFlagPy_OptimizeFlagPy_DebugFlagPy_VerboseFlagPy_QuietFlagPy_FrozenFlagPy_UnbufferedStdioFlagPy_NoSiteFlagPy_DontWriteBytecodeFlagwcstokstdoutPyConfig_Read_PyWideStringList_ExtendPyThread_acquire_lockPyThread_acquire_lock_timedsem_trywaitsem_waitsem_clockwait_PyTime_FromNanoseconds_PyTime_GetMonotonicClockclock_gettimePyExc_OverflowError_PyTime_Add_Py_wgetcwdwcsncpy_PyTime_AsTimespec_clampPyThread_release_locksem_postPyWideStringList_InsertmemmovePyMem_RawRealloc_Py_GetForceASCII_Py_GetLocaleEncodingPyCode_Type_Py_NoneStructPy_HashRandomizationFlagstdinsetvbuf_Py_get_env_flagPy_GetBuildInfoPyOS_snprintfPyOS_vsnprintfPy_GetCompilergetrandomPyExc_OSErrorPyExc_ValueErrorfstat64PyExc_NotImplementedErrorPyExc_RuntimeError_Py_IsLocaleCoercionTargetPyStatus_Ok_PyInterpreterState_EnablePyInterpreterState_New_PyThreadState_NewPyMem_RawCalloccalloc_PyThreadState_BindPyThread_get_thread_native_idsyscallPyThread_tss_getpthread_getspecificPyThread_tss_setpthread_setspecificpthread_cond_destroypthread_mutex_destroypthread_mutex_initpthread_cond_initpthread_mutex_lockpthread_cond_signalpthread_mutex_unlockpthread_cond_timedwaitPyExc_MemoryErrorPyContextToken_TypePyExc_DeprecationWarningPyExc_PendingDeprecationWarningPyExc_ImportWarningPyExc_ResourceWarningfilenoPyFrozenSet_Type_Py_EllipsisObject_Py_NotImplementedStruct_Py_FalseStruct_Py_TrueStructPyBool_TypePyMemoryView_TypePyByteArray_TypePyBytes_TypePyClassMethod_TypePyComplex_TypePyDict_TypePyEnum_TypePyFilter_TypePyFloat_TypePyProperty_TypePyLong_TypePyList_TypePyMap_TypePyBaseObject_TypePyRange_TypePyReversed_TypePySet_TypePySlice_TypePyStaticMethod_TypePyUnicode_TypePySuper_TypePyTuple_TypePyType_TypePyZip_TypePyExc_ExceptionPyExc_BaseExceptionGroupPyExc_EnvironmentErrorPyExc_IOError_Py_hashtable_new_fullPyMem_FreePyMem_Malloc_Py_hashtable_compare_direct_Py_hashtable_hash_ptr_Py_hashtable_get_Py_HashBytes_Py_hashtable_setPyList_New_PyObject_GC_NewPyObject_MallocPy_GETENVmmap64_Py_NewReferencePyDict_NewPyWrapperDescr_TypePyObject_HashNotImplementedPyExc_BaseExceptionPyObject_FreePyObject_GC_DelPyExc_SystemErrorPyExc_ImportErrorPyExc_NameErrorPyExc_StopIterationPyExc_SyntaxErrorPyExc_UnicodeDecodeErrorPyExc_UnicodeEncodeErrorPyExc_AttributeErrorPyExc_TypeErrorPyTuple_New_PyUnicode_InternImmortalPyMem_Calloc_PyUnicode_InternMortalPySequence_TuplePyList_AsTuple_PyObject_GC_NewVar_Py_DeallocPyObject_GC_UnTrack_PyTrash_cond_PyThreadState_UncheckedGet_PyTrash_begin_PyTrash_endPyType_IsSubtypePyDict_ContainsPyCMethod_NewPyCMethod_TypePyCFunction_TypePyDict_SetItemPyObject_IS_GCPyDescr_NewWrapperPyType_GenericAllocPyUnicode_InternFromStringPyUnicode_FromString_PyBytesWriter_DeallocPyUnicode_NewPyDescr_NewMethodPyMethodDescr_TypePyDict_SetDefaultPyDescr_NewClassMethodPyClassMethodDescr_TypePyDescr_NewGetSetPyGetSetDescr_TypestrrchrstrncmpPyTuple_PackPyDescr_NewMemberPyMemberDescr_TypePyLong_FromVoidPtrPyLong_FromUnsignedLong_PyLong_NewPyWeakref_NewRef_PyWeakref_RefType_PyWeakref_ProxyType_PyWeakref_CallableProxyTypePyObject_GC_TrackPyObject_HashPyStaticMethod_NewPyType_FromSpec_PyType_CalculateMetaclassPyType_ReadyPyType_ModifiedPyUnicode_FromStringAndSizePyErr_OccurredPyObject_GetItemData_PyType_GetDictPyLong_FromSsize_tPyDict_SetItemString_PyTuple_ResizePyExc_BlockingIOErrorPyExc_BrokenPipeErrorPyExc_ChildProcessErrorPyExc_ConnectionAbortedErrorPyExc_ConnectionRefusedErrorPyExc_ConnectionResetErrorPyExc_FileExistsErrorPyExc_FileNotFoundErrorPyExc_IsADirectoryErrorPyExc_NotADirectoryErrorPyExc_InterruptedErrorPyExc_PermissionErrorPyExc_ProcessLookupErrorPyExc_TimeoutErrorPyLong_FromLong_PyModule_CreateInitializedPyModuleDef_InitPyModuleDef_TypePyExc_RuntimeWarningPyModule_NewPyModule_NewObjectPyModule_TypePyModule_AddFunctionsPyModule_GetNameObjectPyObject_SetAttrStringPyObject_SetAttrPyObject_GenericSetAttr_PyObject_GenericSetAttrWithDictPyExc_KeyError_PyType_Lookup_PyDict_GetItem_KnownHashPyModule_SetDocStringPyModule_GetDictPyDict_CopyPyFile_NewStdPrinterPyStdPrinter_Type_PyObject_NewPyMapping_GetItemStringPyObject_GetItemPyExc_IndexErrorPy_GetVersion_Py_gitversion_Py_gitidentifierPy_BuildValuePy_GetCopyrightPy_GetPlatformPyFloat_GetInfoPyStructSequence_NewPyLong_AsSsize_tPyFloat_FromDoublePyLong_GetInfoPyHash_GetFuncDefPyList_AppendPyMem_ReallocPyList_SortPyObject_CallFunction_Py_VaBuildStackPyObject_GetIter_PyObject_NextNotImplementedPyTupleIter_TypePyIter_Next_Py_CheckFunctionResult_PyNamespace_New_PyNamespace_TypePyDict_Update_PyInterpreterState_GetConfigPyBool_FromLongPyThread_GetInfoconfstrPyUnicode_DecodeFSDefaultAndSizePyUnicode_FromWideChar_PyImport_FixupBuiltinPyObject_SetItemPyModule_GetDefPyList_SetItemPyUnicode_CompareWithASCIIStringstrncpyPyUnicode_AsUTF8AndSizePyDict_GetItem_PyUnicode_FromASCIIPyBytes_FromStringAndSize_PyCode_New_Py_GetConfig_PyObject_NewVarPyErr_NewException_PyObject_MakeTpCallPyCell_TypePyFunction_TypePyObject_GenericGetAttrPyArg_ParseTuple_PyByteArray_empty_stringPyInterpreterState_Get_PyDict_Next_PyObject_LookupSpecial_PyObject_FastCallPyObject_GetAttrPyObject_VectorcallDict_PyObject_FastCallDictTstate_PyDict_GetItemStringWithError_Py_fstat_noraisePy_CompileStringExFlagsPyUnicode_DecodeFSDefaultPy_CompileStringObjectPyExc_RecursionError_PyArena_NewPySys_AuditPyImport_ImportFrozenModulePyImport_ImportFrozenModuleObject_PyImport_FrozenBootstrapPyImport_FrozenModules_PyImport_FrozenStdlib_PyImport_FrozenTest__ctype_tolower_locPyUnicode_AsUTF8PyExc_IndentationErrorPyMarshal_ReadObjectFromStringPyExc_EOFErrorfreadPyEval_GetBuiltinsPyUnicode_FromKindAndDataPyExc_TabErrorPyExc_KeyboardInterrupt_PyCode_ValidatePyEval_EvalCode__ctype_b_locstrcpy_PyFunction_Vectorcall_PyArena_AddPyObjectPyBytes_AsString_PyEval_EvalFrameDefaultPyGen_TypePyListIter_TypePyRangeIter_TypePyCoro_TypePyObject_ReprPyObject_ASCIIPyMethod_TypePyObject_StrPyCFunction_CallPyAsyncGen_TypePyExc_StopAsyncIterationPyExc_AssertionErrorPyExc_UnboundLocalErrorPyUnicode_DecodeUTF8_PyArena_Malloc_PyToken_TwoChars_PyUnicode_IsPrintable_PyToken_OneCharstrpbrksprintfPyUnicode_DecodeUTF8Stateful_PyTuple_MaybeUntrackPyFunction_NewPyFunction_NewWithQualNamePyTuple_SizePyTuple_GetItem_PyDict_GetItemWithErrorPyObject_Vectorcall_PyObject_LookupAttrPyDescr_IsDataPyMapping_CheckPyDict_DelItem_PyDict_DelItem_KnownHashPyType_GenericNew_PyObject_GenericGetAttrWithDictPyMember_GetOnePyObject_TypePyObject_CallFunctionObjArgsPyArg_UnpackTuple_PyArg_CheckPositionalPyCell_NewPyMember_SetOne_PyToken_ThreeCharsPyObject_GenericGetDict_PyObject_GetMethodPyExc_SyntaxWarningPyNumber_AddPyUnicode_ConcatPyOS_strtolPyOS_strtoul_PyLong_DigitValue_PyUnicode_DecodeUnicodeEscapeInternalPyExc_UnicodeError_PyUnicodeWriter_PrepareInternalPyImport_AddModulePyImport_AddModuleObject_PyUnicodeWriter_FinishPyWeakref_GetObjectPyObject_Realloc_Py_NewReferenceNoTotal_PyUnicode_EqualToASCIIStringPyInit__impPyModule_FromDefAndSpec2PyObject_GetAttrStringPyModule_GetStatePyModule_ExecDefPyModule_GetNamePyModule_AddObjectRef_PyImport_SetModuleStringPyMapping_SetItemStringPyCallable_CheckPyDictItems_Type_PyDictView_NewPyDictIterItem_TypePyDictRevIterItem_TypePyDictRevIterKey_TypePyDictRevIterValue_Type_PyBytes_DecodeEscape_PyBytesWriter_Prepare_PyBytesWriter_FinishPyBytes_FromStringPyBytes_ConcatPyObject_IsInstancePyObject_GetBufferPySequence_ContainsPyBuffer_FillInfoPyExc_BufferErrorPyBuffer_ReleasePyObject_RichCompareBoolPyObject_RichCompare_Py_SwappedOpPyUnicode_RichComparePyUnicode_FromFormatV_PyUnicodeWriter_WriteASCIIString_PyUnicodeWriter_WriteStr_PyErr_SetObjectPyObject_CallOneArg_PyArg_ParseTupleAndKeywords_SizeTPyException_GetTraceback_PyErr_RestorePyTraceBack_Type_PyErr_ExceptionMatchesPyErr_GivenExceptionMatchesPyErr_GetRaisedExceptionPyErr_SetRaisedException_PyModuleSpec_IsInitializingPyFrame_TypePyTraceBack_Here_PyTraceBack_FromFramePyException_SetTracebackPyObject_IsTrue_PyStack_AsDict_PyObject_Call_PrependPyUnicode_RPartitionPyNumber_AsSsize_t_PyNumber_Index_PyAST_CompilePyMethod_New_PyDict_PopPyArg_ValidateKeywordArguments_PyDict_HasOnlyStringKeys_PyUnicodeWriter_Init_PyDict_MergeEx_PyObject_CallPyInit__threadPyModule_AddType_PyType_NamePyType_FromModuleAndSpec_PyStructSequence_NewTypePyLong_AsLongPyType_FromSpecWithBasesPyLong_AsLongAndOverflow_PyTime_AsSecondsDouble_PyModule_Add_PyWarnings_InitPyUnicode_FromFormatPyInit__weakrefPyModule_AddObjectPyList_SetSlicePyUnicode_IsIdentifier_PyUnicode_ScanIdentifierPySet_New_PyUnicode_IsXidStartPySet_Add_PyUnicode_IsXidContinuePySet_Discard_PyUnicode_EqualPySet_ContainsPyCell_SetPyNumber_InPlaceOrgetauxvalPy_FileSystemDefaultEncodingPy_HasFileSystemDefaultEncodingPy_FileSystemDefaultEncodeErrors_Py_HasFileSystemDefaultEncodeErrors_PyConfig_AsDict_PyWideStringList_AsListPySetIter_TypePyObject_CallocPySymtable_Lookupunsetenv_PyLong_NumBitsPyList_SizePyLong_AsSize_tPyObject_FormatPyNumber_LshiftPyDict_Keys_PyErr_CheckSignalsTstatePyNumber_Subtract_PyUnicode_JoinArrayPyUnicode_ContainsPyUnicode_AsWideCharString_Py_normpathPyNumber_NegativePyUnicode_FindCharmemrchrPyUnicode_Substringwcscpyfclose_Py_wfopenwcstombsfopen64PyFrozenSet_NewPyErr_SetFromErrno_PyCode_ConstantKeyPyErr_SetFromErrnoWithFilenameObjectsstrerrorPyUnicode_DecodeLocale_Py_GetErrorHandlerPyObject_IsSubclassPyException_GetContextPyException_SetContextPyNumber_Invertwcsrchr_Py_wreadlinkPyNumber_InPlaceAddPyCapsule_NewPyCapsule_Type_PyList_ExtendPySequence_Fastioctlfcntl64_Py_DecodeUTF8_surrogateescape_Py_DecodeUTF8ExPyCapsule_GetPointerPyObject_SelfIterPyUnicode_AppendPySet_SizePyObject_CallFinalizerFromDeallocPyObject_CallFinalizer_PyGen_FinalizePyExc_GeneratorExit_PyErr_ChainStackItem_PyConfig_FromDict_PyLong_AsIntPyLong_AsUnsignedLongPyImport_ImportModuleLevelObjectPySys_GetObjectPyObject_CallMethodObjArgs_PyImport_AcquireLock_PyTime_FromMicrosecondsClamp_PyErr_SetKeyErrorPyCompile_OpcodeStackEffectWithJump_PyImport_ReleaseLockPyTuple_GetSlicePyWrapper_New_PyMethodWrapper_Type_PyTime_FromSeconds_PyBytes_ResizePyArg_ParseTupleAndKeywords_PyTime_AsMicroseconds_Py_HashPointerPyObject_ClearWeakRefs_PyDict_DelItemIfPySequence_DelItem_PyArg_ParseTuple_SizeTwmemchrPyObject_CheckBufferPyObject_LengthHint_PyObject_HasLenPyObject_SizePyExc_BytesWarning_PyObject_VisitManagedDict_PyObject_RealIsSubclassPyInit__ioPyDict_ClearPyModule_AddIntConstant_PyObject_CallFunction_SizeT_Py_VaBuildStack_SizeTPyEval_GetGlobals_PyArena_FreePyMarshal_WriteObjectToString_Py_HashPointerRawPyObject_DelItem_Py_hashtable_destroyPyThread_free_locksem_destroyPyMarshal_InitPyInit_posixqsortPy_FinalizePy_FinalizeExfflush_PyObject_GC_ResizePyUnicode_DecodeASCIIPyUnicode_JoinPyUnicodeIter_Type_PyLong_AsByteArrayPyList_GetItemPyUnicode_ComparePyObject_Byteswmemcmp_PyLong_FromByteArrayPySet_Pop_PyImport_GetModuleAttrString_PyImport_GetModuleAttrPyImport_ImportPyImport_ImportModuleLevelPyInit_time_PyTime_localtimelocaltime_rPySlice_Unpack_PyEval_SliceIndexPySlice_AdjustIndicesPyList_InsertPyUnicode_AsEncodedString_Py_EncodeUTF8Ex_PyCodec_LookupPyExc_LookupError_PyBytesWriter_Init_PyBytesWriter_AllocPyCodec_RegisterError_PyBytesWriter_ResizePyImport_ImportModulePyIndex_CheckPyUnicode_EncodeFSDefault_Py_EncodeLocaleExlstat64fstatat64PyEval_SaveThreadpthread_cond_waitPyEval_RestoreThreadPyErr_SetFromErrnoWithFilenameObject_PySet_NextEntry_PyLong_FromUidPyLong_FromUnsignedLongLong_PyLong_FromGidPyLong_FromLongLong_PyLong_FromTime_tPyNumber_MultiplyPyNumber_Andfrexpmodf_PyLong_Signreaddir64closedirrewinddirfdopendir_PyUnicode_EQ_Py_ascii_whitespace_PyUnicode_XStripPyOS_FSPathPyNumber_LongPyLong_FromDoubleldexpPyFile_OpenCodeObjectPyNumber_CheckPyUnicode_FSConverter_Py_set_inheritablePyObject_VectorcallMethodisattyPyType_GetModuleByDeflseek64_Py_read_PyErr_ChainExceptions1_PyArg_UnpackKeywords_PyManagedBuffer_TypePyUnicode_FSDecoder_Py_SourceAsStringPyBuffer_IsContiguousPyInit__codecsPyMapping_KeysPySequence_GetItem_PyErr_ClearPyCodec_LookupErrorPyCodec_Register_PyUnicode_IsAlpha_PyUnicode_IsDecimalDigit_PyUnicode_ToDecimalDigit_PyUnicode_IsDigit_PyUnicode_ToDigit_PyUnicode_IsNumericPyOS_setsigsigemptysetsigactionPyInit__signal__libc_current_sigrtmin__libc_current_sigrtmax_PyUnicode_AsASCIIStringPyInit__abcPyOS_getsigPySequence_ListPyDictProxy_NewPyDictProxy_TypePyMapping_ItemsPyLong_FromSize_t_PyObject_IsAbstractPySet_ClearPyImport_GetModulePyModule_GetFilenameObject_PyErr_SetStringPy_hexdigits_PyObject_CallMethodPyExc_EncodingWarning_PyCodec_LookupTextEncoding_PyCodecInfo_GetIncrementalDecoderPySys_SetObject_PyCodecInfo_GetIncrementalEncoder_Py_ClearStandardStreamEncodingPyNumber_OrPyInit__statPy_GenericAliasPy_GenericAliasTypePyVectorcall_FunctionPy_RunMaingetpidungetcPyBytesIter_Type_PyInterpreterState_SetRunningMainPyByteArrayIter_TypePyDictKeys_TypePyDictIterKey_TypePyDictValues_TypePyDictIterValue_TypePyListRevIter_TypePyLongRangeIter_TypePyNumber_FloorDividePyExc_ZeroDivisionError_PyType_GetDocFromInternalDocPyObject_DirPyUnicode_FromObjectPyIter_CheckPyException_SetCausePyUnicode_FromEncodedObjectPyUnicode_DecodePyNumber_RemainderPyUnicode_Format_PyUnicodeWriter_WriteSubstring_PyUnicode_FindMaxChar_PyLong_FormatWritergeteuidgetuidgetegidPyFrame_GetCodegetgidPyImport_GetImporter_Py_convert_optional_to_ssize_tPyMemoryView_FromBuffer_Py_wrealpathPyRun_SimpleStringFlags_Py_fopen_objPy_MakePendingCallsPyRun_StringFlags_PyEval_MakePendingCalls_PyRun_AnyFileObject_Py_FdIsInteractivePyRun_AnyFileExFlags_PyRun_SimpleFileObjectftellrewindPyUnicode_TailmatchPyByteArray_ResizePyImport_GetMagicNumberPyBuffer_ToContiguous_Py_UniversalNewlineFgetsWithSizeflockfilefunlockfile__uflowopenat64_Py_writerenamerenameat_PySys_GetAttrPyDict_DelItemString_PyInterpreterState_SetNotRunningMain_PyThreadState_DeleteExceptPyGC_Collect_PyDict_MaybeUntrackmkdirmkdirat_PyWeakref_ClearRefPyDict_SizePyBytes_AsStringAndSizePyUnicode_GetLength_PyModule_Clear_PyModule_ClearDictPyExc_WarningsigaltstackmunmapPyThreadState_Clear_PyObject_ClearManagedDictPyInit_itertoolsPyInit__operatorPyInit__collectionsPyODict_TypePyType_FromMetaclassPyInterpreterState_Delete_PyNone_Type_PyRuntimeState_FiniPyThread_tss_is_createdPyThread_tss_deletepthread_key_delete_PyPathConfig_ClearGlobal_Py_ClearArgcArgv_PyRuntime_FinalizePyInit__functoolsPyEval_MergeCompilerFlagsPyNumber_PowerPyFunction_GetModulePyUnicode_Partitionuname_PyArg_UnpackKeywordsWithVarargPyFile_WriteObjectPyFile_WriteString_Py_GetLocaleEncodingObjectPyUnicode_CopyCharactersPyType_GetSlotPyOS_string_to_double_Py_dg_strtod_Py_HashDoublePyFloat_Unpack8PyFloat_Pack8PyDict_MergeFromSeq2_PyArg_UnpackStackPyMapping_SizePyInit__srePyModule_AddStringConstantPySlice_NewPyNumber_InPlaceAndPyUnicode_FromOrdinal_PySlice_GetLongIndicesPyType_GetModulePyNumber_Xor_PyObject_RealIsInstancePyNumber_InPlaceXor_PyGen_FetchStopIterationValuePySequence_CheckPySeqIter_NewPySeqIter_Type_PyBytes_RepeatPyByteArray_FromStringAndSize_PyLong_FromBytesPyLong_FromStringlogPyInit__astPySequence_SizePySequence_ConcatPyInit__tokenize_Py_ctype_toupperPyInit__typingPyClassMethod_New_PySet_UpdatePySequence_GetSlice_PySlice_FromIndicesPyLong_FromUnicodeObject_PyDict_SetItem_KnownHash_Py_BuildValue_SizeT_PyUnicode_TransformDecimalAndSpaceToASCIIPyInit__string_PyUnicode_ToLowercase_PyUnicode_ToUppercasePyLong_AsUnsignedLongLongMask_PyTime_GetSystemClockWithInfoclock_getresPyBytes_FromObjectPyCallIter_TypePyCallIter_NewPyUnicode_SplitlinesPyNumber_InPlaceSubtractPyInit_atexitPyInit_errnodlopendlsymdlerrorPyNumber_RshiftPyInit__localePyNumber_InPlaceLshift_PyDict_Contains_KnownHash_PyErr_GetTopmostExceptionPyList_ReversePyUnicode_AppendAndDelPy_ReprEnter_PyThreadState_GetDict_PyUnicodeWriter_WriteCharPyBytes_ReprPy_ReprLeave_PyLong_FormatAdvancedWriter_PyLong_Formatlocaleconv_PyUnicode_InsertThousandsGroupingPyErr_NewExceptionWithDoc_PyUnicode_FormatAdvancedWriter_PyFloat_FormatAdvancedWriterPyNumber_TrueDividePyNumber_Absolute_PyLong_Copy_PyLong_FromDigitsPyNumber_Divmod_PyUnicode_AsUTF8String_PyUnicode_IsLowercase_PyUnicode_IsTitlecase_PyUnicode_IsUppercase_PyObject_CallMethod_SizeTPyUnicode_ReplacePyCapsule_ImportPyCapsule_IsValidPyUnstable_Code_NewWithPosOnlyArgsPyObject_CallNoArgsPyModule_Create2_PyImport_IsInitialized_PyImport_CheckSubinterpIncompatibleExtensionAllowed_PyInterpreterState_HasFeaturePyImport_GetModuleDict_PyImport_FixupExtensionObjectPyObject_CallObjectPyContextVar_NewPyContextVar_Type_PyImport_SetModule_PyEval_GetBuiltin_PyErr_FormatPyInit__symtable_PyTime_GetMonotonicClockWithInfoPy_GetProgramNamePyInit__tracemalloc_PyTraceMalloc_InitPyMem_GetAllocator_PyCrossInterpreterData_RegisterClass_Py_AtExitPyErr_WarnExPyThreadState_GetFramePyFrame_GetBackPyFrame_GetLineNumberPyUnstable_InterpreterFrame_GetLinePyCode_Addr2Line_PyCode_CheckLineNumberPyComplex_FromCComplexPyInit_faulthandlerPyInit_gcPyInit_pwd_Py_DecRef_PyCrossInterpreterData_UnregisterClassPyInterpreterState_ThreadHeadPyThreadState_Next_PyTraceMalloc_Stop_Py_add_one_to_index_F_Py_add_one_to_index_Cfmodfputsfputcwcstol__sysconfpthread_attr_initpthread_attr_setstacksizepthread_attr_destroygetrlimit64setrlimit64abort__ctype_toupper_locPyBuffer_GetPointerPyBuffer_FillContiguousStridesPyAIter_Check_Py_FreeCharPArrayPyByteArray_SizePyByteArray_AsString_PyBytes_Find_PyBytes_ReverseFindPyVectorcall_NARGSPyCode_Addr2Location_Py_c_sum_Py_c_diff_Py_c_neg_Py_c_prod_Py_c_quot_Py_c_powhypotatan2sincos_Py_c_absPyException_GetCausePyException_GetArgsPyExceptionClass_NamePyUnicodeEncodeError_SetStartPyUnicodeDecodeError_SetStartPyUnicodeTranslateError_SetStartPyUnicodeEncodeError_SetEndPyUnicodeDecodeError_SetEndPyUnicodeTranslateError_SetEndPyGen_GetCodePy_UniversalNewlineFgetsPyFloat_GetMaxPyFloat_GetMinPyFloat_Unpack2_PyFrame_IsEntryFramePyFrame_GetGlobalsPyFrame_GetBuiltinsPyFrame_GetLastiPyFrame_GetGeneratorPyFunction_SetVectorcallPyUnstable_Long_IsCompactPyUnstable_Long_CompactValue_PyDict_SizeOfPyODict_New_Py_IncRef_Py_BreakPoint_PyObject_IsFreedPyObject_NotPyException_SetArgsPyObject_GET_WEAKREFS_LISTPTRPy_NewRefPy_XNewRefPy_IsPy_IsNonePy_IsTruePy_IsFalse_PyMem_GetAllocatorName_PyMem_StrdupPyStructSequence_SetItemPyStructSequence_GetItemPyType_ClearCachePyUnstable_Type_AssignVersionTagPyComplex_ImagAsDoublePyType_GetFlagsPyType_SUPPORTS_WEAKREFSPyObject_GetTypeDataPyType_GetTypeDataSize_PyUnicode_FastCopyCharactersPyUnicode_GetDefaultEncoding_PyUnicode_FastFill_PyUnicodeWriter_Dealloc_PyUnicode_ToNumeric_PyUnicode_IsWhitespace_PyUnicode_IsLinebreak_PyUnicode_ToTitlecase_PyUnicode_ToLowerFull_PyUnicode_ToTitleFull_PyUnicode_ToUpperFull_PyUnicode_ToFoldedFull_PyUnicode_IsCased_PyUnicode_IsCaseIgnorable_PyWeakref_GetWeakrefCountPy_GetRecursionLimitPy_SetRecursionLimitPyThreadState_EnterTracingPyThreadState_LeaveTracingPyEval_GetFuncDescPyUnstable_Eval_RequestCodeExtraIndexPy_LeaveRecursiveCallPyCompile_OpcodeStackEffectPyCode_Optimize_PyErr_FetchPyObject_CheckReadBuffer_PyErr_GetExcInfo_PyErr_GetHandledException_PyErr_SetHandledExceptionPyErr_SetExcInfoPyUnstable_InterpreterFrame_GetCodePyUnstable_InterpreterFrame_GetLastiPyEval_ThreadsInitializedPyEval_InitThreads_PyEval_SignalAsyncExc_Py_hashtable_size_Py_hashtable_len_Py_hashtable_steal_Py_hashtable_foreach_Py_hashtable_new_Py_hashtable_clearPyState_FindModulePyImport_GetMagicTagPyStatus_ErrorPyStatus_NoMemoryPyStatus_ExitPyStatus_IsErrorPyStatus_IsExitPyWideStringList_AppendPy_GetArgcArgv_PyDebugAllocatorStats_PyTuple_DebugMallocStats_PyDict_DebugMallocStats_PyList_DebugMallocStats_PyFloat_DebugMallocStats_PyObject_DebugTypeStats_PyObject_DebugMallocStatsPy_GetPathPy_GetPrefixPy_GetExecPrefixPy_GetProgramFullPathPy_GetPythonHomePyPreConfig_InitIsolatedConfig_Py_str_to_int_Py_IsFinalizing_Py_IsCoreInitializedPy_IsInitialized_Py_CoerceLegacyLocale_Py_IsInterpreterFinalizing_PyThreadState_GetCurrent_PyInterpreterState_IsRunningMain_PyInterpreterState_RequiresIDRef_PyInterpreterState_RequireIDRefPyThreadState_GetInterpreterPyThreadState_GetIDPyInterpreterState_HeadPyInterpreterState_MainPyInterpreterState_Next_PyGILState_GetInterpreterStateUnsafe_PyCrossInterpreterData_Init_PyCrossInterpreterData_InitWithSize_PyCrossInterpreterData_Clear_PyCrossInterpreterData_NewObject_PyInterpreterState_GetEvalFrameFunc_PyInterpreterState_SetEvalFrameFunc_PyTime_MulDiv_PyTime_AsNanoseconds_PyTime_AsMilliseconds_PyTime_AsTimeval_clamp_PyTime_AsTimespecPyThread_start_new_threadpthread_attr_setscopepthread_createpthread_detach_PyEval_SignalReceivedPyThread_exit_threadpthread_exitPyUnstable_PerfMapState_Initfdopen_PyThread_at_fork_reinitPyThread_create_keyPyThread_delete_keyPyThread_delete_key_valuePyThread_set_key_valuePyThread_get_key_valuePyThread_ReInitTLSPyGILState_GetThisThreadStatePyGILState_CheckPyThread_get_stacksizePyThread_set_stacksizePyThread_tss_allocPyThread_tss_free_PyTraceMalloc_IsTracing_PyTraceMalloc_GetTracebackLimitPyOS_mystrnicmpPyOS_mystricmp_Py_parse_inf_or_nan_Py_dg_freedtoa_Py_dg_dtoaPy_EncodeLocale_Py_EncodeLocaleRaw_Py_write_noraise_Py_DumpDecimal_Py_DumpHexadecimal_Py_DumpASCII_Py_DumpTraceback_Py_DumpTracebackThreads_Py_closerangeclose_rangePyGC_EnablePyGC_DisablePyGC_IsEnabledPyObject_GC_IsTrackedPyObject_GC_IsFinalizedPyUnstable_GC_VisitObjects_Py_RestoreSignals_PyOS_InterruptOccurred_PyOS_ReadlineTStatePyOS_InputHookclearerrfgetsfeofPyOS_ReadlinePyOS_ReadlineFunctionPointer_PyTraceBack_Print_IndentedPyTraceBack_Print_PyErr_DisplayPy_FatalError_Py_FatalErrorFunc_PyContext_NewHamtForTests_PyEval_SetSwitchInterval_PyEval_GetSwitchInterval_PyThreadState_InitPyThreadState_GetPyEval_ReleaseLockPyEval_ReleaseThread_Py_FatalErrorFormatvfprintf_Py_FatalRefcountErrorFuncPyGILState_Release_PyObject_Dump_PyObject_AssertFailedPyErr_WarnFormatPyFloat_AsDoublePyComplex_RealAsDoublePyComplex_AsCComplexPyImport_ImportModuleNoBlockPyType_GetQualNamePyType_GetNamePyUnicodeEncodeError_SetReasonPyUnicodeDecodeError_SetReasonPyUnicodeTranslateError_SetReasonPyEval_GetFuncNamePyObject_HasAttrPyObject_HasAttrString_PyErr_NormalizeException_PyErr_WriteUnraisableMsgPyErr_WriteUnraisable_PyErr_SetFromPyStatus_PyArg_BadArgument_PyArg_NoKwnamesPyType_ClearWatcherPyType_GetModuleStatePyPickleBuffer_ReleasePyPickleBuffer_TypePyDict_ClearWatcherPyFunction_ClearWatcherPyFrame_GetVarPyFrame_GetVarStringPyUnicodeEncodeError_GetEncodingPyUnicodeDecodeError_GetEncodingPyUnicodeEncodeError_GetObjectPyUnicodeTranslateError_GetObjectPyUnicodeEncodeError_GetStartPyUnicodeTranslateError_GetStartPyUnicodeEncodeError_GetEndPyUnicodeTranslateError_GetEndPyUnicodeEncodeError_GetReasonPyUnicodeDecodeError_GetReasonPyUnicodeTranslateError_GetReasonPyCode_ClearWatcherPyBytes_SizePyPickleBuffer_FromObjectPyObject_GetAIterPyUnicodeDecodeError_GetEndPyUnicodeDecodeError_GetStartPyUnicodeDecodeError_GetObjectPyNumber_InPlacePower_PyErr_BadInternalCall_PyArg_NoKeywords_PyArg_NoPositional_Py_DumpExtensionModulesPyCFunction_GetFunctionPyCFunction_GetSelfPyCFunction_GetFlagsPyLong_AsUnsignedLongMaskPyLong_AsLongLongAndOverflowPyFunction_GetCodePyFunction_GetGlobalsPyFunction_GetDefaultsPyFunction_GetKwDefaultsPyFunction_GetClosurePyFunction_SetClosurePyUnstable_Code_GetExtraPyUnstable_Code_SetExtraPyInstanceMethod_TypePyMethod_FunctionPyMethod_SelfPyInstanceMethod_FunctionPyCell_Get_Py_CheckRecursiveCallPy_EnterRecursiveCall_PyObject_FunctionStrPyContext_TypePyDict_GetItemStringPySys_HasWarnOptionsPyErr_FormatV_PyErr_FormatFromCause_PyErr_FormatFromCauseTstatePyErr_BadArgumentPyUnicode_AsWideChar_PyTime_AsTimeval_PyTime_AsTimevalTime_tPyInterpreterState_GetID_PyInterpreterState_IDInitrefPyContext_EnterPyContext_ExitPyContextVar_GetPyUnicode_GetSizePyUnicode_ReadCharPyUnicode_WriteCharPyUnicode_Fill_PyType_GetTextSignatureFromInternalDocPyType_AddWatcherPyType_WatchPyType_UnwatchPyTuple_SetItemPyPickleBuffer_GetBufferPyDict_WatchPyDict_UnwatchPyDict_AddWatcherPySlice_GetIndicesPyLong_AsVoidPtr_Py_Uid_Converter_Py_Gid_ConverterPyLong_AsLongLong_PyTime_FromSecondsObject_PyTime_FromMillisecondsObject_PyLong_AsTime_t_PyTime_ObjectToTimespec_PyTime_ObjectToTimeval_PyTime_ObjectToTime_t_PyTime_FromNanosecondsObject_PyInterpreterID_TypePyLong_AsUnsignedLongLong_PyLong_UnsignedShort_Converter_PyLong_UnsignedInt_Converter_PyLong_UnsignedLong_Converter_PyLong_UnsignedLongLong_Converter_PyLong_Size_t_Converter_PyLong_FrexpPyLong_AsDoublePyFunction_AddWatcherPyFunction_SetDefaultsPyFunction_SetKwDefaultsPyFunction_SetAnnotationsPyFloat_Pack2PyFloat_Pack4PyFloat_Unpack4_PyErr_ChainExceptionsPyCode_AddWatcherPyCapsule_GetNamePyCapsule_GetDestructorPyCapsule_GetContextPyCapsule_SetNamePyCapsule_SetDestructorPyCapsule_SetContextPyCapsule_SetPointer_PyTime_FromTimeval_PyTime_FromTimespec_PyTime_GetSystemClock_PyDeadline_Init_PyDeadline_GetPyEval_AcquireLock_PyThreadState_SwapPyEval_AcquireThread_PyTraceMalloc_ClearTracesPyTraceMalloc_Untrack_PyTraceMalloc_GetMemory_PyTraceMalloc_ResetPeakPyUnstable_WritePerfMapEntryPyUnstable_PerfMapState_FiniPyGILState_EnsurePyTraceMalloc_Track_PyThreadState_PreallocPyThreadState_Delete_PyThreadState_DeleteCurrent_PyInterpreterState_IDIncref_PyInterpreterState_LookUpID_PyInterpreterID_LookUpPyThreadState_SetAsyncExc_PyEval_AddPendingCallPy_AddPendingCallPyErr_SetInterruptExPyErr_SetInterrupt_PyCrossInterpreterData_Release_PyCrossInterpreterData_ReleaseAndRawFree_PyMem_SetupAllocators_PyMem_GetCurrentAllocatorNamePyMem_SetupDebugHooksPyConfig_SetBytesString_PyInterpreterState_GetConfigCopyPyConfig_SetArgvPyConfig_SetWideStringListPy_PreInitializeFromBytesArgsPy_PreInitializeFromArgsPy_PreInitializePy_SetPathPy_SetPythonHomePy_SetProgramName_Py_SetProgramFullPathPy_SetStandardStreamEncodingPyImport_ExtendInittabPyImport_AppendInittabPyObject_GetArenaAllocatorPyObject_SetArenaAllocator_PyErr_NoMemoryPyUnstable_Object_GC_NewWithExtraDataPyOS_double_to_string_Py_string_to_number_with_underscoresPyUnicode_AsUCS4PyUnicode_AsUCS4CopyPyUnicode_CountPyUnicode_FindPyUnicode_DecodeLatin1PyUnicode_Resize_Py_device_encoding_PyUnicode_Copy_PyUnicode_WideCharString_Converter_PyUnicode_WideCharString_Opt_Converter_PyUnicodeWriter_PrepareKindInternal_PyUnicodeWriter_WriteLatin1String_PyUnicode_DecodeRawUnicodeEscapeStatefulPyUnicode_DecodeRawUnicodeEscapePyUnicode_DecodeUTF16StatefulPyUnicode_DecodeUTF16PyUnicode_DecodeUTF32StatefulPyUnicode_DecodeUTF32PyObject_InitPyObject_InitVar_PyUnicode_FromId_PyUnicode_EqualToASCIIId_PyType_LookupId_PyObject_LookupSpecialId_PyObject_LookupAttrId_PyDict_GetItemIdWithError_PyDict_ContainsId_PyUnicode_InternInPlace_PyDict_SetItemId_PyLong_Lshiftalarmgetppidwcscoll_PyTime_AsNanosecondsObjectPyNumber_InPlaceRshiftPyNumber_InPlaceMatrixMultiplyPyNumber_InPlaceFloorDividePyNumber_InPlaceTrueDividePyNumber_InPlaceRemainderPyNumber_InPlaceMultiplyPyNumber_MatrixMultiply_PyLong_Rshift_PyLong_GCDmktimePyComplex_FromDoublesPyByteArray_ConcatPyBuffer_FromContiguousPyObject_CopyDataPyContext_CopyPyContext_CopyCurrentPyContext_NewPyCFunction_NewExPyCFunction_New_PyObject_GetDictPtrPyObject_GenericSetDictPyODictValues_TypePyODictItems_TypePyODictKeys_TypePyList_GetSlice_PyTraceMalloc_GetTracesPyUnicode_RSplitPyUnicode_SplitPyDict_Valuessigismember_PyAsyncGenAThrow_Type_PyCoroWrapper_Type_PyAsyncGenASend_Type_PyAsyncGenWrappedValue_TypePyInstanceMethod_NewPyCode_GetCodePyBytes_ConcatAndDel_PyBytesWriter_WriteBytesPyNumber_ToBase_PyUnicode_FormatLong_PyLong_FormatBytesWriter_PyBytes_FromHexPyBytes_FromFormatVPyBytes_FromFormatPyMarshal_WriteLongToFile_PyUnicode_EncodeUTF7PyUnicode_AsUnicodeEscapeStringPyUnicode_AsRawUnicodeEscapeString_PyDict_NewPresizedPyInterpreterState_GetDict_Py_GetConfigsAsDictPyUnicode_BuildEncodingMapPyFunction_GetAnnotationsPyContextVar_Set_PyTraceMalloc_GetTraceback_PyTraceMalloc_GetObjectTraceback_PyTraceMalloc_GetTracedMemory_PyErr_StackItemToExcInfoTuplePyCodec_IgnoreErrorsPyExc_UnicodeTranslateErrorPyCodec_ReplaceErrorsPyCodec_XMLCharRefReplaceErrorsPyCodec_BackslashReplaceErrorsstrsignalstrstrgetloadavgPy_VaBuildValue_Py_VaBuildValue_SizeTPyDict_Items_PyLong_DivmodNearPyCode_GetVarnamesPyCode_GetCellvarsPyCode_GetFreevarsPySys_AddAuditHook_PyEval_SetTrace_PyEval_SetProfile_PyThread_CurrentExceptionsPyFile_SetOpenCodeHookPyObject_AsFileDescriptor_PyLong_FileDescriptor_ConverterPyOS_BeforeForkPyOS_AfterFork_ParentPyByteArray_FromObjectPyMemoryView_FromObjectPyMemoryView_GetContiguousPyMemoryView_FromMemoryPyGen_NewWithQualNamePyGen_NewPyCoro_NewPyAsyncGen_NewPyFrame_NewPyEval_GetFrame_PyThread_CurrentFramesPyODictIter_Typesigfillsetpthread_sigmask_PyTime_GetPerfCounterPyExc_ReferenceError_PySys_GetSizeOf_PyState_AddModulePyState_RemoveModule_PyEval_SliceIndexNotNone_PyObject_CallMethodIdObjArgsPyUnicodeDecodeError_Create_PyUnicodeTranslateError_CreatePyEval_CallFunctionPyExc_SystemExit_PyErr_CheckSignalsPyVectorcall_Call_PyExc_CreateExceptionGroup_PyCrossInterpreterData_Lookup_PyObject_GetCrossInterpreterData_PyObject_CheckCrossInterpreterDataPyObject_AsWriteBufferPyObject_AsReadBufferPyObject_AsCharBufferPyNumber_PositivePySequence_LengthPySequence_RepeatPySequence_InPlaceConcatPySequence_InPlaceRepeat_PySequence_BytesToCharpArrayPyArg_VaParseTupleAndKeywords_PyArg_VaParseTupleAndKeywords_SizeTPySequence_SetItemPyObject_DelItemStringPySequence_SetSlicePySequence_DelSlicePyMapping_LengthPyObject_Length_Py_strhex_Py_strhex_bytes_Py_strhex_with_sep_Py_strhex_bytes_with_sep_PySequence_IterSearchPySequence_IndexPySequence_CountPySequence_In_PyArg_ParseTupleAndKeywordsFast_PyArg_ParseTupleAndKeywordsFast_SizeT_PyArg_VaParseTupleAndKeywordsFast_PyArg_VaParseTupleAndKeywordsFast_SizeT_PyArg_ParseStackAndKeywords_PyArg_ParseStackAndKeywords_SizeTPyUnstable_Code_NewPySlice_GetIndicesEx_PyErr_SetNonePySys_SetArgvExPySys_SetArgvPySys_AddXOptionPySys_GetXOptionsPySys_AddWarnOptionUnicodePySys_AddWarnOptionPySys_SetPath_PyDict_DelItemId_PyObject_SetAttrId_PyException_AddNote_PyObject_GetAttrId_PyObject_CallMethodId_SizeT_PyObject_CallMethodIdPyCodec_NameReplaceErrors_PyUnicode_DecodeUnicodeEscapeStatefulPyUnicode_DecodeUnicodeEscapePyEval_CallMethodPyFile_FromFdPyFile_OpenCodePyBuffer_SizeFromFormatPyMarshal_ReadLongFromFilePyMarshal_ReadShortFromFilePyMarshal_ReadObjectFromFilePyMarshal_ReadLastObjectFromFilePyODict_DelItemPyContextVar_ResetPyCodec_StrictErrors_PyUnicode_AsLatin1StringPyUnicode_DecodeLocaleAndSize_Py_GetLocaleconvNumericgetrusagetimespthread_getcpuclockidclock_settimeftruncate64getitimersetitimerfdatasyncfsyncfchdirfstatvfs64setgroups_Py_Sigset_Convertersigaddsetsigtimedwaitsigwaitinfo_Py_get_inheritable_Py_set_inheritable_async_safe_Py_open_noraise_Py_fstat_Py_dup_Py_get_blocking_Py_set_blocking_PyTraceMalloc_Startwcsftime_PyTime_gmtimegmtime_rwcsxfrmsigpendingsigwaitgetgroupsgetresgidgetresuidnicegetprioritysetpriorityumasksched_get_priority_maxsched_get_priority_minsched_yieldopenptylogin_ttysetuidseteuidsetreuidsetgidsetegidsetregidgetpgidsetsidtcgetpgrpdup3lockf64pipe2pipefpathconfsetresuidsetresgideventfdeventfd_readeventfd_writesetnsunshareclock_nanosleep_PyTime_GetPerfCounterWithInfounlinkatunlinkPyUnicode_EncodeLocale_PyBufferWrapper_TypePyODict_SetItemPyCodec_StreamWriterPyCodec_StreamReaderPyCodec_IncrementalDecoderPyCodec_IncrementalEncoderPyCodec_DecoderPyCodec_EncoderPyCodec_KnownEncoding_PyGen_SetStopIterationValuePySys_WriteStdoutPySys_WriteStderrPySys_FormatStdoutPySys_FormatStderrPyFile_GetLinePyIter_Send_PyCodec_EncodeTextPyCodec_Encode_PyCodec_DecodeTextsetpwentgetpwentendpwentgetpwuid_r_Py_open_PyOS_URandom_PyOS_URandomNonblockPyErr_SetFromErrnoWithFilenamePyCode_NewEmptyttyname_rctermidgetloginreadlinkatPyCodec_Decodestrcspn_Py_WriteIndent_Py_WriteIndentedMarginpausepthread_killfchmodfchowncopy_file_rangesplicereadvpread64preadv64v2writevpwrite64pwritev64v2sendfile64posix_fallocate64posix_fadvise64wait3wait4PyInterpreterState_ClearmprotectPyEval_SetProfileAllThreadsPyEval_SetTraceAllThreadsPyMapping_HasKeyString_PyInterpreterState_GetMainModulePyMapping_HasKey_PyImport_GetModuleIdPyImport_ReloadModulestrtok_r_PyEval_GetBuiltinId_PyUnicode_EncodeCharmapPyUnicode_AsCharmapStringPyUnicode_DecodeCharmapPyFrame_LocalsToFasttzsetPyModule_GetFilenamebind_textdomain_codesetdcgettextgetgrouplist_Py_UTF8_Edit_CostPyObject_Printferror_Py_HandleSystemExitPyFloat_FromString_PyImport_ClearExtension_PyUnicode_EncodeUTF32PyUnicode_AsUTF32String_PyUnicode_EncodeUTF16PyUnicode_AsUTF16Stringbindtextdomainmemfd_createsysteminitgroupsgetpwnam_rexecvchrootflistxattrllistxattrfremovexattrlremovexattrfsetxattrlsetxattrfgetxattrlgetxattrmknodatmknodmkfifoatmkfifosymlinkatsymlinkutimensatfutimensrmdirfchmodatfaccessataccesslchownfchownat_Py_statPyMarshal_WriteObjectToFilePyStructSequence_InitType2PyStructSequence_InitTypePyUnicode_DecodeUTF7StatefulPyUnicode_DecodeUTF7PyUnicode_TranslatePyArg_VaParse_PyArg_VaParse_SizeTPyArg_Parse_PyArg_Parse_SizeTgetsidsched_rr_get_intervalsched_getschedulersched_getparam__sched_cpuallocsched_getaffinity__sched_cpufree__sched_cpucount_PyArg_ParseStack_PyArg_ParseStack_SizeTtcsetpgrpsetpgidwaitpidkillpgsched_setschedulersched_setparamsched_setaffinitywaitid_PyCompile_AssemblePyNumber_FloatPyErr_ResourceWarningPyUnicode_AsDecodedObjectPyUnicode_AsDecodedUnicodePyUnicode_AsEncodedObjectPyUnicode_AsEncodedUnicode_PyBytes_FormatExPyExc_UserWarningPyErr_WarnExplicitObjectPyErr_WarnExplicit_PyErr_ProgramDecodedTextObjectPyErr_ProgramTextPyErr_SyntaxLocationExPyErr_SyntaxLocationPyErr_RangedSyntaxLocationObjectPyErr_SyntaxLocationObjectPyErr_ProgramTextObject_Py_DisplaySourceLinePyErr_WarnExplicitFormat_PyObject_GetState_PyDictView_IntersectPyWeakref_NewProxy_PyUnicode_CheckConsistency_PyType_CheckConsistency_PyDict_CheckConsistency_PyObject_CheckConsistency_PyTraceback_AddPyEval_EvalFrameExPyEval_EvalFramePyMapping_ValuesfexecvePyDict_MergePyFrame_GetLocalsPyFrame_FastToLocalsWithErrorPyFrame_FastToLocalsPyEval_GetLocalsposix_spawn_file_actions_initposix_spawn_file_actions_addopenposix_spawn_file_actions_addcloseposix_spawn_file_actions_adddup2posix_spawn_file_actions_destroyposix_spawnattr_initposix_spawnattr_setpgroupposix_spawnattr_setsigmaskposix_spawnattr_setsigdefaultposix_spawnattr_setschedpolicyposix_spawnattr_setschedparamposix_spawnattr_setflagsposix_spawnattr_destroyposix_spawnpposix_spawnPySys_ResetWarnOptionsPy_ExitPyErr_PrintEx_PyErr_PrintPy_EndInterpreter_PyInterpreterState_IDDecref_PyInterpreterID_New_PyInterpreterState_GetIDObject_PyCompile_OptimizeCfgPy_CompileStringPy_CompileStringFlags_PyCompile_CodeGenPyCodec_Unregister_PyInterpreterState_SetConfig_Py_InitializeMainPyRun_FileExFlagsPyRun_FilePyRun_FileExPyRun_FileFlagsPyRun_InteractiveOneObjectPyRun_InteractiveOneFlagsPyRun_InteractiveOne_PyRun_InteractiveLoopObjectPyRun_InteractiveLoopFlagsPyRun_InteractiveLoopPyRun_SimpleStringPyRun_StringPyRun_SimpleFileExFlagsPyRun_SimpleFilePyRun_SimpleFileExPyRun_AnyFilePyRun_AnyFileExPyRun_AnyFileFlagsPyImport_ExecCodeModuleObjectPyImport_ExecCodeModuleWithPathnamesPyImport_ExecCodeModuleExPyImport_ExecCodeModulePyEval_EvalCodeExPyEval_CallObjectWithKeywordsPyErr_SetImportErrorPy_NewInterpreterFromConfigPyErr_SetImportErrorSubclass_PyBytes_Join_PyExc_PrepReraiseStarPyUnstable_Exc_PrepReraiseStarPy_ExitStatusExceptionPy_NewInterpreterPy_InitializeExPy_InitializePyOS_AfterFork_ChildPyOS_AfterForkforkforkptyPy_MainPy_FrozenMain_PyErr_DisplayException_PyOS_IsMainThread_Py_Get_Getpath_CodeObjectPy_VersionPyStructSequence_UnnamedFieldPyEllipsis_Type_PySet_Dummy_PyNotImplemented_TypePyExc_ModuleNotFoundErrorPyExc_ConnectionErrorPyExc_ArithmeticErrorPyExc_FloatingPointErrorPyExc_FutureWarningPyExc_UnicodeWarning_PyParser_TokenNames__environlibm.so.6libc.so.6ld-linux-aarch64.so.1libpython3.12.so.1.0GLIBC_2.17GLIBC_2.35GLIBC_2.29GLIBC_2.28GLIBC_2.25GLIBC_2.26GLIBC_2.27GLIBC_2.33GLIBC_2.32GLIBC_2.34      ʖ @    ! , 7BMXC #CЃ#C1 Cp10C1@C1`C0WhC1pCШYxCТ1C0YC0CYC$/CYCH1CPYC1CYȤCء1ФCYؤC1CpYC1CЛYCh1C0YC81CYC1 CY(C10CPY8C1@CYHCp1PCYXC /`CpYhC1pCЎYxC؟1C0YC1CYCP1CYC01CPYCp1CYȥC@1ХCYإC1CpYC1CЁYC1C0YC`1C~YC1 C|Y(Cx10CP{Y8C(1@CyYHC1PCxYXC1`CpvYhC(1pCtYxC1C0sYCx1CqYC01CoYC1CPnYC1ClYȦC@1ЦCkYئCp3/CpiYC1CgYCȘ1C0fYC1CdYCx1 CbY(CH10CPaY8C1@C_YHCȗ1PC^YXC1`Cp\YhCp1pCZYxCH1C0YYC1CWYC1CUYC1CPTYC1CRYȧCH1ЧCQYاC1CpOYCЕ1CMYC1C0LYC1CJYCX1 CHY(C(10CPGY8C1@CEYHC1PCDYXC1`CpBYhC`1pC@YxC(1C.C1CK1C B1CK1CK1CK1CK1C1ȨCK1ШCK1بCK1CK1CL1CL1C1C0C L1C0L1C@L1 CPL1(CXL10C`L18ChL1@CpL1HCL1PCL1XCL1`CL1hC.pC0xCh1CL1CL1CL1C.CM/CL1C`<0CL1CL1ȩCL1ЩCM1ةCM1CM1C M1C8M1C0C@M1CPM1C`M1ChM1 CxM1(CM10CM18CM1@CM1HC/PCM1XCM1`CM1hCM1pCM1xCM1C/C 0CM1CN1C1CN1C0CN1C/ȪC\0ЪC(N1تCx0C` 1C0N1CHN1C(B1C`1CH1CXN1C8B1 C1(C`N10CpN18CxN1@CN1HC0PCN1XCN1`CN1hCN1pCW/xCN1CA1CN1CN1CN1CN1CN1C@.CN1CO1ȫCO1ЫC O1ثC(O1C0O1C8O1C@O1C1C0CHO1C>0CPO1 C`O1(CpO10CO18CO1@CO1HC1PCO1XCO1`CO1hCO1pCO1xCO1CO1CO1C(.CP1CP1CP1CP1C@E/C P1ȬC0P1ЬC1جC0 /C8P1C@P1CHP1CXP1C`P1CpP1C0C/ C00(CxP10CP18Cx0@CP1HCP1PCP1XCP1`CP1hCP1pCP1xCP1CP1CP1CP1CP1C.C/C/CP1C1ȭCQ1ЭCw/حCQ1CQ1C.C Q1C(Q1C0Q1C8Q1CB1C@Q1 CHQ1(CXQ10C`Q18CpQ1@CxQ1HCQ1PCQ1XCQ1`CQ1hCh1pC@0xCQ1CQ1CQ1Ct/CQ1C`0CQ1CQ1CQ1C(L1ȮCQ1ЮCR1خCR1Ch/CR1C(R1Cx.CH0C0R1C8R1C@R1 C0(CX00CHR18CXR1@C`R1HChR1PCxR1XCR1`CR1hC.pC.xC/CR1Cf0C/C/CR1CR1CR1C1CR1ȯCR1ЯCR1دC>0CpF1CR1CR1CR1CR1CR1CR1CS1 CS1(C S10C0S18CF/@C8S1HC0PCHS1XCp\0`CXS1hChS1pC0xCБ.CpS1CS1CS1CS1CS1CS1CS1CS1CS1ȰCS1аC@D0ذCS1CS1C.CT1CT1CZ0C C1C/CT1 C T1(C(T10C/8C/@CH.HC8T1PCHT1XCPT1`CXT1hC`T1pC/xChT1C@,/CpT1C.CT1CT1CT1CT1CT1CT1ȱCT1бC /رCT1CT1CZ1C(Z1C8Z1CHZ1CXZ1C01 C`Z1(CpZ10CxZ18CZ1@CZ1HCZ1PCZ1XCZ1`CZ1hCZ1pCZ1xC.Ch0C0C0CX0CH0C0C0C0C0ȲC0вC0زC0C0C0C0CX0 CP(CC̈C] CW(C0CT8CR@C8BHCiPCTXCl`CxhC]pCTGxCoC~CC8cC|BCpCCJC\DCYC,oȶCuжC\dضCCSC|KCLQCC=CGCC~ CDY(Cl{0C8C@C`cHCPCXCh`CfhChXpCpxC@CACC`CvCiCjCCqC|~ȷCIзCXOطCTACCsCFCPC CQC8ECt C4(C0C<8C@CTbHC PC|XCXF`CXhCpCxC?C0{C,C$CCtCCCCȸCиCظCCCCCCCCC C(C0C8C@CHCPCXC`ChCpCxCCCCCCCCCCȹCйCعCCCCCCCCC C(C0C8C@CHCPCXC`ChCpCxCCCC$CCHCCdCC`ȺCкC|غCPCCCCCDCCC C،(C0Cd[)8CTi'@CxJHCPC('XC ,`ChCHpC,xC,CC@,C`C,C81C@1CH1ȻC .лC/ػCP1Cd1Cd1Cd1Cd1Cd1Cd1Cd1Cd1 Ce1(Ce10Ce18Ce1@C90HC90PCd1XC90`Cd1hCd1pC90xCd1Cd1Cd1Cd1Cd1C/C/Chd1Cp/Cpd1ȼCxd1мC )1C0)1CpB(C@)1CP)1C`)1CB( Cp)10C)18CB(@C)1PC)1XCB(`C)1pC)1xC`B(C)1C)1C)1CB(C*1C*1нC *1ؽCB(C0*1C@*1CP*1C`*1 Cx*1(CD(0C*18C D(@C*1HC0D(PC*1XC@D(`C*1hCPD(pC*1xC`D(C*1CpD(C*1CD(C*1CD(CHB1ȾCpB1оCB1C/CI/C/CW/CY/CW/CW/ CpW/(CpY/0C18CW/@C8X/HC(X/PC/XChW/`CW/hCW/pCpY/xCY/CY/C/ChW/CW/CW/CpY/CY/CY/пC/ؿCW/CX/CW/CW/CY/C}.CY/CY/C}. CY/0C/8CY/@C}.PCО/XCY/`C}.pCО/xCXW/C}.CY/CО/CX/CW/C@Y/CY/CО/CX/CW/C@Y/CY/CY/CW/C@Y/CY/CW/ C@Y/0CX/8CW/@CY/PCX/XCW/`CY/pCY/xCW/CHX/CW/CW/CpX/C@Y/C20CW/CpX/C@Y/C20CY/CY/C=/C@//C=/C/C=/C=/C}. C1(CW/0C8X/8C(X/@CY/HC.0PCО/XC}.`CY/hCY/pCxY/CY/C Y/ChW/CW/CY/CW/C@Y/CX/C.0C X/CX/C/CX/C/C(0C}.C/ CX/(C/0C}.8C}.@C}.PCY/XC(Y/`C.0pC`X/xChW/CX/C}.CW/CPX/C.0C}.C.C}.C0CW/C}.C.CW/C}.CW/C0CW/ C X/(CW/0C X/8CW/@C1HCY/PCY/`CО/hCX/pCX/xCX/C1CW/C8X/C(X/C.C/CW/CXY/ChW/CY/CX/CX/CX/CX/C1CXW/CY/ C1(CW/0C8X/8C(X/@C1HC}.PC1XCW/`C8X/hC(X/pC/xCW/C1CW/C8X/C(X/CW/C0Y/C(/ChX/CW/C1CW/C8X/C(X/C}.C}.CHY/CX/CHY/ ChY/0CW/8CHY/@CX/HCX/PC/`C(/hC/pCHY/C1CY/C1CW/C8X/C(X/C/CW/C/C/C?/CLCh1CxC.C-Cx"0C Ch"0C C80(C0C"08CP@C"0HCPC0XCpC/xCH/C8Y1C@Y1CHY1CXY1ChY1CxY1C0C.C Y1C/C(Y1C/C0Y1CH.C#C" C"(C"0C#8C#@C"HC`"PC$"XC"`Cl"hC"pC8"xC"C"C"C"Cx"C"C"C"Cd"Ct"C"C"C"C"C"CH"C"C "Ct"C"CT" C#(CX"0C0"8C("@C"HC"PC"XC"`C$#pCH.xCf1CHb1C1Cb1Cؐ1Cf1C0C0C1C1C0-Cz-Cl-C-C-Cԏ-Cx-C-C-C0- C0-(C-0C-8C-@C-HC-PCLy-XC-`C-hCL-pC-xC-CP-Ch-Cy-Cd-Ċ-C-Cԃ-CȌ-C܅-Cd-CH-C-Cd-C-C-C-C\-C-CX-C- C4-(C`18Ch1HCp1XCx1hC1xC1C1C1C1C1C1C1C1C1C1C1(C18C1HC1XC1hC1xC1C1C1C 1C(1C01C81C@1CH1CP1CX1(C`18Ch1HCp1XCx1hC1xC1C1C1C1C1C1C1C1C1C1C1(C18C1HC(1XC81hCH1xCX1C`1Ch1C.C.C.C.C<.C.C.C.C.CX.CX.C,. Cd.(Cx.0C.8C.@C.HC.PC.XCP.`C4.hC`.pCx.xC .C.Ch.Cp.C.C(.C.C.C.C.CD.C.C.C.CX.C .C,.C`.C.Cp. C00(Ch.0C`.@C/HC/PC"0`CC1hCC1pC5/C0W/C1C1C1C(1C81CH1CX1Ch1Cx1 C.(CX38C%@C0HCh2XC@(`C /hCp 2xCg(C0C 8Cs)C0Cg7C$[)C/CW7Cs)C0C6C) C 0(C@68C*@C00HC0z6XC)`C@0hC6xC,-CH0CP5C)CX0CP5C)C`0C 5C)CpF1C4C)CF/C04C ) Ch0(C`n48CR+@Cx0HCPj4XCR+`C/hC24xC )C0C 08CěC0C 08CěC0C 08CěC0C 08Cě C0(C.88C@C0HC.8XC`C0hC`.8xC C0C`.8C C00C-8C0CH0C,8CTCX0C+8Cx C10C80@C.PC.`C0hC0pC1C0C0C1C0C1C0C0C1C1C0C`0C1C0C`0 C0(C00C1@C0HC0PC1`C0hC0pC1C(/CT/C1Cp 1C 1C1C/C(/C/C(0C/C(/ C.(CY/@C1HC1`C/hC(/C/C0C/C`X/C 1C@1CP1Chk0Chk0Chk0C01C81 C]10CP08C.PC1XC"0`C]1hCP1pC1xC1C"0C]1CP1C1C1Chk0Chk0Chk0C1C1Chk0 C1(C1@C1HC1`C1pC8/xC/C1Cp1Chk0Chk0Chk0Chk0Chk0Chk0Chk0C/ C8/(C/0C18C"0@C]1HCP1PC1XCp1pCH1xC"0C]1CH1C"0C]1C0C0C0C 1CT/Cc0C'1 C'10Cc08C}.PCc0`C'1hCT/C/CT/C/CT/C/C/C/C0C/C/C0 C/(C/0C}.8CT/@C0PC/XC/`C0pC/C/C/C/C'1C'1C'1C'1C'1C'1C'1 Cc00Cc0@Cc0PC/XC'1pC/xC/C`1C'1C/C/C'1Cc0C'1C'1C0X/C`0Cc0C'1C'1 Cc00Cc0@C/HCT/PC/XC'1pC'1xCT/C'1C(1C(1C'1C(1C(1C/C/C/C/CH/ C00C'1@C/HC1PC1XC'1`C0pC/xC'1C/C'1C(1C(1C (1C((1C'1C/C'1C(1C (1 C@(1(CP(1@C(1HC (1PC@(1XCP(1pC(1xC (1C`0C`(1Cp(1CT/C(1C (1C`0C`(1Cp(1C/C'1Chk0Chk0Chk0C(1 C(1(C(10C%18C(1@C(1HC(1`Chk0hChk0pChk0xC(1C(1C(1C%1C(1C(1C(1C(1C(1C(1C(1C(1C/C/C'1 C/(C'1@C/PC(1XC (1`C@(1hCP(1pC0C/C/C)1C)1Cc0C)1C)1C/C)1C)1C'1C0Cc0C/ C/(C/0C'18C0PC/`C/hC/pC'1xC)1C0C/C'1C0ChV0ChV0C=0C=0C=0C=0CK1C(K1 C(K10C0K1@CG1PC(0XC[1pChk0xC[1Chk0C.C1C`1C`1CЄ1C8/C1C`1C`1CZ/ Chk0(Chk00Chk08C`1PC[1XC~/`C/hCT/pC`1xC@F1C`1C/CP`1Cx`1C`1C/Chk0C`1C"0C@a1CHa1C~/C1C@//CXa1Cha1C[10C@a18CHa1@Cxa1HC[1PCa1`CP]0hC"0pC]1C8d1CHd1C`1C1C`1C1C"0C]1C/CW/Cf1Cf1 Cg10C1@C/PC/`C/hCW/pCf1xCf1Cg1CH/ChW/C1C/CH/ChW/C1C/C}.CY/ C.0C@s08C@/PC/XC1pCP]0CP]0CT/Cpr0C1C`1C1C1C(0C؄1C؄1 C(0(C.@C(0HC.`C/hC}.Chk0C`1C.Cؐ.C@/C'1Cؐ.C@/C(0CP1C1CP`1C/C`1 C`10C/8C.PC/`C1hC1pC1xC1C01CE1C1Cȥ1Cإ1C1C(1C1C1C1C1C81CH1C1C1 C1(CX10Ch18Cp1@C1HC1`C[1hC"0pC]1Chk0C[1C8d1C`1C1C`1C1C`1C1CHd1 C"0(C]1@C[1HC"0PC]1`Chk0hC[1C8d1C`1C1C`1C1C`1C1CHd1C"0C]1C1 C1(C10C18C1@C1HC1PCȨ1XCШ1`Cب1hC1pC1xC1C1C1C1C1C1C 1C(1C01C81C@1CH1CP1CX1C`1Ch1Cp1C1C1C1C1 C1(Cȩ10Cة18C1@C1HC1PC1XC(1`C81hCH1pCX1xCh1Cx1C1C1C1CH*1C1CȪ1CЪ1C1C1C1C1C1C1C(1C81CH1CX1Ch1Cx1 C1(C10C18C1CcOC8{OCWCOCwOCtOCXvOClOCjOC|OC8nOCsOCxqO(CyOPCoOXC(eO`CaOCXgOC,hC C(CT(C0*C)C(CT:C~C CCT:C~C CCT( C0*(C)0C(HCT:PC~XC `CxCT:C~C CCP$C@*DU1DU1 DU1`D U1D(U1D0U1 D8U1`D@U1DHU1DPU1 DXU1`D`U1DhU1DpU1 DxU1`DU1DU1DU1 EU1`EU1EU1EU1 EU1`EU1EU1EU1 EU1`EU1EU1EU1 EU1`EV1EV1EV1 EV1`E V1E(V1E0V1 E8V1`E@V1EHV1EPV1 EXV1`E`V1EhV1EpV1 ExV1`EV1EV1EV1 EV1`EV1EV1EV1 EV1` EV1 EV1 EV1 EV1` EV1 EV1 EV1 EV1` EW1 EW1 EW1 EW1` E W1 E(W1 E0W1 E8W1` E@W1 EHW1 EPW1 EXW1`E`W1EhW1EpW1 ExW1`EW1EW1EW1 EW1`EW1EW1EW1 EW1`EW1EW1EW1 EW1`EW1EW1EW1 EW1`EX1EX1EX1 EX1`E X1E(X1E0X1 E8X1`E@X1EHX1EPX1 EXX1`E`X1EhX1EpX1 ExX1`EX1EX1EX1 EX1`EX1EX1EX1 EX1`EX1EX1EX1 EX1`EX1EX1EX1 EX1`EY1EjOEWJ8nOJPY K K KT( K0* K) K( KT: K~ K  K K?/ KB1 KB1 KB1 KB1 KB1 KB1 KB1( KB10 KB18 KC1@ KX1H KXC/ K0 1 K@ 1 KF/ K/ K"1 K/p K 0x K(0 K00 K80 KH0 KP0 KX0 K`0 Kp0 K0 K&1 K/K8/ K/pK.xK(1K.K (1 K"1(K/xK/K`1K"1K/K('1K/HKYPKYXK`KXpKtxKKKKtKKKKZ/K[/KZ/K&1K/0K&18K/K8&0K/K80K/8Kh"1@K/KH"1K/K0K/@K0HK/K0K/KH0K/HKH0PK/Kp0K/Kp0K/PK%1XK/K%1K/K#1K(1XK#1`K (1K"1K/Kx0K/`K81hK/K#1K/K"1K/hK(/pK(1K(/K (1K"1 K(1pK"1xK (1K0K/ K8"1(K/xK`"1K/KX0K/(K(#10K/K@0K/KP0K/K e1KKXK`K8e1K0P KX K`H!KPVP!KȃOX!KO!K8S!KaP!K_P!K_P!K0Ox"KȄO"KPP"KP"KAV"KaP"KP"KP"KPO#KPV#KHO0$Kx6V@$KaPH$K`^PP$K`^PX$KO$KO$KQ0%KaP8%K0^P@%K0^PH%KQ%KPV%KO%KhO%KP&KaP&KO&KO&KPV&KO'KЇO'K0T'KaP 'KXO('K O'KPV'KpO(K0O(KXT(KaP(KV (KO((KPOX)KHO`)K؊O)KO)KhO)KaP)KO)KO)KOh*K8Op*KO*KO*KQ*KaP*KXO*KO+KPV+K8O,Kp{V ,KaP0,KO8,KO,KPV,KO,KO-KO-KhV -KaP(-K(O0-K(O8-KO8.KPV@.KБOH.KO.KPO.KV.KaP.KO.KO/KPV/KO/KO/KhO/KhV/KaP/KU0KO0KO(1K(O01KO1KaP1K]P1K]P1KpO2KPV 2KPO`2KOh2KAVp2KaP2KO2KO2K0O3KЗO@3Kp{VP3KaP`3KxOh3K Oh4KșOp4KO4KжO4KAV4KaP4K0O4KOx5KO5KxV5KaP5K@]P5K@]P5K`O`6KOh6KQ6KaP6K]P6K]P6KQ87KO@7KHOH7KO7KO7K@U7KaP7K\P7K\P7KO8KPV8KO9Kh6U9K(}V 9KaP09KhO89KO(:KHO0:KOp:Kp{V:KaP:KO:KO:K@Oh;K(Op;KOx;K0O;KO;K(}V;KaP;KPO;KO;KХO>KO>KO>K@O>KO>K(}V>KaP>KȩO>KO(AKO0AKxOpAKp{VAKaPAKOAKpO(BKO0BKOBKaPBK\PBK\PBK@OCK}V CKO`CKh6UhCK(}VpCKaPCKOCK`OCKODKO@DKp{VPDKaPXDKPO`DKXOhDK ODK8ODKO0EKp{V@EKaPPEKOXEK`OFKO FKxO`FKp{VpFKaPFK OFKOGKO GKOpGKaPxGKX\PGKX\PGK`OHKPVHKOPHKh6UXHK(}V`HKaPpHKOxHKpOHKPVHKеO0IKp{V@IKaPPIKxOXIK0OJKPV JKO`JKжOhJKAVpJKaPJKxOJK@OKKO KKX~VpKKaPxKK\PKK\PKK@OKKPVLKOLKO@LKOHLK(}VPLKaPXLK(O`LK@OhLKзOMK8OMKOMK`OMK0OMKAVMKaPMK[PMK[PMK`OOKOOKXOOKOOKOOK(}VOKaPPKOPKO QKhO(QKAV0QKaP8QK(Q@QK(QHQK OQKOQKORKPORKAVRKaPRKQ RKQ(RKO8SK@O@SKOSKOSKXTSKaPSKOSKOSK0OXTKO`TKOTKpOTKTTKaPTK[PTK[PTK OHUKXOPUKOUKOUKXTUKaPUKOUKhOUKOhVKOpVKOVKOVKTVKaPVKX[PVKX[PVK`OXWKO`WKhOWKOWKVWKaPWK-QWK-QWKOYK0OYKOYKOPYK8OXYKV`YKaPhYK [PpYK [PxYKPOZKpuSZKO[KXO[KPV [KaP0[KO8[KO\KPO\KOP\K`}VX\K(}V`\KaPp\KOx\KO^KPV^KHO^KOP^KOX^KAV`^KaPp^KOx^KOH`KPVP`K O`Kp{V`KaP`KV`KO`KOaKPVaKPO bKO(bK(}V0bKaP8bKV@bKOHbKObKObKhOcKp{VcKaP cKO(cKOcKPVcKO0dKp{V@dKaPHdK PPdKhOXdKOdKPVdKOeKyVeK(}V eKaP(eK P0eKhO8eK8OeKOeKOfKaPfKqV fKqV(fKPO(gK`O0gKO8gKOpgKhOxgKPVgKaPgK@fVgK@fVgKpO(iKO0iKO8iKOpiK(OxiK@UiKaPiKZPiKZPiKOkKOkKOkK@O lKO(lKV0lKaP8lKZP@lKZPHlKOpKO pKO`pKOhpK(}VppKaPxpKfVpKfVpKOqKOqKO rKPO(rKAV0rKaP8rK`ZP@rK`ZPHrKPOtKO tKXO(tKO`tKOhtKhVptKaPxtK0ZPtK0ZPtK@OhxK@OpxKOxxK0OxKOxK(}VxKaPxKYPxKYPxKpOH|KXOP|KOX|K O|KO|KAV|KaP|KYP|KYP|KpOKhO K(O(KO`KPpKaPxKYPKYPKOHKPPKOKpOKhVKaPKVKOKOhKPpKPKPKaPȂK ^VЂK0P؂KOKPKP0KPP@KaPHK]VPKPXKPKP(KpP0K(}V8KaP@KЉVHKPPPKPKPKpPK(}VKaPK8PKPpKPKpPK(}VȆKaPІKQ؆K@PKP8KHP@KPKaPKxqVKxqVKPKXPKx PK0 PK PK8VKaPKp PK@ PKPKxPK0PЏKP؏K@UKaPK PKpPKPPؑKPKhP KP(KV0KaP8KV@KPHKPؓKPKPKpP K@P(KAV0KaP8K ^V@KPHKpP(KPV0K(PpKPxKhVKaPK]VKPK0PKPK`PЖKPؖKVKaPKQKPKP(KP0KPpKpPxK(}VKaPKЉVKPKPKP`KpPhK(}VpKaPKPKPKPKP0KpP8K(}V@KaPHKQPKPXKPؚK #PKp"P0KaP8K@qV@K@qVHK`!PhK$PpK$PKp{VKaPМK0$P؜K%PXK&P`K&PKH&PKhVKaPK%PȝK%PHK'PPK'PKaPK@YPK@YPK@'P(K)P0K)PpK0)PxKVKaPKfVKfVK(PhK-PpK8-PxK,PKX,PK8VKaPȠKfVРKfVؠK +P(K0P0Kh0PpK:PxKAVKaPKYPKYPK/PK5PK05PK4P0Kh4P8K8V@KaPHKXXPPKXXPXK2PK8PKh8PK(8PPK7PXKhV`KaPxK7PhK;PpK8;PK:PKAVKaPȫKWPЫKWPثK:PK@PKP@PK@PЬK?PجK@UKaPK>P8KEP@KDPKpDPKAVKaPKWPKWPKpCPXKIP`KxIPKIPKVKaPȱKHPȳKXKPгKKPKJPK(}V KaP(KhWP0KhWP8KpJPKxPPKOP@KHOPHK8VPKaPXK8WP`K8WPhK0NPKxRPK RP0KQP8K(}V@KaPHKoQPKoQXKQPXKSP`KSPKhSPKaPKVPKVPȹKSPxKPcPKXaPкKaPK@_PHKSPKPfPXKfPKePK(}VKzQKePHKhPPKgPKPKzQKuQKhPKpgPpK iPȿKzQпKuQؿKhPKhP8KjP@KjPKXjPK jPKzQKHuQKHuQKiPK8lPKlPKkPKzQKtQ KtQ(KkPKlPKmPKmPKzQKQ KQ(K`mPK(nPKmPKmP KzQ(KQ0KQ8K`mPKqPKxpPK8pP KoP(KPV0KzQ8KQ@KQHKnP8KrP@K`rPHK(rPKrPK(}VKzQKQKQKqPxKPVKsPKsPKhsPKXTKzQKsPKrPxK uPKtPKtPKTKzQKQKQK@tPKvPKXvPKUKzQK@QK@QKvPKpxPK0xPKwPKwPKAVKzQKtQKtQKPwPK`yPK0yPKUKzQKQTKQTKxPK`zPK zPKUKzQKQTKQTKyPK{PK{PKH{PK(}VKzQK`tQK`tQKzPK|P K|P`KUpKzQxK`tQK`tQKp|PK~PKP~PPK~PXK(}V`KzQhK(tQpK(tQxK}PhKPpK`PxKPKPKPVKzQKsQKsQKPKPPKXP@KЉPHKTPKzQXKPeV`KPeVhKPK(PKPP@KؓPHK8VPKzQXKdV`KdVhKPKPKXPKP0KЗP8KV@KzQXKPKPVKؙPKPKXSKzQKrQKrQKPKP KXP(KP`KPhK(}VpKzQxKhrQKhrQKP8KНP@KPKHPKPKzQK PKPK@PKPKPPKPKAVKzQKPKPKPPKhPK0PPKPXKP`KzQhK0rQpK0rQxK`P(KP0KPpK@PxKPVKzQKQKQKPPKPP KP`KPhKPVpKzQxKqQKqQKPKPKЯPKPKhVKzQKQKQK PKPK8PKPKVKzQKqQKqQKPP8KpP@KPKгPKhVKzQKpqQKpqQK@PKPK8PPKPXKV`KzQhK0qQpK0qQxKPPKPK@PKPKV KzQ(KeV0KeV8K`PhKPpKHPxKPKPKVKzQKdVKdVKPKPKhPKPKPVKzQKpQ KpQ(KPKPVKPKPPKP`KzQhKPpKHPxKPKPK8PKPKPKPVKzQKPK PK`PKPKPKPPKPK@UKzQKVKPKPHKPPKXPKzQKoVKoVKPhK PpKPKPKVKzQKQK0PKPK+QKYV K(}V(KzQ0K ^V8KP@K>RK@PKPKPKAVKzQK]VLHPLPLP LPP`LȧQhL(}VpLzQxLQLPLPLPLP`LzQhLQpLQxL0PLPLP8L0P@L(}VHLzQPLPPXL8P`LPLPLhPL0PL(}V LzQ(LQ0LP8LPLPLPLPLhVLzQLQ LHP(LPLPLHPLAVLzQLQLPL>RhLPpLPxLpPL0PLVLzQLPL`PLPLPPLPLhV LzQ(LP0LP8L`PLPPLPPLP L(P L'T LzQ( LЉV0 LP8 L P LhP LP0LzQ8LpQ@LpQHLPLPLQ LP(LAV0LzQ@LPHLPPLPVL QLUL(}VLzQ L@P(L@ QLPVL Q0Lp{V@LzQPLPXL QLXPLPPLPXLXT`LzQhLQpLPxLPPLQLU@LȧQHL(}VPLzQXL Q`LPhLQL0PLPLP LPP(LAV0LzQ8LXQ@LPHLpPLPLPL`PLAV LzQ(LpQ0LP8LPLPL0PLXSLzQLHpQLHpQLPLPLP LHP(LAV0LzQ8LQ@LPHLPL`PL(P0LP8LV@LzQHLQPLxPXL0PLQL8QLQ0LhQ8LV@LzQHLQPLQXLPLQLQLzQLnV LnV(L@QL8QLQLQLVLzQLЉVL@QLQLQPLȧQXL(}V`LzQpLQxLHQL8QLQ0 LzQ8 LnV@ LnVH LQ LPV LQ!L Q!LAV!LzQ !LQ(!LQ!LPV!L Q!LU!L(}V!LzQ"L Q"L@ Q"LPV"L Q#Lp{V #LzQ0#LP Q8#L Q#L( Q#L Q0$L Q8$LAV@$LzQH$L ^VP$L( QX$L QX%LQ`%L Q%Lx,Q%L(}V%LzQ%L]V%LQ%LpQ&LQ&LT'LhQ'LXT 'LzQ0'LQ8'LQ'LQ'LQ(LHQ(LQ(LzQ(LQ (LQ((LpQ(LQ()LȧQ0)L(}V8)LzQ@)LЉVH)LhQP)LHQ)LQ)LȧQ)L(}V*LzQ*LpQ*LHQx*LQ*LU*LȧQ*L(}V*LzQ*L Q*L Q*LQX+L@Q`+LQ+LzQ+LPnV+LPnV+L0Qh,LPVp,LQ,L )Q,LhV,LzQ,LPQ,LQ-LQ-LQ.LQ.LhV.LzQ.L&Q .L(Q(.LQ.LPV.LQ /LhQ(/LAV0/LzQ8/L`&Q@/LQH/LQ0LPV0LQP0LQX0LAV`0LzQh0L(&Qp0LpQx0LQ(2LPV02LQp2Lp{V2LzQ2LQ2LpQ(3LPV03L#Qp3L Sx3L(}V3LzQ3LX Q3L Q4LPV 4L"Q`4L0!Qh4LAVp4LzQ4L Q4L Q5LPV5L!QP5Lp{V`5LzQp5L!Qx5L`!Q6L#Q6L"QP6Lp{V`6LzQp6L"Qx6LP"Q6LPV7L#Q@7Lx$QH7L(}VP7LzQ`7Lx#Qh7L@#Q7LPV7L$Q08Lx$Q88L(}V@8LzQP8L($QX8L#Q8L(Q8LX'Q@9LzQH9LpQP9LpQX9L&Q:LPV:Lh)QP:L )QX:LhV`:LzQp:L(Qx:L(Q:L8R8;LȧQ@;L(}VH;LzQP;LQX;L)Q`;L)Q;L4RR0>LPVx>Lx,Q>L(}V>LzQ>L]V>L ,Q>L+Q>L.Q?Lp.Q@?LȧQH?L(}VP?LzQX?LQ`?L.Qh?L-Q(@L0Q0@LX0Qp@L0Qx@LAV@LzQ@LpQ@L/Q@L/Q(AL1Q0AL01QALzQALnVALnVAL0Q(BL4Q0BL(4QpBL3QxBLAVBLzQBL0QBL3QBL2Q(DL`7Q0DL7Q8DL6QpDL6QxDL(}VDLzQDL(EQDL@6QDL5QEL:QELP:QEL:QFL9QFLAV FLzQ(FLDQ0FLx9Q8FL8QxGL=QGL=QGL=QGLVGLzQGLaQGLR`L,RLp{VLhRȻLX,RлL0,R(L-RpLFRxL(}VLhRL-RL>RL0RL/RPLhRXLR`LRhL@/RL4RL1R@LBRHL(}VPLhR`L0RhLp0RLPVL@U@LPCRHLhVPLhRXL05R`L@1RhL@UȿLPVпL1RLPDRLPV LhR0L1R8LCRL4RL2RPLp{V`LhRpLh2RxL02RL}VLGRPLp{V`LhRpL83RxL3RL4RLGR@LFRHL(}VPLhR`L3RhL3RL@6RL5R0LhR8LR@LRHLp5RL8RLX8R LBR(L(}V0LhR@L8RHL7RL9RL@UL9RLAVLhRLP9R L 9RL:RLp{VLhRLp:RL>RHL=RLp{VLhRL=RL`=RLh?RXLFR`L(}VhLhRxL?RL>RLxARLAR0LhR8LhR@LhRHL@RLRLBR LBR(L(}V0LhR@L BRHLARLPVL@U LPCR(LhV0LhR8L(HR@LBRHL@ULPVLDRLPDRLPVLhRLCRLCRLRLxER0Lp{V@LhRPLERXLDRL}VLGR0Lp{V@LhRPLERXLERL}VLGRLFRL(}V LhR0LhFR8L8FRL0IRLHRLhRL RL RL`HRLNRLMRL[RLAVLhRLxMRL@MRLPRLORLpORLhVLhRL ORLNRLxQRL@QRLRL(}V LhR(L؝R0LPR8LPRLSRLp{V(LhR8L0SR@LSRL}VLsRLRLAVLhRL8TRLSRLpRL@R LR(LAV0LhR@LTRHLpRLPVLp{VLhR(L(UR0L SLPVLRLXRLhVLhRLhURLИRLRLRLhRL(}VLhRLURLЙRL(WRLVRLhRLRLRL0VRL[RLP[RL[RLAVLhRLZRL`ZRLPVL@U8L`\R@LAVHLhRXL\R`L[RLeRLPeRLeRLdRLV LhR0L@dR8LbRLplRLkR LkR(LV0LhR@L0kRHLhRLoRLXoRLoRLhV LhR(LR0LnR8LnRLrRL@rR Lp{V0LhR@LqRHLqRL8tRLsR0LR8LAV@LhRPLsRXL`sRLRLuRPLPuRXL(}V`LhRpLuRxLtRLPVHLp{VXLhRhLuRpL SLpRL@RLRLAV LhR0LuR8LpRLPVLp{VLhRL8vR L SxLPVLRLXRLhVLhRLxvRLИRxLRLRLhRL(}VLhRLvRLЙRLxRLxRLhRLRLRLwRL@|RL{RL{RLVLhR LP{R(L{RLPVL|R L}R(L(}V0LhR@L|RHLp|RLPVL}R L}R(L(}V0LhR@LX}RHL }RLPVL~R L~R(L(}V0LhR8LR@LH~RHL~RLRLR Lp{V0LhR@L8RHLRLPVLp{V LhR0LR8L SLPVLȀRLRL(}VLhRL8RLRLPVLRLRL(}VLhRL؝RL(RLRLPVLȕRLp{VLhRLRL0RL}VLRLRLAV LhR0LR8L0RHLpRPL@RLRLAVLhRL0RLpR0LPVxLp{VLhRLxRL SLPVLR@LXRHLhVPLhR`LRhLИRLRLR@LhRHL(}VPLhR`LRhLЙRLRL R`LhRhLpRpLpRxLRHLRPL@RLRLVLhRLRL0RMPVMhRM`RMhVMhRMRMRMPVMRM`RMhV MhR0MR8MRHMXRPMRMRMhVMhRMRMpRMRMRMRMhRMAVMhRMRMRMPV Mp{V0MhR@MRHM SMPVM8RMRMAVMhRMRMPRMRMR0MhR8MhV@MhRHM؝RPMRXMRH MPVP MȕR Mp{V MhR MxR M0Rx MPV M@R MR MAV MhR MR M`R MpR M@R MR MAV MhR MR( MpR MPV Mp{V MhR MR M Sh MPVp MR MXR MhV MhR MR MИRhMRpMRMhRM(}VMhRMRMЙRxMRMRMhRM8RM8RMPRMhRMRMRMhRM@UMhR(MRhMRpMRMPRMVMhRMRMRMRMHRMR@MxUPMhRXMR`MRhM0RMRMxR0MxU@MhRHMRPMRXM0RMRMxR M@R(M(}V0MhR8MPR@MPRHM@RMRMشR0MR8M(}V@MhRHMRPMRXM@RMRM`R@MxUPMhRXMR`MRhMRMRMHR0MxU@MhRHMRPMRXMRMRMRMPR MPR(MV0MhR8MhR@MhRHMR8MȽR@MRHMPRMRMVMhRM0RM0RMpRMRMpRMHRM(}VMhRMRMRMRMRMpRM(RMhVMhRMRMRMRMRMRMRMhRM0R!MPR"MRP"MRX"MR`"MRh"MR"M R#MRP#MRX#MR`#MRh#MR#MR$MRP$MRX$M8R`$M8Rh$MPR$MR%MhRP%MRX%MR`%MRh%M R%MXR&MR&MRP&MRh&M0R(MPV0)MS8)MHS@)MHSH)MR)MPV)MS*M0Rp*MPV*M0S*MS*MS*MS*MXRH+MPVX+MS+MS+M S+M S+MR(,M8R0,MRp,MRx,MV,MS,M(rU,M(rU,M R-M}V-Mp{V-MS-M`R-MSH.M8RP.MR.M:S.M(}V.MS.MR.M@:SH/MRP/MpR/MS/MS/MS/MS80MPVH0MR0Mp{V0MS0MHR0MR1MR 1MHR`1M:Sh1M(}Vp1MS1MR1MR2MR 2M Rp2MSx2MxS2MxS2MR3MR 3MS`3MyVh3M(}Vp3MS3MhR3MpS3MpR3MS04MpS84MhV@4MSP4M(RX4MS4M R5MS5MHS@5Mp{VP5MS`5MRh5MS(6M0R06MRp6M:Sx6M(}V6MS6MR6MPR(7M`R07MR7MS7M@S7M@S7MpR88MPV@8M8R8Mp{V8MS8MR8MR9M8R 9MR`9M:Sh9M(}Vp9MS9MR9M`R:MHR :MRp:MSx:MS:MS:M`R;MxR ;MS(;MS`;Mp{Vp;MS;M(R;MR;MPV8MS>MдS >MдS(>MR>MS>MxS>M8S?Mp{V?MS ?MS(?MS?MHS?MS?MS@MyV@M(}V@MS@MP S @MS(@MpS@MS@MS@MS@MpS@MhV@MS@M SAMpSAMSAMSAM@SAMSAMp{VBMSBMSBMSBM0SBMSCMhS@CM:SHCM(}VPCMS`CMShCMSCM SDM SPDMSXDMS`DMShDM SEMPVEM0SPEMp{V`EMSpEM SxEMSEM SEMx S FM:S(FM(}V0FMS@FM SHFM@:SFM SFMP S0GMS8GM`S@GM`SHGM SGMSGMS HMp{V0HMS@HM SHHM SHMPVHMp{VIMSIMHSIM SxIMhSIM(SIM:SIM(}VIMSIMSIMSxJMxSJMSJMSJM(SJM(SJMSpKMPVKM0SKMp{VKMSKMSKMSHLM8SPLMSLM:SLM(}VLMSLMSLM`SHMM8SPMMSMMSMMSMMSMMpS8NMS@NMSNMp{VNMSNM8SNMS OMS(OMShOMyVpOM(}VxOMSOMSOMpSOMSPMS@PMpSHPMhVPPMS`PM(ShPMSQMSQMSQMHSPQMp{V`QMSpQMSxQMS8RMS@RMSRM:SRM(}VRMSRMPSRMS8SM0S@SMSSMSSMSSMSSM0SHTM}VTMp{VTMSTMSTMSUMS UMS`UM:ShUM(}VpUMSUM0SUMSVMS VMPSpVMSxVMSVMSVMSWMpuSPWMHSXWM(}V`WMSpWMSxWM9SWMH SWM S XM:S(XM(}V0XMS@XMSHXMpSXMX!SXM S0YMS8YMPS@YMPSHYMp SYM"SYM@"S ZM:S(ZM(}V0ZMS@ZM!SHZM!SZMh#SZM#S0[MS8[MS@[MSH[M"S[MPV[M@U\M $S\M(}V\MS \M#S(\M#S\M %S\M$S\M:S\M(}V\MS\M$S\MP$S]M8&S]M%S]MS]MS]MS]MP%S^M()S^M(S^Mh(S^M.S^MS^M(S^M`'S8`M+S@`MP+SH`M+S`M*S`MXT`MS`M*S`M)S(bM8-S0bM,SpbM`}VxbM(}VbMSbM,SbM,ScM/ScM/ScM(/ScM.ScMScM.ScM.S(eM2S0eM1SpeMXSeMSeMSeMSeM@1S(fMPV0fM3S8fM3SpfM3SxfMXTfMSfM03SfM2S(gMp6S0gM6SpgM5SxgMTgMSgMpSgMpSgM`5ShMX9ShM8ShM8ShMShM8ShM8ShM 8S8jMpuSjM:SjMAVjMSjM9SjM9SkMP;SkM;SPkM:SXkM(}V`kMSpkM:SxkM@:SlMhSoMUoM(}VoMSpM>SpM=SpM?SpMx?S0qM8?S8qMAV@qMSPqM>SXqM>S(rMPV0rM@SprMUxrM(}VrMSrMH@SrM?SxsM8BSsMpsSsM(}VsMSsM(sSsMASsMASXtMPVhtMBStMIStMXTtMStMBStM`BSHuMCSPuM@GSuMUuMTuMSuMpCSuM CSxvMESvMDSvMAVvMSvM0TSvMDSvM@DSXwMPVhwMFSwMESwMAVwMSwMESwM@ESHxMGSPxM@GSxMGSxMAVxMSxMFSxM`FSxyMPVyM(JSyMHHSyMXTyMSyMGSyMGShzM8ISpzMKSzMUzMSzMSzMHSzMHS{MPV{M(JS |MIS(|MXT0|MS@|MISH|M`IS|MKS|MKS}MU}MT }MS0}MJS8}MPJS8~MPV@~MKS~MU~M(}V~MS~MKS~M0KSMQSMQSMPQSMVMSMTSMQSM PShMUSpMUSMSȁMбSЁMбS؁MpTSMWSM@UMyVM(}VMSMVSM@UpMWSxM@UMyVM(}VȃMS؃MWSM@UHM@YSPMYSMyVM(}VMSMVMXSMpXSXM0[S`MZShMZSM_SMAVMSM8TMhZSȅMZSM\SM`\SMSMp{VMSM\SM[SMPVMP]SM_SMAVMSM]SM\SMPVM^SM_SMAVMSM]SMp]SMPVM_SM_SMAVMSM^SM0^S8MPV@M8`SM_SMAVMSM_SMP_ShM8cSpMbSMSȌM`SЌM`S،MbSMPVMSЍMzS؍M(}VMSMcSMXzSXM eS`MShMdSMHSMAVMSMdSȎM`dSHMSPMSXMeSMzSM(}VMSMeSM@eS8MgS@MfSMp{VMSMfSM`fSM8hS MhS`Mp{VpMSMgSMgSM`iSM0iS@Mp{VPMS`MhShMhSؒMPVM jS MU(M(}V0MS@MiSHMiS8MplS@MkSMSMHhUMHhUMPkSXMPV`MySMpmSM(}VMSM mSȕMlS8MPV@M(nSMp{VMSMmSMmS(MXoS0M(oSpMp{VMSMnSMnSMPpS MoSpMSxM(SM(SMoSMPV MsS`MpsShM(}VpMSxM(sSMpSMrSMPVMyS@MzSHM(}VPMS`MqShMpSؚMPVMySMqS Mp{V0MS@MqSHM`qS؛MhrSMvS0MS8MS@MSHMrSȜMPVМMsSMpsSM(}V MS(M(sS0MrS8MrSMpuSM8uSMtSMtSMVMSMhtSMtSȞMPVОMyS؞M0vSMzSM(}V MS0MuS8MuSM wSMvS@MSHMSPMSXM`vSؠMSMyS MxS(MhV0MS@MwSHMpwSMPVMySMxS@MzSHM(}VPMS`MxShMPxSMySMxyS`MShMSpMSxM0ySMPVMS0MT8MAV@MSPMzSXMXzSMPVMSMzSM(}VMS MzS(MXzSMH}SM}SM|SХM|SإMhVMSM8TMH|SM{SMXSMSM~SMTMAVMSMPSM~SM ~SاMSMSMS Mp{V0MS@M0SHMSMSMS0MXS8MV@MSHMVPMSXM`SMSMSMxSMHSMAVMSMUMSMSMSMPSMSMxhUMxhUMSMPVȬMhSM SM(}VMS(MpS0MSMSMhSMSMhSMAVMSMSMSMSMSMAVMSMhSM SMPVMSMUMȌSM(}VMSMxSM0SM`SMSȰMЏSMSMPVMSM!T M@S(MpShMSxM`SM0SMXTMSвMАSزMShMHSpMSMyVMSMSгMSسMpSXMhS`MؔSMSMHSMHSȴM`ShMSpMSM@SMSMSеMSصMPSMКSMSM@SM0TMSMؙSMSMSMSMXSMSMȯSMȯSMSMSMȜSMSMSMSMSpMPVxMhSM(SMAVȹMSعMPSMS@MPVHMhSM SM(}VMSMȝSMSMSMhSXM(S`MAVhMSpM VxM؞SMSMSMS0MyV8M(}V@MSPMXSXM SMhSM0SMS0Mp{V@MSPMSXM`SMSMS@MSHMAVPMS`MPShMS8MS@MSMhSMAVMSMSMФSXMSM`SMAVMSM8TMSMЦS8MS@MSMyVM(}VMSMVMSM`S(MPV0MSpMЩSxM(}VMSMxSM@SMxS MЫSpMSxMXSMXSM0SHM0SPM`SMSMShMPVpMSM8SMAVMSMSMSHMSPMSMp{VMSM8SMSHMPVPM@SXMSMSM(}VMSMSM0SM SMSMSMUMUMShM}VpMSxMSM@SM@UMSMSMpSMHSMSMS0M@S8MhV@MSHMSPMSXMSM(SMS@Mp{VPMS`MShMSMSMxSM0SMSMVMSMSMShM(SpMSMSMpUMpUM`SXMxSMp{VMSM(SMS(M}V0MSpMSxMhVMSM@SMSMS MSpMSxMUMUM`SMSMXSPMShMSM0S MS(MqT`MUpMSxMUMUMS8MS@M(SHMSMTM(}VMSM UM UMSMHSMSMSMSM(}VMSMUMUMSMSMpSM0S@MTHM(}VPMSXMT`MThMSXMS`MSMXSMSM]TM]TMSXM0S`MSMXSMSM]TM]TMSXM@S`MSMXSMSMx]TMx]TMSXMS`MSMXSMSM@]TM@]TMSXMS`MXSMSMVMSMЎTMЎTM`SM0S MS`MShM(}VpMSxM`TM`TM`SHMSPMXSMSMhVMSM]TM]TMSxMSMXSMSMhVMSM\TM\TMSMSMSMHSM@UMSMTMTMpSXMS`MSM8SMVMSM0TM0TMSMSMHS@MSXMpS(MS0Mh^TpMUMWTMUTMUTMSMS M0S`MShM(}VpMWTxMUMUM0S8MS@M(SMx_TMWTMUMUMSMT M8T`MThMhVpMWTxMTMTMPTMTMTMTM0TMTMWT(MTM TM TMH TMhVMWTMpT MpT(M TM0TMTMXTM8VMWTM8TM8TM ThMTpMTMHTMVMWTMTMTMT(NT0NfTpN8hTNWTNTNTN0TNTNxTN8hTNWTNTNTN0TxNTNxTN8hTNWTNUNUN0TXNT`N ThNTNTN(}VNWTNȡTNȡTNpTNTNHpTNU NWT(NȡT0NȡT8NTNqTNHqTNqTNTN(}VNWTNT NT(N`TNTNT NT(NV0NWT8NhT@NhTHNT NxT NT NT N0T( N@U0 NWT8 NU@ NUH NT N)T N)T N`(T N'T(N'T0NWT8NT@NTHN #TN,TN0,TN+TN8VNWTNPTNPTNP*TXNp.T`N8TNTN(}VNWTNPSTNPSTN-TN/TNx/TN8/TPNU`NWThNVpNVxN.T8N83T@N2THNP2TN2TNVNWTN`RTN`RTN1TxN6TN`6TN5TN5TNPVNWTNRTNRTN4TN=TNNPoT`>NnT>NnT>NhV>NT>NU>NU>N nT?NpT?NHpT @NU0@NT8@NȡT@@NȡTH@NpT@NqT@NHqT@NqTANU ANT(ANT0ANT8ANpTANuTANtTANtT0BNHtT8BN@U@BNTHBNhTPBNhTXBN0sTDN{TDN{TDNzTDN zTDNVENTENUENUEN@xTHNTHNTHNpT0INT8INT@INTHINTPINTXIN~TLNȅTLNXT MNT(MN8V0MNT8MNPT@MNPTHMNЃT(ONT0ON8TpONTxON(}VONTONVONVONTPNXTPNT QNȈT(QNhV0QNT8QNT@QNTHQN`TRNpTRN،TRNTPRNTXRNV`RNThRNTpRNTxRNPThUNhTpUNTxUNPTUNTUN8VUNTUNhTUNhTUNTxXNTXNTXNTXNXTXNTXNTXNВThYNPTpYNTxYNTYNxTYN8TYNTYN0TYN0TYNT\NT\NxT\N0T0]NTH]NT^NPV_NT@_Nx6VP_NxUX_NpU`_NpUh_N@T_NT_NT_NPT `N T(`N(}V0`NxU8`NpU@`NpUH`NT8aNPV@aNTaNTaN(}VaNxUaNXnUaNXnUaNPTXbNT`bNhThbNTbNTbNPVbNxUbNPlUbNPlUbNЭTdNpTdN(TdNTeNTeNAVeNxUeNlU eNlU(eNTxfNTfNTfN@TfNTfNhVfNxUfNkUfNkUfN`THhNTPhNTXhNThNThNThNxUhNxkUhNxkUhN@TmNTmNPTmNTnNxTnNVnNxUnNkU nNkU(nNTpN@TpNTpNTPpN`TXpNVV`pNxUppNTxpNTqN@TqNTqNTPqNTXqN`T`qNxUpqNTxqNTrNXT rNpT(rNT`rNThrNTprNxUxrN@jUrN@jUrN@TwNTwNTwNTwN(}VxNxUxNjUxNjUxNXTxN0TxNTxN8TxNAVxNxUxNiUxNiUxNTxyNTyN`TyNTyN(}VyNxUyNiUyNiUyN TXzN T`zNTzN8TzNAVzNxUzNiUzNiUzNTH{NTP{NxT{NT{N(}V{NxU{NPiU{NPiU{N@T(|NT0|NxTp|N8Tx|NAV|NxU|N iU|N iU|NT}NT}NT}NTP}N8TX}NV`}NxUh}NhUp}NhUx}N ThN`TpNTxN0TNTNhVNxUNhUNhUNT؁NPVNT NHT(NPV0NxU@NTHNTNPVNTNT0NT8NAV@NxUPNPTXNTHNPVPNTNTNAVNxUNTNpTNPVNTNTЅNxT؅NAVNxUN(TNT؆NPVN(TNT NT(NAV0NxU@NpTHN TNPVNTPNp{V`NxUpNTxN`TNTNTNT@NhTHN0TPNxU`NThNT(N`T0N TpNTxNTNxUNpTNThNPVpNTNp{VNxUЋNT؋NTHNPVNTNAVNxUNUNTN@T(NPV0NUpNUxN(}VNxUN8UNUNPV NU`NpUhNAVpNxUNUN@UHNPVPNUNpUNAVNxUN UNUxN@UNUАNxUؐNhUNhUN0UNUNUNUNxUN` UN UNUȒNPVВNUNUN` U NxU(N( U0NhU8N0UNpUNUN UN` UNxU NU(N`UN UN UPN UXN` U`NxUpN UxNUNP UN U@N UHNH UPNxUXNgU`NgUhN UN UN UNUN(}VNxUNgU NgU(Np UN0UNUNUNxUN0gUN0gUNPUؙNUNU NU(N(}V0NxU8NfU@NfUHN@UȚNPUКNUNUNHU NxU(N(fU0NU8N`UNUNU@NUHNHUPNxUXNPV`NUhNU(NU0NUpN@UxNUNxUN`fUN`fUNUhNUpN@UxNUNUN@UNxUȞNPeUОNPeU؞NUhNUpNUN)UNAVNxUȠN eUРN eUؠN@UXNU`NUNh,UNhVNxUNdUNdUȡNPUHN!UPN!UN)UNAVNxUNdUNdUN`!U8N$U@N#UNh,UNhVNxUNdUNdUN#U(N%U0N%UpN)UxNAVNxUNXdUNXdUNp%UN'UN'UPNh,UXNhV`NxUhN(dUpN(dUxNp'UNh*UN8*U@N)UHNAVPNxUXNcU`NcUhN)UئN,UN,U Nh,U(NhV0NxU8NcU@NcUHN,UȧN1UЧN1UN0UNV NxU(NcU0NcU8N/UNPV N3U`N2UhNAVpNxUN2UNP2UN 5UN4U@N4UHN(}VPNxU`NH4UhN3UPNPVNp{VNxUNX5UNxFUNPV NpGU`N`}VhN(}VpNxUN5UNFUNPVN6UPNh6UXN(}V`NxUpN6UxN5UNPVN7U@Np{VPNxU`N87UhN7UNx8UN8U@NxUHNXcUPNXcUXN7UذN:UNP:U N9U(NV0NxU8N(cU@N(cUHN`9UXNx?U`N?UhN>UN>UNAVNxUNbUNbUȲN=UN@UN@UдNp{VNxUNH@UN@UXN0BU`NAUNAUN(}VNxUN`AUȵN AUXNCU`NpCUNxUN`bUN`bUȶNCUxNPVNPEUNEUȷNhVзNxUNDUNpDUhNPVpNHFUNp{VNxUиNEUظNEUpNPVNp{VȹNxUعNFUNxFU8NPV@NpGUN`}VN(}VNxUNGUNFU(NHU0NHUpNp{VNxUNhHUN HUHNIUPNIUNxUN bUN bUN0IU8N MU@NLUNLUNAVNxUNaUNaUN0LUXNH}U`NyUhN0yUNxUȾNrU8NȂU@NxUNHUN@VN@UN@UNUhNPVpNhUxN UNUN(}VN@VNUNUN`UNUNUNpUPNHUXN(}V`N@VhNUpNUxN UNUN0UPNUXNhV`N@VhNUpNUxNPUNUNxUN0UNUNhVN@VN`UN`UN`UHN8UPNUXN`UNȖUNUN@VN(UN(UNUNUNUN0UNUNPV N@V(NU0NU8NUHNСUPN`UN@VNUNUNUxNPVNUN`UN@VN0UNUNUN0UNȦUNUNAVN@VNxU NxU(NU(NЪU0NhUpN(UxNAVN@VN@UN@UNpUNUNUPN@VXNU`NUhN@UNЮUNU0NXU@N@VHNUPNUXNUNUNUPNXUXN(}V`N@VhNUpNUxNUhNUpN UNUNVN@VNPUNPUNUHNUPNUN`UNAVN@VNUNUNUNUNUNUN@VNUNUNUN8U NU`NHUhNAVpN@VxNUNUN@U(NPV0N(UN@VNxUNxUNU(NPV0NU8NUpNUxN`UN@VNUNUNU8NU@NUHNUN`UN(UN@VNUNUNUNUNU@NUPN@VXN8U`N8UhN@UNPVNUNU N`U(N(}V0N@V@NUHNUNUN UNU@NHUHNUPN@VXNU`NUhN0UNPUNUN0UPNUXNAV`N@VhNUpNUxN0UXN U`NUhN0UNUNAVN@VNUNUN0UNUNUNUN(}VO@VOVOVOUOPUOUPOU`O@VhOUpOUxOPUOU OU`OUhO@UpO@VxO(UO(UOUOVOVO@VO0V OV O` V O'V( O"V0 O"V8 OV OV O` V O'V OX"V OX"V OVh OVp OXV O` V O'V O0 V O0 V O0 VX O`V` O(V O` V O'V O V O V O0 VH O0VP OV O` V O'V OV OV O0 V8OV@OVO` VO'VOVOVO0 V(O V0O VpO` VO'VOhVOhVO0 VO V Ox V`O` VpO'VxO8VO8VO0 VO VOh VPO` V`O'VhOVpOVxO VO V8O` VHO'VPOVXOV`O( VO VO` VO'VOV OV(O( VO VO` VO'VO`VO`VO( VHOVPOVOpVOVO'VOVOVOVO*VO((VO'VO'V(O$VOX.VO.VO-VOgVOdV OdV(O-VO1VO0VO0VOhVOgVOcV OcV(O/V(O5V0OX5V8O5VpO4VxOhVOgVOcVOcVO 4VO=VOX=VO=VOVO>VH OPVP O0@V Op{V OgV O?V O?VX!OPV`!OBV!OAV!OAV!OgV!O0AV!O@Vh"OHCVp"OCV"Op{V"OgV"OIV"OBV"OpBVX#OPJV`#OIV#OgV#O0cV#O0cV#OIVX$OOV`$O@OVh$ONV$ONV$OV$OgV$O(NV$OLV8(ORV@(OQV(OQV(O(}V(OgV(OPQV(OQV8)OPSV@)ORV)OgV)ObV)ObV)ORV*O UV *OTV`*OTVp*OgVx*OhTV*O TV*OSV+OPV`+O@VVh+OVVp+OgV+OUV+OUV+O0XV,OXV@,OWVH,OWVP,OgV`,OPWVh,OWV,OPV-O YV@-OXVH-O(}VP-OgV`-OXVh-O`XV-OPV.OZV@.OYVH.O(}VP.OgVX.O ^V`.OYVh.OPYV.O]V/O\V@/OX\VH/OhVP/OgVX/O]V`/O\Vh/O`[V0O`V0O_V@1OgVH1ObVP1ObVX1O_V1O@iV2OHhVP2OgVh2O`gV3O(kV3OjV04OPrV84OmV@4OmVH4OjV4OhsV4OrV 5OPrV85OqV86OPV@6OtV6OuV6O(}V6OV6O@tV6OtV87OPV@7OHvVH7OvV7OuV7O(}V7OV7OuV7OuV8O}V8OwV9O`}V9O(}V 9OV09O@wV89OvVX:OxV`:OxV:OV:OV:OV:O@xVH;OPVP;OyV;OyV;O(}V;OV;OpyV;O0yVHO`}V>O(}V >OV0>O|V8>O|V>O~V>OX~V@?OVH?OVP?OVX?O~V?OHV?OV@OxV@O8V @OV(@OV0@OV8@OVxAOVAOVAO0VAOȃVAOVAOVAOhVAOhVAOVhCO0VpCO8VxCOVCO VCOVCOVCOVCOVCO0VHOVHOPV IOV(IOV0IOV8IOhVIOVIOhVIO VIOЗVIOVIOVIOHVJOHVJOЖVKO VKOV LOV(LOPV0LOV8LOV@LOVHLOVMOVMO8VMOVPMOVXMOhV`MOVhMOȸVpMOȸVxMOVOOHVOOاVOOVPOOHVXOOV`OOVhOOVpOOVxOOpVQOV QO0V(QOpV`QOVhQOVpQOVxQOPVQOPVQO V8UOV@UOVUOVUOVxWOVWOPVWOVWOHVWOHVWOpVHXOVPXOPVXOVXOVXOVXOpVYOV YOPVpYOVxYOVYOVYOVYOVYOV@ZOVHZOVPZOVXZOpVZOVZOHV [OV8[OV[OV\OVP\OVX\OV`\OVh\OpV\OXV\OV0]OVH]O@V]OPV^OV0^OV^OPV^OV^OVX_OV`_OV_OV_OV_OV_OpV8`O V@`OV`OV`O@V(aOV0aOVaO8VaOVbOXb1bO+@bO>HbOXXbOX`bO\>xbODbOhb1bO-bO0=bOXbOXXcOT1cO(cOxdOX@eO`e1XeOPG(eO$efOb"fOXfOCfOؕ/ gOC(gOx'1pgOg1gOp,.gO^gOXgOXhO`<hOT,hOD@hOXHhO8XPhOpXhO@hOA1iO0 /iOx.(iO/8iO`1HiO1XiO1hiO1xiOM/iO1iO1iO` 1iO@D0iOH1iO1iO1iOh1jO`<0jO0(jO08jOx0HjOX0XjOB1hjO.xjO B1jO(B1jO@.jOБ.jO/jO8B1jO/kO\1(kOlkOqlO[1lOPmOrPnO[1hnO)nO8XnO XnOPtnOoO@+oO oO@XpoOoO1pOpOqO1qOPXrO0sOY1tOX/tO̕(uO(XpuO txuO8uO;pvO.0vO̕vO(XwO twO88wO;xOX/(xO̕hxO(XxO txO8xO;yO1yO\PzOSxzOP{Oȉ1h{Ow#{OW{OQ.|Ob |O!Y|O[1}O}OLr~OC~O/~OC~Oh'1OC Ox'1`OChOȻ/OCOh'1OCO8&08OC@O/OCO8&0ȀOCЀOh'1OCO8&0XOC`Ox'1O1OHOpQ.PO$T.pO<xO@4YOVOOOPhO`VO0^POOІOSOVOO0OS@OVHOPOXOOOhOO@OO^POpOOO O^V(OV`OOhOPpO%KxO&KO'KЌOO،OOO^POOOOXO@)K`OOPO@OXOU`OhOO8T O@O(O8T8OS@O^PHOpOOPOO@OO(OOtVOtVO@OO(O OOO(OOU@O]PHOP*KPO+KXO,KhO .KpO/KxOPV0OO8OxZVhOOpOxZVO]POUOOO0^POOOxZVHOxOOOOVOxZVOXOO@]PȚOOКO2KؚO2KOP4KO]PPOOXOPO`OOПOO؟OOOPOOOOOOOOxZVOOxO\POhOO8OСO^PءOZVOxZVOȠOOhOOO OO(OO0OPO8OOO\PO^POȨO OU0O]PhOOO^POȨOO@]PȧOxZVOOO]POhOOPOOO@OOXOpO8OOO^POȨOOxZVOxzVЪO8TتOOOhO OO O0O(OpOحOOOPO O\P(O0O0O8K8O:K@OP;KHOp>KPOAK OxzV`OOвOOزOpOOPO0OX\P8OO@OCKHOCKPODKXOFKOQ OOO[POQOOOPOOPUV(OOO\POGKOHKOJKOOOhdV O#P(O]P8OP%PPOxZVXO(OػOhdVO#PO]POtVO^POX\PO\PO^POO OP%PPO@O`OKKOxZVpO[PxOPOO]POhOOSOȾO(O0UpOOO`VOUOȋVOVO0OOOOO OXVO`V OPqU(O0V`OOhOx6VO(OOOOpOO SKO:VO(O0OhdV8OMP@O0VxOOOx6VO(OOOOP0OO8O0UK8O:VHOVOQOȌVOTO@fVO`VO0ZPOYPOOO@OXOV`OVO`ZPOVHOOpOOxO OOhUOPOOVO [VOQOVO [VOVOpPOhOOV OVpOOxOOOPOOOOTOUOLQ`OVpOVOVO POVO@U8OhOHOpPPOqVXOR`OrQ8OVhOhOOVOVOpO0OpPOP>VOpPO [VOQ`O@IVhOVpO OO POqVO OOOOZKO[KO]KO0`KOaKObKOcKOdKOVOQOdVO}TOV OqV(OR0OdV8OQ@O0VHOqVxOOO(!PO QOTVOkQOQOHUPHOVXOVhOPpOVxOV(OVPO~VXOqUhOqVpOpPxOVOVO(!POPOV OIV(OV0OnV OV(OV0OV8OqV@ORHOnVXO/QO POVO~VO~VOVOVO ^VO0VO`^POZPOOO ^VO]VOOhOVxOVOVOqVOnVOqUO/QO POO(OO8OO@OhUHOPOPO OOVxO\PO`VO0VOVOVOZPOVO_POQOȌVO5QOQO]VO8T OO(OO0OXO8Ox6VHOOXOUP`O]VhOOOVOVOQO`VO8TOVOV OVOVOVOVO_POQOȌVO5QOYPOfVO`VOV O0V(O]V0OtV8O8T@OQxO]VOOOOOx6VOO@O\PPOYPOOOVVO:VOhdVOOO@fVO(!PPVP`VPPqUP0VP(QPhdVPO0P8O8PO@Px6VP(QPhdVPPPHPPPPPPPP(!PPX^VPVP^VP ^VP]VP[PPЉV PQ(P-Q0PQ`PxqVhPPpPPP0KPPKPЃKPȄKPKPXKP`V PVV PV Pp-R PP PP PP P [V PP P8T PV PhdV PP P P P`V PP PVP VPV(PU0PP@P PxP0PPPPpPPPPVVP:VPPP PPPP`VPPPVPxUPȋVP UP UP`VPXmQ8PPPPQXPVPPPVVP:V PxR0PP8PP@PVPPPP(QPhdVPhPP@fVP(!PP PP`VPPP [VPVP VPHUPPpPXPVP`^PP [VPV P(PPVPP(QXPhdV`PPPhPФVPVV P:V0PxR@PPHPPxP-QPhdVPhPP0PPPP8TPxPPhdVPPP0PP0P8PPVVP:VPhdVPPP@P"P(!P"PX^V"P P"PV"P^V"P ^V"P]V"PQ"PX[P"PЉV#PQ8#P@qV@#P0 PH#P PP#PK`#PpKh#PKp#PKx#PK#PpK#PK#PK#PЙK#PpuS#P`V$PhdV$P#P$P#Px&P%P&PhdV&PP%P&P$P'P@YP'P&P(PPK(P@KP)P;V`)Px(P)PP)P0V)P/V)P(P,PhQ,P*P,P;Q,PV,PVP-P`VX-PhQ`-P0Vh-PQp-PȌVx-P5Q-P@YP-PV-PV-P*P-P@*P-P*P0PV0PV0PV0P0V0P`/P0P/P0P.P0P.P1P0.P1P-P4PH>P4PH2P4P2P4P1P4PVH5PVP5P`V`5P(Qp5PVx5PXP5P0:V5PfV5PYP5P8T5PLP5PQ5PȌV5P5Q6PV 6P1P(6Px6V86PX1P@6P1P8PH>P8P`V8P XP8P\P8PXXP8P0:V8P6P9P6P 9PH6P(9Px6V;P;VP;PYPX;PfVh;PWP;P09P?PH>P?P>P?P=P?P=P?PVp@PV@PV@PV@P(Q@P0:V@P`V@P XPAPP0UPIVhUPQxaP_PaP^PaPQaP^PaPqVaPPaP`^PaPqUaP0^PaP]PaP]PaP]PaP@]PaPxzVaP]PaP\PaP\PbPX\PbP\PbP[P bP(Q(bPQ0bP[P8bPX[P@bP-QHbP [PPbPqVXbP@fV`bPZPhbPZPpbPfVxbP`ZPbP0ZPbPYPbPYPbPYPbPxqVbP@qVbP@YPbPfVbPfVbPYPbPXPbPXPbPXXPbP XPcPWPcPWP cPhWP(cP8WP0cPoQ8cPVPhcPpUPpcP0!KcP`"KcP#KcP$KcP0^PcP1KcP]PcP`5KcP@]PcPH6KcP]PcP 7KcPBKcP\PcPGKcPX\PcPKKdP\PdPpMKdPOKdPPK(dP8Q0dPQK8dP@TK@dPPVKHdP@WKPdPXKXdPeK`dPqVhdPHUPpdPgKxdPiKdPUPdPkKdPpKdPqKdPtKdPPxKdP0|KdPKdP KdPxqVdPKdP@qVdP0KdP@YPdPKePPKePKePTPePTP ePФK(ePK0ePPK8ePxTP@ePpKHeP KPeP@KXePK`ePKhePзKpeP@KxeP`VePPVeP}VeP0TPfPUgP`VgP(gPgPHwQhPU0hPfP8iP8hPpjPuQjP`VjPxUjPȋVjPuQjP vQkPxiPkPHiPkP0KkPXKlPqU lPsQPlP kPXlPPlPplPnPqUnPsQ@nPmPpPPpPHwT pPXnP(pPTpPPTpPHwQpPzPpPȋVpPvQpPPVpPUpPxQpPQpPT qPHqPrPP rPPPxrPQrPUrPxQrPHqPsPUsPplTuPpTuPxQ8uPsP@uP`KpvPHwQxvPUvPhuPwPwPHxP@QPxPUXxPTxPvPxPVHyPtQxyPxPyPV8zPHwQ@zP8THzPtQxzPyPzP@Vh{PHwT{PHwQ{PzP{PȋV{PPV{P(|P |P7T|PȋV|PxQ}P(|Ph~P`tQp~PxQx~P`}P~PQ~PHwQ~P8T~P}PȁPhPPHwQP8PPPPPPRȂPUPPP@kQP~PPȇPPPP0TPT(PT8PPpPQxPȌVPTPVPHwQPbUPQPVP`VPPPȏPȊPRPVP`PPVPsQPpVPPP(tQ PxQ(PQ0P`P8PHsQhP8PxPȃPPhPPxPP(PP0TPPPPPHPPP PP(PP0PpP8P8PhP`VpPPxPȏPPRPHwQPbUPQPPPUPxQPȋVPQДPHsQؔPVPPPsQP`PPUPQPpV@PȍPPPxPhP0PxPPPPPPPPPPȋPPHQPTPؖPPPxPVP@UPdVPRPVPQTИPPPPPPVP8UPpVPPeVPRPpVpP@QxPTPUP PP@kQxPPUVP0VPPPțPPx6V(PU0P@VhPVpPLPPVPPP PPPPPPPȟPP KPKPPVhPQpP PPeVPQȧP0VاPPQPQPP(P`P0PГV8PpPHPP`PТPhPPЫPQثPQPQ PQ0PQ8P0VhPPPPPQPpPPdVPQP0VPP0PPPHQPPPPPQXPQhPxQxPQPhdVPPP0VPPȲPPвP@PزPQPPQPQ0PS8PeVHPtQPPPQXPPPPPdVPPPPSXPeVhPtQxPPQPPPPPh-VP PPP(PPXP PhPRxPpPPxRPȶPPPPVPVPVPOQȽPHQнPQؽPU`PVhP QpP0VxPHwQPbUP(tQPUPqVPpPPoQPPVP8UȾPVоPpQؾPQPVPQ PP8P Q@PPPPQ0PP8PV@PVHPPPPVPVPVPQPȌVPTPPPP PV(P`P(PwQ0PP8PpP@PUHP0PP:VPPPPVVP:VP(PPPPPPXPHP`PPpP`VxP0UPPPwQPPPUPUPPPVVP:V8PV@PHQHPVPPP@QPUPoQPPVP8UP@fV PPPPPHPPxwQPoVPPP^VPPPX^VPPPVPoVP0PPP PXP(P(P0PK8PpKHPpKPP`VP:VPxPP@PPQP QPPPV8PXPPЉVP0VP(Q PФVXPPhPPPpPPpP-QPxPPQP ^VP]VPQPQPPPPKPK PK(PLPUP8PPPPPPPPQPPPPPQ0PPP8PPP:V`Ph-VhPVP QPXQPUP0VPeV PP(PP0Px6V8P(PpP(QxP0VPxPPФVPPP8PHQ@PPHP:VPPPXPQ`Ph-VhPdVpPhQxP0QPHQPUPQPPPPhP QpPPeVxPQPqUPXQPQPSPhdVPHQPdVPeVPQPqQPQPqQP0VPPQPUPRPPP`VPhP P0qQ(PpqQ8PQhPPPPQPQPpQP@QPHPPPPPP(P PPP(PQ0PQ8PQHPPPPЉVPpQPLPLPLPLPPLPPPLPLP:V0PPP:V0PS8PHpQ@PQpPPPpQPPnVP`VPVPRHP PPPPPPQPPPpPP0rQPQP QPXQPpQPHpQPPPLPLPLPLPLPLPLHPPQpPUP@QPSP`SPXPP0PPPPHQ@PhrQHPQPQQPQPQPPQVPQQXQQTpQQxQHwQQXUQ0TQUQQQsQQPQPQP QPQQQQQQQnVQ(QQL QL(Q@kQ0QQ8QLQHQQ:VQQQ QQXQQQQqQ QSXQQhQQ0QpQQЉVPQnVXQ@Q`QLhQL Q0OS QV Q(Q QhdV Q Q QQ@ Q( QH Q Q@Q(QHQhdVPQ QXQQQ QQP QQUQ@QQ0QhQ:VpQ0QQQQ(5SQoVQQQ&LQQQQQxPQ ^VQ]VQQQЉV Q0rQ(Q QXQPnV`QQhQ LpQ!LxQ"LQ#LQ@%LQ'LQ(LQ)LQ`*LQQQ/QQ8UQ`&QQQQ2QQHQQQ Q`VQhTQQQQQV Q0Q8QQQQQHQQ&QQ`VQp:VQV Q8U(Q`&Q0QQ8Q2Q@QHQHQQPQQXQV`QVhQ/Q Q(&QP!Q!T"Q(&Q"Q/Q(#Q"Q#Q(&Q$Q/Q'Q2Q'Q&Q'Q`&Q'Q(&Q(QpQ (Q$Q0(QP,L8(Q-L@(Q.LH(Q/LP(Q2LX(Q3L`(Q4Lh(Q4Lp(Q5Lx(Q6L(Q7LP)QQ)QpQ)Q/Q+Q0V`+QФVp+QPQ+QhP.QQ.Q/Q.Q-Q.Q,Q.Q,Q/Q@/Q@0Q@/Qp0QQx0Q@/Q0Q/Q0Q.Qh1QQx1QЉV1Q ^V1Q]V1QQ1QpQ1QnV1Q9L1Q:L1Q;L1QpL2Q>L2Q@L4Q;Q4QBQ@4QqUH4Q`VP4Q8Q`4Q`tQh4QVp4Q0Qx4QpQ4Q2Q4QhBQ4QBQ4Q2Q4Q0Q4Q@Q 7Q`V(7Q0iQ07QQ87QȌV@7Q5QH7Q0Vx7Q05Q7Q4Q9QVV9Q;Qh:QHwQp:Q8Tx:QT:Q`V:Q8Q:QtV:Q(EQ:Q7Q(=QVV0=Q:VH=Q>QP=QTX=Q;Q`=QVh=Q;Q=QV=QDQ=QV=QV=QV=Q0V=QqV>Q ;Q >Q:Q @QVV(@Q:V@@QVH@Q>Qx@Q`V@QaQ@QV@QV@QpQ@Q(>QAQBQCQPUVCQBQCQhBQCQBQCQDQ(DQAQ8DQ@QHFQ^VPFQ0QXFQ(EQ`FQX^VhFQDQpFQaQxFQVFQDQFQHoVFQ@DQFQBLFQDLFQELFQ`GLFQ`ILFQKLFQPVGQ`VGQUGQ@QGQVhJQ`^QpJQIQxJQHQJQVJQNQJQHwQJQ8TJQ(tQJQ OQJQUJQVQJQ`VQ(KQHQ0KQ@ML8LQ OQhLQPKQhMQOQpMQ:VMQLQMQVMQkQSQ:VSQQQSQPQSQPQSQpPQSQ8PQSQPQSQ@QSQOQTQOQTQXOQTQVTQVTQ@QTQHwQTQ8TTQSTQUTQ OQTQaQTQuQTQ`VQTQ@UTQVQTQQUQNQUQQTUQaQUQQT UQV0UQQ8UQqV@UQVpUQPNQUQNQUQ8QUQMQ`YQWQhYQHWQYQhTYQ@QYQWQYQTZQHwQZQ(UZQ8T ZQT(ZQVQ0ZQT8ZQ`V@ZQxUHZQȋVPZQUXZQVQ`ZQUhZQ@UxZQuQZQ`VQZQUQZQUQP\QVVX\Q`^Q\QQT\Q0V\Q[Q\QZQ\QUh_QVVp_Q`^Qx_Q^Q_Q\Q_QYL`Q_QbQ0QbQaQbQVbQaQbQX^VbQhQcQoVcQ`QcQ0NLcQPL cQPL0cQQL8cQ`VL@cQZLHcQp[LPcQPVdQpQdQXcQdQVdQV(eQV0eQnV8eQnV@eQdVHeQ(tQPeQVXeQVeQTVeQ~V8gQxfQHgQ@fQxgQPnVgQhdVgQrQgQnVgQpVgQnVgQpVgQeQ0hQiQjQiQjQhiQjQHoQjQoQjQ`VjQ0iQjQoVjQhQjQhQkQHoV0kQhhQkQ@kQkQVlQV0lQPmQpfP mQUPmQUQH{QhdVX{Q`V`{QQh{QPQp{QxUx{QxwQ{QHwQ{QwQ{QxQ{QvQ{QQ{Q8U{QvQ{QpvQ{Q vQ{QuQ{QuQ{QHuQ{QuQ|QtQ|QQ|QQ|QQ |QQ(|Q@Q0|QtQ8|QQT@|QQTH|Q`tQP|Q(tQX|QsQh|QQp|QxQx|QsQ|QeV|QqU|QsQ|QeV|QHsQ|QsQ|QpV|QrQ|QoV|QpV|QpV|Q@pV|QPeV|QdV}QrQ}QhrQ}Q0rQ}QQ }QqQ(}QQ0}QqQ8}QpqQ@}Q0qQH}QeVX}QpQ`}QdVh}QpQp}QoVx}QQ}QpQ}QHpQ}QnV}QnV}QPnV}QpQ}QnV}QoQ}QHoV}QoV}QoQ}QHoQ}QoQ~QmQ0~QXmQH~Q0K`~Q8mQh~QmQp~Q Kx~QK~QK~QK~QK~Q K~Q`K~QK~QpK~QK~QpK~QK~QK~QK~QPK~QlQQ(QQlQQhlQQV Q8lQ(Q8Q0QlQ8QK@QKHQKPQKXQK`QKhQKpQKxQKQKQ KQKQKQkQQPKQKQ0KQoVQLQQQ LQpQQLQHpQQLQnVQLQnVQ@+L QPnV(Q8L0QpQ8QAL@QnVHQLLPQHoVXQ`\L`QoVhQp]LpQp_LxQ`LQpaLQkQQPVQpkQQxQQصV@QQxQUQUQUQTQUQV QV0QQ8Q@QHQQPQqVXQ@Q`QThQUpQVxQQQQQtVQ@QQQQQQQQUQȁQQQQUQVQVQPQXQV`QQQQQ:VQ0QQ0QQVQxQQ@fVQQQQQQQQ QqV(QV`QQpQxQQ8QQQQpQQ`QxQ@QQQQȋVQQQQQtVQUQXQQQQ:VQQQ0QQQQQpQ:VxQQQQQ`QQxQQQQQQqV QQ(QQ0QtV8QXQ@QQxQQQQQx6VQQQVpQ:VxQQQxQQQQQQQQx6VQ:VQQȚQ0QQQXQQ`QȌVhQTpQQxQ`VQQQQQqVQQQQЛQVQФVQtVQ0VQQ@Q`QHQQXQQ`Q@QhQQQ@Q0Q:V8Q@QhQQpQ@QQQQQ(Q@Q0QQ8QQ@QQHQQPQ8TQQQQQQQUQQQQHQVPQЉVXQXQ`Q QpQQxQQQpQQ0QQhQȦQQЦQhLQ0lLQnLQoLQqLQrLQsLQtLQxL Q`yL(Q{L0QPVQ:VQU QVQhQHQQPQQQ:VQ@QQQQQQQHQQPQ(QXQQQQQSȴQQдQQQQQQQQQhQQ0QQU0QxQ8Q Q@QQHQQPQ@QXQhQ`Q0QhQQpQоQQ`VȶQUжQQQPQQQQpTQQQplT QQ(QPQ0QQ@QUPQQ`QQhQqVpQQQQQQQUзQмQQ@QQQQQQpQ Q Q0QQ8QQQQQ`VQTQ`QPQQQQкQQغQQQPQQQQV(QQ0QQHQ8QXQQ0QQ8Q`Q@QQHQxQPQ@QXQQ`QоQhQ QpQQxQQQSQhQQ0QQQQQQQPQQ`Q`VpQUQPQQQQQQVQQQмQQUQQQ`QQ Q0QػQ8QQ@Q`Q@QQHQxQxQHQxQpQQQQ:VQQQhQQ0QQh-VQdVQQQQQqVQQQhdV QHQ(QHQ0QdV8QeV@QQHQQPQ QXQQhQQpQPQxQQQxQQVQQQpQQ@QQQQQ QQ(Q(QQpQPQ8QXQ0VQФVQPQQ QQQ(QQQ`QQ QQQQQhQQpQQxQtVQSQVQQQxQQ`QHQQPQXQXQQ`QtVQQPQO(Q:V8QpQ@Q@QHQQPQQXQQ`Q`QhQ0QQVQQQ(Q QQ(QQ0QQ8QQ@QXQHQQPQ0VXQQ`QtVhQQQXQQ8QQQQx6VQQQa8@QVQ8QxQQQQQUQqVQQQQQUQhdVQPQQ`VQ QQQ QQ(QxQ0Q@Q8Q0V@QQHQQXQQ`QPQhQQpQQxQQQhQQ(QQQQQQxQQ@QQQQQQQQXQQ QQQQQQxQQ8QQQQQQQQHQQQHQQ`Q`QhQQpQhQQgLQ(QQQQ|LQQQQQhQQ(QQ0}LQ@~LQ0LQ`LQQQ0LQLQLQL QL(QL0QL8QL@Q`LHQL`QQQPQQxRQPQQLQQQSQ8RQQQLQRQQQQQSQSQPUVQVV0QS@QRQPRQHQQVVQHSQR0QQ0QR`Q8Q8RVVHRQPRQXR`Q`RQRVRRRRRQRQRXVR`QR(QRQRQ RhQ(R`RXR0R`RVVR(RRhRRU RR RR RRP RSX RR` R`Lh RpLp RPLx R0L RL RL RL RPV RVV R R Rh R RV(RUXRSR RRbURRRSRRRR RR(RPR0RR8RR@RRHR`RPR(RRBURX^VRxR R^V(R8R0R@IV8RR@R(gVHRRPRRXRPR`RRhRRpRRxR`RR(RRSR0VRRRRRbURXRRLRLRxRRLR8RRL RR0RR8RL@RSHRRPRrUXRЭL`RLhRbUpRSRVVRRRRRRRR(R8UPRRXRR`RRhRRRxR`R`RhR(RRRRLRLRVRRx"RR'R0R'R"R'RPL'R L'RКT)R'R*R)R+R*R,R+R.R,R 0RR(0R .R00RиL80RL@0RLH0RHLP0RL`0RКTh0R0GR(1RR2R05R2RR6R05RX6RR`6R@4Rh6RLp6RLx6RL6RL6RL6RL6RКT6R0GR8R6R:R8R:R:R=R(;R>R;R?R>RARhRAR?RARLARLARhLAR0LARLARКTAR0GRBRhRDRaRDRNRDR(HRERhRFRp-RHR(HRHIR RPIRPGRXIRL`IRLhIRLpIRLxIRLIRLIRКTIR0GRMR2UNRIRORNROR2UPR(NRQR(PRSRQRVR؝R@WRRHWRLPWRpLXWRL`WRLhWRLpWRLxWRLWRpLWRpLWRКTWRR0[R2Uh[R2Ux[RxqR[R@wR[R8qR[RqR[RpR[RWRdR`fRdR(fRdRHbRdRbRdRaRdRVdRhhRdRaRheRpRpeR8qReRqReR2UeRxqReRUeRUeR\RfRRfR`fRgR(fRkRhRkRhhRkR0hRkRgRlRpRlRqR lRU(lR8qR@lRVHlRPVlRgRlRRlRfRlRfRlRfRxoRUoRmRXrRxqR`rR8qRhrRqRprRpRrRoRtR2UPtRrRuRT8xRV@xR@wRhxRRxRRxRLxRLxRLyRLyRLyRL yRL(yRL0yRL8yRL@yRLHyR`LPyR`LXyRКT`yRwRhyR8RpyRR{R2U{RR{RȊR|R2U|R(R |RRX|RxyR}R(R~R(R~R(R~RRR(RRRRqUЁRR؁R؝RR2UR(R(RRxRRR؝RRpRRXRR8RRL RL0RL8RL@RLHRLPRLXRL`RLhRLpR0LxRLRLRLRКTR8SRPVRRR2URR RȊRXR2UpR(RxRRRRR(RRRR(RRR R(R@RURRRRȑR(RR`tR RpR`RRRqURpRRRR(RRR(RSRXR(RhRRXR2URxTRRRR2URVRUR RpR(R8RHRRhR؝RПR8R؟RhRR8RR0LRpMRMR0MRMRM RM(RM0R0 M8R` M@R MHR MPRP MXRPM`RКThR8SpRPVxRRRxRRHR(RзR0RpR8RR@RRRRpRpRxR8RRRRȫRRRȭRзRЭR8RRRRRRpRR8R0RR(RзR`R8RRзRȰRhR`RRRзRRRRRвRаRRзRRRRR0RزRxRзRRRR8R`RзRhRRRRhR8RRPUVRRRRȺRPRRRR8R0RPUVHRRRRR R`RRRR@RxRRȿRRURзRRRRRRR R(R(RR0R@R8RR@RRHRXRPRRXRR`RRhRxRpRPRxRRR`RR0RRRRhRRRRRRpRR8RRRRRRPRRRRRRRRhRR0RR@RRR RR(RR0RHR8RR@RRHRxR(R`V0RR8R0V@RRHRRXRXR`R(RhRRpRRxRRRPRRRRRRRRxRR@RRRRRRRR8UR`RR0RRRRRRhRR RRRRR RpR(R8R8RR@RRHRRPRPRXRR`RRhRRpRhRxR0RRRRRRxRR@RRRRRRRRHRRRRRRRRhRRR R@V(RPR0RR8RR@RxRHRPRPR(RXRRhR`LpR`RxRLR0RRLRRRLRRRLRhRRLR RRLRRRpLRRRLRpRR`MR8RRMRPM RM(RM0RM8RM@RMHRMPRMXR M`RMhRpMRRRRRHRRRRRRКT0RHRhRRRR8RRRpRR8RRRRR@RRHRxRPR8R`R`VhRRpRRxRRRhRR0RRRRRRxRR 9URxRR`VRRRRRRRRRR R8R(RhR0R0R8RR@RRHRRXR8R`RlUhRlUpRlUxRRR 9URxR(RR@RrUHRRPRxRXR8RhR`VpRRxRRRRRhRR0RRRRRRxRR 9URlURlURlURHRRSRRRRRRRpRR8RRR RR(RU0RR@R0VpRRxRRRRR(RRVR!MRRRSR"MRRR#MR8RR$MRRRRRRRR R@URSR(rU R@URBURX^VRSRh-MR0.M`RxShR(rUpR@UXRBUhRX^VxRqURxSR 0MR1MRRRR8R`S@RRR@SR(rUR@U RBU@RX^VxR@SR3MR3MR4MR6MR`VPRдSRSR(rU R@URBURX^V(RqU`RSpR 8MxR9MRRRдSR(rUR@URBURX^VRдSR;MR;MSM S?M S@M SAM SBM S`V S`S S(rU S@U SBU SX^V SqU S`S SDM SEMS S@S(SHS(rUPS@U@SBUXSX^VS(SSGMSHMS`IMSSS(rU S@USBUSX^VPSS`SXKMhS0LMSxSST0SSSRSRSRS`RS8SSSSxzVSTSPSSSSSS(rUS@USBUSX^VHSSXS NM`SOMpSOMxSPMS RMS`VSSS(rUS@USBUSX^VSSS0TMSUM SPS( S(rU0 S@U!SBU(!SX^V8!SqUp!SPS!SVM!SWMX"SS`"S(rUh"S@UH#SX^V#SS#SYM$SS%S(rU%S@U%SBU&SqU&SS&SX^VP&SSp&S[Mx&Sp\M(SVV(Sp-S(S-S(S8U(SV(SqU)SpS)SSP)S&SX)S&Sx+SpS+SS+S8S+S)S+ST+S`)S-SpS-SqU-SS -SSP/S-SX/S-S`/Sp-S/S8U/SS/SqU/SS/SS02SS82S0SH2Sp^MP2S `MX2SbM`2SpcM3SUp4S2Sx4Sh2S6SXU06S7S@6SqUX6S(5S6S4S6SX4S6S4S6SfM(9S7S09SS@9Sp/Vp9S6S9S6S0:SS:SVV(;SS0;S(rU8;S@U(SбSx>S@UX?SU`?SVhTMTpTUxT TTTTUTTTDTTHwTTT0TV8TbU@TUTHTVPT8TXTST`TUhTTTTPTxThTwTpTDTxTHTTTTVTbUTȋV TUT(TU0TtV@TPVPTTXTU`T(fUTTT`TT(TTTTT'T"T(T"T(T"T(TX"T(T("T (T!T((TU0(T!T8(T!T@(Th!TP(T8!T)TV )TbU@)T!TH)T TX)TUh)T!Tp)TVx)T(fU)TPV)TtV)T@ T)T T)TT*TfU+TnU+TU+TؾU+TDT,THwT,TU,TЂTH,TVP,TbUp,T8Tx,TT,TT,T؍T-TT.T-T/TST/TPT/TU/TV/TPST/T.T0T(0T0T0T0T/T02T@4T82T0U@2T0TH2ThV2TU2TU2TRT2TT2TT2TPT3TU3TU3TX8T 3TVX3TX0T04T3T84T`3T5T@4T5TT5ThV5TTx6TRT6TU6TX8T6T`RT6TT6T3TTBT@TBTTBT>TBT>TBTTXCTV`CTbUxCTVCTVCTPTCT8TCTUCTTCTTCTVCTVCTTCTTCTTCT0TDT@T0DT؍THDTTXDTT`DT@>ThDT>TDThTGT(UHTnUHTUHTET0HT`T8HTDT@HTHwTPHTЕThHT0TpHTT`ITVhIT8UpITPTxITVITbUIT8TIT@UITTITTITpTITUITVITVITTIT0T(JTT0JTpTxJT TJTDTJT0TKTPTKTVKTU LTJTXLTPTLT8QTLTpQTLTQTMTQTHMTRTPMTPWUMTSTMTSTNT8UT NTTT(NTHTTXNTU`NTTpNTpTxNT8TNTTNTTNTTNTUNTЎTNT]TNT]TNTx]TNT@]TNTTNTUNTTNTUNT UNThTNTUOTTOTPTOTVOTU OTؾU0OTHU8OTPoU@OTnUHOT oUPOTnUXOTT`OTThOThTpOT]TxOT\TOT`TOT0TOTȡTXTUXTؾUYT oUYTHUYTnU YTPoU(YTnU0YTV8YT`V@YTUHYTTXYTUT`YTpUThYT8UTpYTUTxYTTTYTTTYTHTTYTTTYTUYT0VYTTYTpTYT8TYTTYTTYTTYTTYTUYTVYTSTZTȡTZTTZTST ZThT(ZTU0ZTT8ZTT@ZTPTHZTPSTPZTSTXZTV`ZTRThZTPWUpZTRTxZT`RTZTRTZTTZTTZThTZT0TZTQTZTUZTQTZT UZTpQTZTTZT8QTZTUZTPTZTPT [TPT0[TTP[TOTX[TOTp[T@Vx[T@NT[TM[TNT[TM[T M[TM[TM[TM[TM[TPM[TN[TN[T`N[TMT[T@N[TN[TN\TMT\TN\T N\T N \TT(\TpN0\T@N8\ThMT@\TNH\T0MTP\T NX\T`Nh\TКTp\TN\T#N\T(N\TMT\TLT\TLT\TpLT\T@LT\T -N\T0.N\TPV_T^T`TV`TbU`THT`TȋVaT_TcTVcTbUcTHTcTPTcTȋVcTPVcTVcTVcTTcTTcT0T dTaTeT0TeTTeT@dTfT oUfTVfTbUgTTgTThT`gTXkTTkTVkTbUkThT`mTVhmTbUpmTHTxmTplTmTlTnT0ToTVoTbU oTHT(oTplT8oTUhoTmT`pTVhpTbUpToT`qTVhqTȒUpqTUxqTVqTThtT0TxtTTtTsTtTrTtTrTtTprTuTVuTȒU uTU(uT8V0uTT8uTU@uTVHuTbUhuTTpuT@rTxuTrTuTqTuT؍TuTT@zTxTXzTwT`zTwTpzTxwTxzTHwT{TV {TbU8{TȋV@{THTH{TwTX{TU`{TwTh{T0Vp{TvTx{T U{TvT{TtV{TPV{TxvT{T`V{TxU{T(fU{TU{TvT|TuT |TXUT}TT}T0TU`TTЀTV؀TbUTTT}TT0VTTT}T T0T(TU0Tp}T8T@}T@TȋVHTPVPT(fUXTPVhTtVT|TT|TЁTfUT8|TTTThTT8T(TT0TЂT8TT@ThTpTVxTbUT8TTTT8TTTT؍T TTPTVXTbU`TTxT8TT8TTPTT0TTT(TV0TbU8TT@TVpTȇT(TT8T0UHTUPTؾUhTTpTUxTTTTTTTUTT TV(TȒU0TU8T8V@TTHTUPTTXTPWUT؍TTTTU TؾU0T@T8TTHTTؑTVTVTbUTVTTTЎT(TV0TV8TT@TTHTTPT0TT@TTTT؍TTTȒThTTUT(UTUT`TTTȘT0TИTTؘTЕTTUTVT8UșTPTЙTVؙTbUTTTUTTTpTTU TV(TV0TT8T0ThTTpTpTT`XNT TT0TTTHTUPTT`TpThT8TpTTxTTTTTUTЎTT]TT]TTx]TT@]TTTTUțTTЛTU؛T UThTTUTTTPTTVT]TT\TT`T TU(TؾU8THU@TPoUHTnUPT oUXTnU`TThTTpThTxT0TTȡTTUTؾUT oUTHUTPoUȥTnUХTnUإTVT`VTUTTTHTTUTT TT(TT0TT8TpT@T8THTTPTUXTȡT`TThThTpTUxT0TTTTTTTTPTT0VTVTTTTȦTxUЦTTئThTT0TT(T TT8TTHTTXT@V`T0ThT`2NpTP3NxT@4NTp5NT7NT09NT:NT;NT=NT@>NT?NT@NȧTANЧTDNاTHNTTTLNTONTКTTPNTQNTU TPUN(TPYN0TPVTqUȩTVЩTUTVȪTTTnUToUT(nUpTTTTT0TTTThTTTTUTPlUT0TTUTXUȯTUЯTUTxTTXTTTвT0TزTT@TVUPTTXTUT T T@V(TU0T0T8TTTTTUTPlUTVUȷTlUзTUTT(TT0TT8TT@TTHTTXTؿU`TThTTpT(TxTVTpTTTT0TT8TTTTUTTT`VTPTTbUTT T8T0T8U8THkU@TUPTTXTkU`T0ThTTTTT@TTTTTTTTTTTTTTPThT`VpTPTxTbUTjUT@jUT8TTpjUT TTTxTUTTThTTUTTTTThT(TjU TT(TT0TT8TTHTPTXT T`TThTTpTTxT`TTUT(TTؿUTTTTTTThTT8TTpjUTjUTjUTUTTTTTUTUT0 VTTT`TTHkUT(fU T0T(TT@TTTPUTTTxTToNTpNT(OUTTThTUHTTxTPiUT`TT iU8TTTPTThUTThTTpTTxTTTTTUT:V ThTU(T(OU0TU@TUHThUXT(fU`TPTpTTxTTTU TT(ThTTUT0TTTTTTVThgUTVTtV0TPV8TPoU@TTHTHUxTpTT@TTTTTpT( UxTHTT8TTTT( UTHTT8TTTTgUTgUT( UTtVTT0T( U8T8T@TTHTgUTTT( UTPTTgUTtV@TqUHTgUPTHTTgUTUTHTTT(TГVTT@TgUTTTNThTT8TUUUVUUUUUHhUU@UUVUUXUhU`UNhUЂNpU0NxUpNUNUNUNUPNU0NUNUNU0NUVUVU UUU8UV@UVU UUU UU U` U U( U UV UU( U`V0 UpU8 UhUx UN UN UN UN UUU UUVPUUUfUUXU UbU0UVhUUUbU UpUXU(fU`UPVU`VUpUU(UUNUNUUUhU`U8UhUqUpUVxUVUXOUUPpUUeUUUUUUUUHUUUUPeUU(OUUUUPeUUhTUUU!UPeU!UPiU!UU#UPeU#U iU($U"U%U eU&U0$U'UdU(U&UP*UdU*U((U,UdU,U*Uh-U-U-U-U0U/U0UH/U0U1U 1UV(1UV81UV@1UH/UH1U/UP1U.UX1UXcU1U.U1Up.U1U(.U1U-U1U-U1UP-U2U2U3U1U03U6U83Up3U4U3U4U6U4Up3U5U@3U6U6U7U6U8UXcU8UN8UN8U8N8UN8UN8UN0:UPUV8:UVp:UqUx:UV:UV:U 9U:U8U>Uh=U>U0=U ?UV@?UVH?UVP?UV?U;U?UH;U?U:U@UR@U?UAUVVAUQBU`bUBU(rUBU@UCUrUCUBUCUX^VCUqUDU`bUDUXBUDUpN DU@N8EU0DUpEUEUxEUKU`FUKUhFUEUIUGU IUGUJU bUJU`NJUPNJUXN JU N(JUNLUKUMU bUMUKU8MU8JUNUPMUNU eUNUdUNUdUNUdUOUeUOUeU OUeUOUfUOUfUOUgUOUhgU PUxhU(PUHhUXPUjU`PUiUhPUiUpPUiUxPUPiUPU iUPUPlUPUlUPUkUh[UUp[UؾU[UHU[UPoU[U oU[UnU[UnUH\UoUx\UPpU\UnU\UU\UؾU\UHU\UpU\UPoU\UnU\UlU]UlU]UlU]U(fU]UPV ]UhU(]U(cU0]U oU`]U(rUyUrUyU`VyUUyUUyU`rUyU(rUzUqUzUqUzUqU zUPqU(zU qU8zUpU@zUpUPzUpU`zUPpUpzU0VxzUpUzUoUzUoUzUoUzUUzUؾUzUHUzUPoUzU oUzUnUzUnU{UnU{UXnU{UU{U(nU {UmU({UmU8{UxmU@{U0mUH{UlUP{UlUX{UlU`{UPlUh{UlUp{UkU{UkU{UxkU{UHkU{UkU{UjU{UjU{UpjU{U@jU{UjU{UiU{UiU{UiU{UPiU{U iU{UhU|UhU|UxhU|UHhU|UhU |UgU(|UU0|UgU8|UhgU@|U0gUH|UgUX|UfU`|UfUh|U`fUp|U(fUx|UPV|UeU|UeU|UeU|UPeU|U eU|UdU|UdU|UdU|UXdU|U(dU|UcU|UcU|UxU|UcU|UXcU|U(cU}UbU}UbU}UbU }U`bU(}U bU0}UaU`}Uh]Ux}UH]U}U\U}U^N}U_N}U@V}U`\U}UPpU}U0\U}U[U}U[U}UoU}UP[U}UoU}U aN~U[U~UZU~UZU ~UhZU(~U8ZU0~UZU8~UU@~UYUH~UYUP~U`YUX~U0YU`~UXUh~UXUp~UXUx~U`XU~U(XU~UWU~UWU~UWU~UPWU~UWU~UVU~UVU~UVU~UHVU~UVU~UUU~UUU~UxUUU@UUUUUUTUU(U UHkU(UTU0UhTU8U0TUHUSUPUSUXUSU`UPSUhU SUpURUxURUUxRUUHRUURUUQUUQUUpQUU8QUUQUU@bNUdNU`fNUPUU0hNUxkUUPUUmNUrN UkU(UwN0UpxN8U`yN@U@zNHU0{NPU|NXU@PU`U|NhUPNpUPUxU`NUhUUNUNUOUUNUNUOUUNUXOUȀU eUЀU(OU؀UNUUPNUPNU@NU0NU NUNUUNUN UXdU(U(dU0UdU8UN@UNHUcUPUcUXUXU`UNhUЯNpUXcUxUcUUNU@NUbUU@NU`bUU0NU bUU NUxNUȁU8NUЁUMU؁UPVUMUUMUU`VUUUVUXVU(UUUUVUVUUUU`UUhUUhUUUU U`VHUVXUV`UVpUVUUUVU~VUpUЈUHUUUUUU(UHUUPU`V`UUU؈U(U UUUU`VUVUUUUȌUVUUU0UUUUUUUU:VUUUXU8UU@U(UHUVXUUU`U UV8UȒU@UUPUUXU@V`U VhU@UpUVxU`VUUUPUUUUUUȋVUpUȘUФVИUUؘUUUUU`VUVUV UpUPUpUpU8UUUUUUpUU8UUUUUșUUЙU8UUUU؍UUXVUUU`UUUUUUUUXUU@UU`UUUU`VНUV؝U(UUUUPVUȋVUUU(U0UxU8U8UXUUxU`VUUUVUVUPUU UUUUUUhUU UUPUUUUUUVUUUUUXUU(UUhUU0UUVUUU`VUxUUШUU0UPUUXUȤU`U`NpUUUXUUUU(UUUUȣU@UUPU8UU`VU0UUVUUUxUUШUUUUhUUU U U(UU@UUUpUUxUجUHUpUUUUUUUUU@UUUpUUxUUU@UUUUUUVаUUذUUU@UUUصUUU`UU0UUUUUUгU8UU@U UPUV`U`VhUhUU0UUUжUUضUUUHUUUxUUUUUUU@UUPUȸUVظUUUUU@UUUUغUлUVUUUUUxUUV0UU@U`UHU UPUxUXUV`UUhUؿUpUUUUUpUU`VU8UUUUVUVUUUؾUUU UxUPU UXU8U`UUhUXUpU UUUUUUxUUhU@UUHUUXUUUUU`U UUxUxUU@UUUUUUU0UxU@U@UHU0VXUhU`U0UhUUpUUxUVUUU@UUUUUUUU`UU(UUNUUU`VUUU UU NxUUUPUUVU U`UUpU VxUUUUUUUPUUUUU8UV@UUHU`VPUxUXU8U`U VpUUxUVUUUUUpUU@UUUUXUUUU UU VUUUU UU(UU0UNHUxUXU U`UUU8UUVUUU8UU0VUVU`VUUU`UhUUU8UUxUUГVUU UV(UUUUU0VUVU`VUUU`U8UUPUUXUU`UГVUUUU U`V0UU8UU@UUHUUPUUXUU`UUhUUpUUxUxUUhUU8UUUUUUpU(UV8UUpUUxUUUUUHUUUUUUUUxUU`VUUUU UV0UU8UVHUpUPUUXUV`UHUpUxUxUUU8UUUUUUOUUUhUU0UUUUU UUV`VVVVUVVVUVUVXUV UVUVUVpUV@UVUVU VU(V`U0V(U8VU@VUHVxUPV@UXVU`VUhVUpVPUxVUVUVUVxUV8UVUVUVUVVVXUV(UVHU V N(VPN0VN8VN@VNHV0NPVNXV0N`VNhVNpVNxVNVNVPNV0NVNVNVNVNVNVNV@NVNVOVPVVVVVVVVVpVX"VxV("VVV@VX"VHV!VxVVVX"VV!VHVVVX"VV!V VPV VX"V Vh!V V V VX"V V8!V V V VX"V V!V V V8 V V VH V V VVVVVVPVV VVVV VH(V$VP(VX$VX(V($V`(V#Vh(V#Vp(V#Vx(V`#V(V(#V(V"V(V"V(V"V(VX"V(V("V(V!V(V!V(V!V(Vh!V(V8!V(V!V(V V(V V(V` V(V0 V)V V)VV)VV)VhV )V8V()VV0)VV8)VV@)V`VH)V0VP)VVX)VV`)VVh)VpVp)V8Vx)VV)VV)VV)VxV)VHV)VV)VV)VV)VV)VXV)V(V)VV)VV)VV)VXV)V V)VV*VV*VxV*V@V*VV *VV(*VV0*V`V8*V(V@*VVH*VVP*VxVX*V0V`*VVh*VVp*V`Vx*V V*VV*VV*VHV*VV*VV*VV*V8V*VV*VV*VhV*V(V*VV*V0V+V`Vh+V Op+V Ox+V@V+V V+VV+VV+VV+VV+VV+VP O+V@ O+V0 O+V O+VO+VO+VO+VO+VO+VhO,V`V,V@V,V V0,VVP,VVX,VV`,VVh,VVp,V`V,V0O,V@V.Vh-V0.VhdV8.VdV@.VeVp.V,V0V;V0V/V0VȋV0V0V0Vp/V1VfV01V/V@1V.VH1Vx.V5VVp5V`V5VfV5VV5VV5Vh1V5V(6V5V5VV87V >V6V(>V6V0>Vx6V@>V(6VH>V5V@?V8BVp?VP>Vx?V8BVH@VhdVP@Vh@VX@VIV`@V@VAV@V BV@V(BVhdV0BVh@V0CV8BV0JV@IV8JVIVhJV0cVpJVxCVxJV@OJV0 OJV@!OJVP"ONVPVNV [VNVHLVNVLVNVKVNVKVhOV [VpOVbVOVVOV]VOV`VOVVOVVOV8dVOVPVPV8KVPVxZV(PV@ZVHPVJVPPVJVQVPVQVPV(RVXPVhSVbVpSV8RVxSV@$OSV (OTVVUVVUVV@UV]VHUVSV`VVPUVhVVVVpVVVWVVVWVVXV^VHXVxVVPXV+OYVV8YV^V@YVVZVV0ZVV8ZV ^V\V [V\VV\VZV\V [V]VbV0]VZVX]VxZVh]V@ZV_V^V_V^V_VX^V_V ^V_V]V`VbV `Vp]V(`V*O0`V+O8`V,O@`V-OH`V.O`VdV`VdV`VeVaVPeV@aVeVpaVeVaVfVaV@fVbVfV0bVfV`bVfVhhV(gVphVfVhVfVhVfVhV@fVhVfVhVqVhVeVhVeVhVPeVhVeVhVdVhVdVhVhdVhV`VhV8dVhVdVhVcViVcViVViV0cViVPV iVbV(iVbVXiVhbVhiVHbVpiVbVxiVaViVaViVaViVXaViV(aViV`ViV`ViV`ViVh`ViVOiVOiVOiVOiV@#OiV0cVjV )OjVbVjV0OjVbV jVPVkVpVkVpVkVoV@kV(jVpkVnVkVPnVkVnVlVnV0lVoV`lVHoVlVoVlVpVlVpVlV@pVlVpVlVoVmV@qV@mVxqVpmVqVrVqVrVxqVrV@qVrVqVrVpVrVpVsV@pVsVpVsVoVsVoV sVHoV(sVoV0sVnV8sVnV@sVPnVHsVnVPsVmVsVxmVsVXmVsV(mVsVlVsVlVsVxlVsVHlVsVlVsVkVsVkVsVkVsVXkVsV3OtVVtVPVtVvVuVV`vVVhvVvVxvV`VvVtVwVvVwV`VwVVyVVyVwVyV 6OyV 7O yV8O zV(|V(zV`|V{V(|V{V`|V{VxzV{V`V|V0zV}V`|V}V(|V}V`V~VV~V0;O~V0OXVV`V?OhV`AOpVPCOxVHOVVVIOVKOVLOVNOVQOVxVȿVXVпVVؿVصVVVV`VVHV`Vp0VVV0VVx0VVVV`VVhVHVpVVxVVVVV`WOVHVV0XOVVVYOVVVYOxV[OVV0VXVVVVV@V@_OVVVVVXVV8V`T.V(Vt8VS.HVPFXXVFXhVVV8VTT.VxVԚVS.VFXVFXVd8V,XVP8hVxVV4VS.V GXVVVW/@V0HVD`V1hV\MV 1V81V v,VV@t,Vp8(V@,8Vv,HV@VXV PXhVVxVo,VHV4VVS.VV8QX VW/V%(VV]XV4'V`]XV0( VP.(V.,8V`8@V 1HV`XV8`V/hV,xV08VX'0VV8V 1V@V8V 1Vp(-V@8V[0V V8V 1V##V8 V 1(V8V8@V1HVR.XV8`V1hVpR.xV8V 1V81V8/VP,V8V.Vp,V@8VЄ1V,V8 VX=0(V$8Vp8@Vp 1HV`-XV8`V`1hVxV8Vp1VV`8V1VR.V@8V1VR.V8V 1V81HVhV8xVVVV0V8V8VYXVVVp8VV8[V0iXV|(VHV<hVh'xViXVV4V8V@V`ViXV%HVL(XVp8hVxV'Vp$V`jXVjXVH!VВV8(VLHVlXVjXhV$ V̒V08VȒV%V@kXV$8VhXV8hVDV%VkXVV Vp8VH(Vh8VlXHVd xV,V@8VVt%V`lXVV1V`(V80V08VoHV8PV1XVhV8pV 1V81VVp8V$V VV(VXV$,xV`8V(V ,VlXV,VV@8(VHV8XV mXhV(VV8V VX:VmXV,&8V ,XV@8hV$V,V nXV$,V4V8V(V8VnXHVxV(Vp8VDV VoXVVĐ8V@8HVHhV#xV@oXVV+VnV8V`+V(VoX8V@\+hVdxV(V8VLVPVoXVطV8V8HVhVXxV pXV|VyV%9VV8VhZVXVxXV(XV V[VW/V/VhV1V`Vf9V1VhVPf9V1VV f9 V1(V8Ve9@V1HVXVe9`V`0hV xVe9V1VXV`e9V 1V(Ve9V/VVd9Vx/VV`d9V/V(GV0d9 V01(VF8Vd9@V0HVXVpg9`V81hVdxVc9V@1VVc9VP1VXVPc9VX1VHVb9V1VxVb9V 1V81HV+XVPVf9V@+V+V VtVXV`e+Vd+(VV8VXHVd"XV8hVPxVEVVGVVVxVV(V E8V0XHVhVxVVVpDV0XVpV1V-Vg9V1V̒(Vg90V18V̒HVg9PV0XVЅhVpg9pV 1V81Vp-VV0[Vh9V,V(VV8VXHV,V!1V0,V9 V"1(V8V 9@V"1HV,XV9`V"1hVIxV`9VF/VV9VP1V~V9V("1V4V`9V 1V81(V-8V@-XV,hVHXW C1W pWQ:xW${WWXWXW(XW`Wh/WW:W.WW:W1WW:W 10W81XW 1pW81W\1WT#WP W\1h W W: Wp W| WXW0 WXp W,6WdT.6Ww16Ww16W`>,6W\6Ww17W0x17W47WdT. 7W8x187Whx1H7W4P7W\X7Wxx1p7Wx17Wp7,7WdT.7Wx17Wx17Wp7,7W\7Wx17W y17WЦ-7WD\8W(y18WHy1(8WQ08WD\88WXy1P8Wy1`8WPh8W,p8Wy18Wy18W@P8W,8Wy18Wz18WO8W,8W z18WXz19WN9W,9Whz109Wz1@9WNH9WPP9Wz1h9Wz1x9W$N9W,9Wz19W0{19WM9W,9W@{19Wx{19WLM9W,9W{1:W{1 :WL(:W,0:W{1H:W|1X:WtL`:W,h:W|1:WH|1:W6:WdT.:WX|1:W|1:W6:W\:W|1:W|1;W-;WdT.;W|1(;W }18;W-@;W\H;W0}1`;Wh}1p;WLx;W,;Wx}1;W}1;WK;W,;W}1;W}1;WQ;WD\;W~1W`s1>W{ >Whs18>Ws1P>W{X>Ws1p>W1>W0I,>Wz>W1>W1>WS>W{>W1>W 1>WS>Wz?W01?Wh1(?W *0?WT]8?Wx1P?Wy1h?W,p?W1?Wz1?W{?W1@W .(@Wt$P@Wx@Wd$@W@<@W ]@WXAW AW`AW$AWP]0AW0QAWxz BWLWP<MW.MWT?MW< MW 18MW81`MWh1hMW+xMW<MW1MW:MWp<MW1MW,GMW<MW1MWAMW<MW1MW 4MWP<NW1NW)NW< NW(1(NWP-8NW<@NW0HNWXNW`<`NW1hNWxNW0<NW81NWh9NW<NWp1NW>NWP<NW 1NW81OWx10OW XOW<PW1PW&XQWp[QW*!QWYXRW.pRW,!RWt-RW YRW@YRW<RW`YSWp)SW`)SW&(SWJWhSW?xSW6SW`&SWȒ.TW,!8TWt-@TWYHTW@YXTW(TW<TW`YTWp)TW`)TW&TW`MWUW;pUW$UW1UW4)`VWhhVWY8WW1XWP+XWYXW.XW)YW| YW`Y(YWY0YWY8YWpYW <YW=YW)YWXYYWYYWPZW)xZW1ZWXWZWTZW YH[W Y[W4c\W(10\WLWX\W-`\W Yx\W!\W`[)8]Wc]WX1]W`%^W,p^W<x^W'%^W0T.^W7^W` Y^W Y^WT[&^W$_W@//_Wp*_W\(`W@p H`W<P`W&%X`W*`W@Y`W Y`W Y`W'`W'PaW1bW1dWЃ1dW4~dWdW)dW@ 0eWJ@eWt,`eWYheWpYpeWY8gWx.PgWL)xgWXgWpYgWXYgWPsgWHYgWp<gW4)gW gW<gWhWYhWYXhW)hW1hWZ)xiWT)iWx`jWW/kW1lWDWlWYxmW18nW WHnWXYoW1oWVoWYpW1pW+pW̡qWYqWYPqW <XqWP`qW8hqW$ixqW`WqWYqW`jWqWXrW(1prWprW$Q sW[(sWYsWh1sWp,sW<tW1tW$tWp< tW1(tW8tW@<@tWh/HtW&XtW<`tW/htW+xtW<tW/tWR&tW0<tW1tWltW<tWX/tWD)tW@<tWX/tW%tW<uW.0uWp)uW< uW.(uWP%8uW<@uW /HuW@,XuW <`uW1huWP-xuW<uW1uW -uW<uW@1uWUuW<uW 1uW81XvWvWIvW@wW`1wWd%wWwW`Y(xWt-HxW)XxW YhxWY(yWp1@yWd%hyWpyWPvWxyWYyWt-yW"yWD%yW YzWYzW1zWd%{W{WPvW{WYh{Wt-x{W"{WP){WpY{WYh|W1|W b&}W+0}W@ +8}WY~W1 ~W b&~W+~WPw,~WYW1W b&HW+pW%xWYHW؅1`W b&W+WWYW1W b&W+WWYW1W b&(W+PWXWY(W@/@W6hWF#pWYxWvWWYW<ȆWLІW(؆W4.W +WsW8W+@W4HWP+W+xW.W !W=!WXY؈WW<(W HWxYXWYW@(W1W&W`1 W@1(WD)8W<@W1HW~XW<`W1hW@xW`<W1WW <W1W`&W<Wx/ȊW`,؊W<W1W!W0<W/W0"(W< W81(W4'8W0<@W/HWXW<`W`0hWHxWP<WP1W-W <W1WD ,W<W 1؋W81PWp/hW`W-WYWYW0<W5W@&W 'Wp' WW`W'ȍW+W1W)WQ.W[*W YW1W '0W`F,XW!`W0 YPW؉1hW0#WQ.W@)# W!YW(40WO,WOW`H,W0!YW1W~ДWؔWp"YWW(W=@W܇W~W`?/ WH((W!@W/HW PW,hWXC0pW xW W`/WS%W*WW/W/WS%W`%WPB0WS%W%0WB08W*@W*W(1W)WW/W(1W) WW/ؘW.W *W@W pW=xW&%WS.W$YWWЙWd&W]%xW.WP*WWp=W%% Wa+PW$YXWWpWJ&W=%W.0W@XW,W=W^WW#YWWW 8Wt W870НWĬ WXWPq`W4WP'YW'YWp%YXWH)0pWP(WW*YW+W=W((W(Y8Wp(YxWfРWxeW18WȡWH,YءW+YW 1W6W=W1WTW=W؏1ȢW`6آW=W1W0Wp=W 1W81PW6XW6W1УW !W.YW8XW-W@!WH.YW`W-YXW1pW<WQ.W1W0W`WW8MW7ȧW@3YW(1W0W@18WM`W6hWX1Y8Wx1PWpWWتWMWCW3YثW1W !W@WWxWpWWW2YW1YxW1W !W81YW$W-HW0YPWH0YXW/YW 10W`)XWX`Wp6YpWX6YxW,W{W,WP=W4,ȯW`,دWW5YW4YW4Y8W`WW/ȰWhW/аWTHذW)W81W*W WH1 W|H(W0WX1@Wp1HWHPWXW1W 1W81WP0W бW[0رWWX0W(HW1`W0k'WLWXW(1WGWW7Y W7Y(WWXW4!hWpгW0سWW=W 1W81HW.`WY+W`=W,W"WгWhW4WU+ W.8W,W`=W|GW,W(Y@W0W)Wh/W`,W`1ȷWX/зW4+W1W.0WW1WX/W|) W1(W10W@WX1HW 1`W81hW@1pW$Wx18W1PWxWWd(عWQWPYWحYW8Y0W'غWؤ1WWxWQWحYWYлW! ػW%xW1WW(WQHWPYPWحYXWHYpWxWn%W10WXW4WWQWحYWYW@$W 1пWW4XWQWPYWحYWYWpXWؒ.pW:%W=W (WS.(WY0WY8WYPW@;&XW9&hW2%W81W)8W@WxYHW(YPWYXWthW\W-W08Wй,WWW,WH1W'WWW'8W4a+HWFhWЯYpWYxWYpW.WWhYWiWP= W@WȳYHWPYWfW1W$l 8W@XWp>"W =W+WYWYWYW*WP1W WW|W80W"=8WD(HW&hWYpWYxWYWXK8Wx40PWS.xW(WW|WP"=W Q.W%WYWY0WJXWLW40W"WpW"=xW'%W "W88W`YWXMxW1WP'WW#=W1WT"hWEW"WYhW.W-WYWxYW`YW5"WWPYW ==W((W"8WYWtW-Wt"WWtW(W0W-8WW1 W)WDWWYW.W)W0WpYWWWXYW\0WHY@W]=XWhW4)xWhYWP)hWp.W<Wp-WYWm=WxQW&WP1W0 W&8W0@W*XW0`W&xW0Wh1W0W/W0W0W0W''W0W/W0 WP&8WH/@W &XW 0`W@ 'Wx<0W4Wx<0W@R.WY1WY1WY1Wg1W%W Wpg18W0!W@WXg1XWP$W`W@g1xW#WW(g1W"WWg1W"WWP1W<WxYWxe1W0XW1W=W'YWP\1W0:WXWБ.Wu:WX(WxK10WR:8WXHW2PWY1`W`K1hWu:pWXWPK1W0u:WhXW@K1W`R:WXWZ1WXPW@.XW:hWXWh/W'Wi1W0WWOW WC1(WR:0WXX@WP1HW[XW`1WW/W,WW(1WP1W[W`1WW/W,W W(1`WKhWKpWPYxWYW`YWYWYW`YW0YW1WX.WP.W.W`CWؒ.WWHW.PW:`WXhWpXW/WH1W` 1W8W`XWbXW(W0*W*W 1(W\X0W 1HWVPW 1hW@_XpW 1W_XWh 1W8W``XW8B1W:WXWpX@W1HW 1XWVX`WUXWqWWWpCW8-/WWWPCW@//Wp_W8W C@W81/`WWW/WZ9WXWXW0 (W*Wp*W1WvXW1WXW10W0X8Wh1PWuXXWx1pWh}XxW1WXW1WxVW1WXW1WXW1WXW10WxX8W`1PWXXW01pWsXxW1W{XWB1W0:WpXW@X(Wx.0W<:@WXHWȬXPW`](XWt*`Wp*hW`.1xWp.1W.1W.1W.1W.1W.1W.1W.1W.1W/1W/1(W(/18W8/1HWH/1XW`/1hWx/1xW/1W/1W/1W+1W+1W+1W+1W+1W,1W,1W(,1(W8,18WH,1HW`,1XWh,1hW,1xW,1W,1W,1W-1W(-1WH-1Wh-1W-1W-1W-1W-1(W.18W .1HW@.1XW/1hW/1xW/1W01W01W 01W001W@01WP01W`01Wp01W01W01(W018W01HW01XW01hW01xW11W11W(11W@11WX11Wh11Wx11W11W11W11W11(W118W11HW21XW21hW021xWH21WX21Wh21Wx21W21W21W21W21W21W21W21(W318W 31HW831XWH31hWX31xWh31Wx31W31W31W31W31W31W31W31W41W41(W(418W841HWH41XWX41hW`41xWp41W41W41W41W41W41W41W41W51W51W 51(W8518WP51HW`51XWp51hW51xW51W51W51W51W51W51W61W 61W061W@61WP61(W`618Wx61HW61XW61hW61xW61W71W 71W871WP71Wp71W71W71W71W71W71(W718W81HW81XW 81hW081xW@81WP81W`81Wp81W81W81W81W81W81W81W91(W918W091HWP91XW`91hWp91xW91W91W91W91W91W=/W9WXW=/W9WXW=/W9WPX(W >/0W98WЪXHWH+1PW 9XWPXhW0+1W VW +1WXWh>/W9WXW+1W9WpXWCW?/ W0W@WCHW0@/hWWWCW.WWW@D0W8WXXWWXW[)Wd* W*(W@10WX18WWXHW@.PW\1XWhW]1pWؾ.xW`]1W|Wp]1W.W]1WW]1W /W@^1WW`^1W/W^1WW_1W_1W_1 W80W_18W.@W.HWh`W/hW/pWWCWF/WWW(0W.W/W/W/ W@C(W"1HWhWhWCpW0'1WVW`CW@/WWWCW. WW@WCHWM/hW8VW CW8/WhVWpCWO/WxVWC W1@WV`WpChWx.W(fWWPCWP.WHWW a1WW(W1@WXHW0KW/W@9WXW`XW)Wp*W*W1W9WXX1 X080XTX8XTX@X)HX*PX*XX1pX TXxX1XPM.XPCX /X8VX CX(1XVPX0XXPl8hX@DXpXDXX@CX.XPWX@.XpCX&1(X`VHXCPX80pXWX CX(0XWX@CX8/XV XC(X.HXHVhXCpX"1XVX@1XX@1X@1X@1hX@18X1@X8PXpXXXpX`Xp*hX+pX@+xX1XVX1X@VXx1XVX`1XVXH1XpVX810XV8X1PXVXX1pXVxX1XVX1XVX1XVX1X VX1 XV Xp10 XV8 XX1P X0VX X@1p XPVx X(1 X`V X1 XpV X1 X0V X1 X@V X1 XV X10 XV` X0h X`8x XGX X`GX X`* Xt+ X+ X1 XV X1 XV X0 XPV( X10 Xj9@ XXH XPXP X*X XP+` XD+h X1 X@V Xh1 XV XH1 XV X 1 X`V X1 XpX0 Xh18 X@8H XSXP XSXX X_+` X+h Xp+p X(1 XV X1 XRX X1 XV X1 XQX X C X I1( XWH X CP X`0p XhV XC X0#1 X(V XC X[0XW X C(X"1HX0WhXCpX/XWXCX1XWX1(XhX0XiX8X ,@XP-HX`-PX1hXcXpX1XfXX1X`gXX1XgXXPCX81XW(XC0XP.PXVpX`CxXP.XVX@1XP.XP1XX1X`CX81XWHX B1hX@XXCX`1X(WX(B1X`XX X,(X`-0X-8Xa1PXWhXCpXh1XVXH1X8XVXXVXXC X@/@X%W`XChXH1XVX/XPd1XXXpKX CX/8X8VXXC`X('1X(VXCX!1XVX`CX.XW0XC8X /XXfWxXCX 1XVXCXb1XWXCX 10XxVhXA1pXA:XXXPKX1X`9X`X`X XPC(Xp 1HXVX`<0XP8XNXXPNXX-X(.XD(.X0CX1X(GWXC Xb1@XXWPXH 1XXFXCX.X8WX/Xx0XCXXCX`X`1hXP9xXXX0 /X=:XXXXXK.0X/8XM:HXXPXXXX0Xpd8XBXXpCXXL.XN.XN.X`0Xc8XpBXXH1XC1XC10XP]08X.PXhk0XX.pXP]0xX1X CX1XVX@CX`1X`V(XC0X[0PX@VpX@CxX 1XxVX@CX1XVXCXx1(XHVHXCPX`1pXVXCX(1XVXCXX1XV X0C(X(0HXVhX`CpX1XHVXCX >/X VX CX'1 XV@XCHX`&1hXVXCXP&1X(VXCX@&1XXV XC X0&1@ XV` XCh X &1 XV XC X&1 XV XC X&1!XV8!X C@!X@%1`!XPV!X0C!X #1!XV!XC!XxR0!XW"XC"XK18"XpWX"XC`"X(J1"XW"X0C"XH1"XW"X@C"XG1#X0W0#XPC8#XS0X#X`Wx#XC#XP/#XW#XC#Xb1#X(W$XC$X8S00$X'WP$XCX$Xe1x$X'W$XPC$Xg1$X@&W$X@C$Xg1%X&W(%XC0%Xx1P%XXfWp%XCx%X``1%XfW%X`C%X /%XkW&XC&X.(&XWH&X0CP&X.p&XW&XC&Xئ1&XW&XC&X``1'X W 'XC('Xb1H'XXWh'XCp'Xb1'XW'XC'X81'XPW'XC(X``1 (X`W@(XCH(Xb1h(XW(XC(Xb1(XW(XC(X@1(X0V)X`C )X01@)XV`)XCh)XA1)XXW)XC)XA1)X(W)XC)X(Y0*X('W8*XC@*Xpf1`*XX'W*XC*Xpf1*X&W*XC*Xe1*X&W+X0C+Xe18+X%WX+X`C`+X[0+Xp&W+X C+X%1+XHV+X0C+X%1,XxV0,X@C8,X%1X,XVx,XC,Xp%1,XV,Xhk0,X 1,XC,X"1-XV -XC(-X"1H-XxVh-XCp-XH#1-XV-XC-X`#1-XV-X`+1-XC .XV@.XCH.XX%1h.XV.X0C.Xph0.XV.X+1.XpC.XV/X`C /XX'1@/XPV`/XPCh/X`'1/X V/X0C/Xp'1/XV/XC/X'10XV80XC@0X'1`0XPV0XC0XȄ10XjW0XC0X10XjW1X C1X/81X(kWX1XC`1X11XV1X@C1X811XPV1X@11X8/1Xp@11X`,02X8/2Xp@102X@ 182XH/@2X8/H2Xx^0`2X8/h2Xp@12XC2XP"12XW2XC2XX"12XXW3XC 3X"1@3X0V`3XpCh3X"13XV3XC3X`%13XV3XC3X8'14XV84XC@4X$1`4XhVx4Xp+14XC4X0V4X@C4X/4X`kW5XpC5X(085XVX5XC`5X805XV5XC5X05X8W5XC5X806XgW06XC86X(0X6XWx6XC6XH'16XV6XC6XH 16XV7XC7XF/07XVP7XCX7X"1x7XV7XC7X&17XV7XC7X&18XV(8XPC08X8&0P8XVp8XCx8Xh"18XW8XPC8XH"18XhW9XC9X0(9XXVH9XCP9X0p9XV9X C9XH09XV9XPC9Xp0:X V :XpC(:X%1H:XVh:XCp:X%1:XXV:XC:X#1:XV:XC;X"1 ;XV@;X@CH;Xx0h;XV;XpC;X81;X(V;XC;X#1;X`VXC>Xb18>XWX>XC`>X[0>XW>XC>Xb1>X(W>XC>X[0?XW0?XC8?X.X?X0Wx?X0C?Xx<0?XW?XC?X00?XW@X`C@X 10@XVP@XCX@X(#1x@XhV@XC@X@0@XV@X`C@XP0AXV AX0(AX1HAXCPAX`1pAXXWAX0CAXp1AX0VAXCAX 1BXV BXC(BXX'0HBXVXBX C`BXChBXCpBX0xBX0BX0BX0BX0BX0BX0BX0BX0BX0BX0BX0BX0BX(0BX80BX CX`g8CX0CX(CXf80CXH08CXHHCX f8xCX(6CX'CX0CXsCXh8DX)@DX0HDXȁXDXl8`DX0hDXpxDXk8DX0DXDX`k8DX0DXD+DXk8DX0DXDXj8DX0DX+DXpj8EX0EXhEX0j8 EX0(EXd8EXi8@EX0HEX`XEXi8`EX0hEX xEX`i8EX0EXEXi8EX0EXĊEXh8EX0EX(~EXh8FXP.PFX0XFX[hFX 8FXP.FX0FXxpFX 8 GX0(GX8GX 8hGXp*GX0GXPTGX8GX@Q0GXGX08GX0Q0GXGX~8GX8Q0GX$HX~8HX8/HX(HX`~80HX0/8HX(HHX ~8PHX/XHXdhHX}8pHX'0xHXHX}8HXX'0HXЧHX}8HX'0HX HX`}8HX'0HX(HX0}8HX'0HX|IX}8IX'0IXЩ(IX|80IXZ/8IX$HIX|8PIX0XIXXhIXp|8pIX0xIXLIX@|8IX0IXZ.IX|8IX0IXIX{8IX0IXTIX{8IX'0IXJX{8JXP'0JX|(JXP{80JX08JXSHJX {8PJX'0XJXXhJXz8pJXH'0xJX(JXz8JX@'0JXJXz8JX('0JXJX`z8JX&0JXJX0z8JX8'0JX4KXz8KX&0KXx(KXy80KX&08KXHKXy8PKX'0XKXHhKX`y8pKX '0xKXKX0y8KX&0KXTKXy8KX&0KXKXx8KX&0KXKXx8KX&0KXLXpx8LX(0LX(LX@x80LXN08LX(HLXw8PLX8N0XLX`hLXw8pLX0xLXLXpw8LXHO0LXLX0w8LXO0LXLXw8LXP/LXx LXv8LXH/LX MXv8MX0MX5(MXpv80MXi18MXh5HMX@v8PMX@1XMX5hMXv8pMX.xMX4MXu8MX0MX`4MXu8MX (/MX4MXu8MX(0MXMXs8MX8P0MXNXpr8NXF0NX(NX r8XNX-NX0NXANX8NX01NXNX8NXP$0NXdNX08NXe0NXNX8OX@1OXp?OXP8 OXx0(OX@8OX8@OXh0HOX>XOX8`OXX0hOX@=xOX 8OXH0OX(<OX8OX@0OXOX`8OX00OX:OX8OXP1OX@OX8 PX`X/@PXx1HPXhW/hPX1pPXX/PX1PX(.PX@.PXP.8QXH1XQXP1QX`+.QX@.QX(. RXx1(RX8RX08@RX1HRXXRX8`RX0hRXRX1RXR.RX1RXR.RXP-RX,SXp8SX@E,(SX-8SX RXHSXQXXSX VhSX KxSX4,SXL0SX`SX8SX1SX SXp8SXd+(TX88TX)HTXT*XTX)hTX*TXr)TXx1TX~TX 8TX1TXs)TX8TX1TXUX 8UX1UX((UX80UX18UX@HUX8PUXȃ/XUX)hUX8pUXh0xUXlcUXp8UX /UXD)UX8UX0}&VX1VXXVX 8 VXH,/(VX'8VX8@VX1HVX XVX@8`VX(0hVX<xVXp8VX,VX@1VXVX8WXP1WXX1 WXp1(WXx10WX18WX1@WX1HWX1PWX1XWX1`WX1hWX1pWX 1xWX(1WXP1WXX1WXx1WX1WX1WX1WX1WX1WX`k(XX@D0XX-XX8 XX1(XX<8XX8@XX 1HXXHXXX`8`XX01hXX0xXX8XXH1XX(XX8XXX1XXxXXP8XXp1XXXX8XX1XXXX8YX1YX<YX8 YX1(YXA8YX8@YX1HYXTBXYXp8`YXd0hYXl xYX8YX1YX YX8YX1YXYX8YX1YXP YX8YX1YXYX08ZX1ZX8ZX8 ZX0(ZX >8ZX8@ZX1HZX>XZXP8`ZX0hZXxZX8ZX1ZX@ZX8ZX0ZXHZX 8ZX1ZXZX8ZX0ZX=ZXp8[X 1[X$>[X 8 [X01([XX_8[XЖ8`[X(.[X 1[Xg+[X8[X 1[Xg+[X8[X 1[Xk+\X8\X( 1\Xk+(\X80\X0 18\X+H\X08P\X8/X\X+h\X08p\X@ 1x\Xg+\X8\XP 1\Xk+\X8\X` 1\X@\X&(]X]X`8(]X[X8]X(H]X`[X`]X(.]X 1]XP']X 8]X( 1]X']Xp8]Xp 1]Xp^X08^X 1^Xp(^X80^X 18^XtH^X8P^X 1X^X<h^X@8p^X@ 1x^XP'^X 8^XP 1^X'^Xp8^X` 1^XH@^X(.H_X7X_X 1h_X^X_X(._XD7_X_X`X 1`X-.(`XN.8`XH`X_X``X 1h`X 1p`X 1x`X 1`X0 1`X@ 1`XB0`XX 1`XA0`Xl`X8`X` 1`Xl`X8`Xp 1`X0aX8aX 1aX'(aX80aX 18aX'HaX8PaX 1XaX ;haX08paXx^0xaX ;aX08aX 1aXtaX8aX 1aX'aX8aX 1aX@l+aX08aX/aXdbX8bX 1bX(bX80bX 18bXf+HbXл8PbX 1XbX hbXp8pbX 1xbXbX8bX n&bX 1bXbX 10cX(/PcX 1XcXT/xcXP 1cXp 1cXx 1cX(.dX-,dXp dX0dX8@dX"PdX V`dX0cXpdXbXdX0q,dXP.,dX 1dXdX 1dX(1dXdX81dXh1eXHeX0heXp1peX.eX1eX0eX1eX1eX1fX3,(fXV8fX08HfXVXfXHeXhfXdXxfXfX04,fX@WfX(/gXP.gXԢgX8 gX/(gX,#8gX8hgX.#xgXgXgXfXgXgX/#gXgXPgXhXP.hX#,hX8 hX80(hX8hX8@hXx1HhXXhX8`hX1hhXP,xhX`8hX1hXP,hX08hX1hX,hX8hX1hXD-hX8iX ,0iX08iXpHiX8PiX1XiXHthiX8iX0iXiX8iX0iXtqiX8jX(.`jX1hjX$xjX@8jX0jXpjX8jX1jX,sjX8jX0jXjX8kX1kX(rkX8@kX0HkXpXkX8`kX1hkXuxkX8kX0kX4pkX8kX1kXpukX8lX0lXlX8 lX1(lX{8lX8`lX0hlXoxlX8lX0lX~lX8lX1lXpzlX8lX1lXlX8 mX0(mX~8mX8@mX1HmX(yXmX8`mX1hmXxmX8mX0mX}mX8mX1mXwmX8mX1mXmX8 nX0(nXL|8nX8@nX1HnXuXnX8`nX1hnXxnX8nX0nXnX8nX1nXmnX8oX0oXooX8@oX0HoXDoXoX8oX0oXnoX8oX1oXoX8oX0oXTnoX8 pX0(pXpm8pX8@pX1HpXlXpX8pX*pXP0pX"pX8pX/pXAqX1 qXؘ@qX1HqX@qX(.qX@.rXph0rX rX 8(rX10rX@5@rX8HrXh'1PrX,3`rX8hrX/prX(rX8rX1rXrX`8rX8&0rXprX8rX/rXprXP8rXx'1rXsX8sX1sXA sXp8(sX10sXA@sX 8HsX1PsXA`sX8hsX 1psXOsX1sXWsX(sX8sXtXtXe tXrX0tXqX@tXpXPtXP`tXhxtX"0tXPR.tX@8tX1tX`R.tX8tX]1tX4R.tXp8uXx0 uXC0uX88uXh'1@uXPuX8XuX/`uXpuXP8xuXx'1uXLCuX8uX8uXuXuXxtXuX1vXHvX(0PvX`vX8hvXx1pvX -vX8vX1vXvX`8vX1vX@mvX@8vX,wX8wXHvX wXuX0wXp-@wX,PwXд,hwX/pwX\wX/wX"wX1wXlBwX]1wXBxX1xXLxXxXxX"0xX1xX1xX1xX1 yX(.HyX@.yXx0yXPlyX`9yX1yXnyX9yXx'1yXp"yX`9yXh'1zX0-zX@9zX/ zX,0zX98zX1@zXi*PzX9XzXph0`zX*pzX9xzX0zX`-zX9zX1zXhizX9zX1zXhzXp9zX1zXgzXP9zX1{X4g{X09{X/ {X0{X98{X1@{X8P{X9X{X8&0`{X$jp{X9x{X0{X{X0{X{Xd*{X̘|X9|X ) |X*0|X #@|XyXP|XXxX`|XhwXp|X)|Xx0|X4C|X9|Xh'1|X|X`9|XȻ/|X|X 9|Xؕ/|XP}X` 9}X]0}XD }X0 9(}Xx'10}X@}X0 9p}X9}X|X}X/}X|"}X/}X}X/}X 8~X1`~X1~X(.~X@.Xx0XsX9 X1(X(8X9@Xph0HX (XX9`X1hX)xX`9X1X)X@9X0X -X9X1X(sX9X1X0*X9Xh'1X@(X9 Xj0(X$w8X09@XȻ/HX,XX9`Xؕ/hXl}xX9X]0X`|X9X/XXP9X/ȀX,*؀X`9X1Xt)X@9X8&0XtX9 X1(X8X9@X0HX`X0hXX)XȁX9؁X)Xp)XXXX8~X(X}X8X(PX/XX|"xX/XX/X X1X1@X(.hX@.Xph0X (ЃX9؃Xx0XsX9X1X)X`9X1 X)0X 98X0@X -PX9XX1`X(spX9xX1X0*X9Xx'1X+X9X8&0XtЄX9؄X1XPk*X9X/X,*X`9X1 Xt)0X@98X1@XPX9XX0`XxX0XX)ЅXX09X)Xp)XX XX0XPX@X0)XX/`XؙX(.ІX@. Xh'1(X@Xj0HX`XȻ/hXXؕ/XX]0XxXx'1ȇX\X1X@X1X$ X1(X@Xph0HX,`X1hXX()X09ȈXt؈XX XXXXXXX0X/8X|"XX/`XX/X ЉX1X1 X(.HX@.Xph0X (X9Xx0XsЊX9؊X1X)X`9X1X)X@9X1 X)0X 98X0@X -PX9XX1`X(spX9xX1X0*X9X1XPk*X9X/X,*ЋX`9؋X1Xt)X@9X8&0XtX9Xh'1 X@(0X98XȻ/@X,PX9XXؕ/`Xl}pX9xX]0X`|X9X/XXP9Xj0X$wЌX09،Xx'1X+X9X1XX9X0 X8X0@XX)XX9X)Xp)ЍXXXXЉXX0XX(X/0X@XH1xX(.X@.X1XX$9X1X(Xp$90X18XHX $9PXph0XX@hX#9pX1xXX#9X1XܾXP#9X1XȏX#9ЏXx'1؏X8X"9Xh1X\X!9XȻ/XX(X!90Xؕ/8XHX` 9PX/XXZhX`9pXH/xX8]XP9Xh'1XYX9Xx1X>ȐX09АX1ؐX4X9X/XDX9X8&0X4(X90X 18XxPPX1XXYpX1xXXȑXؑX\XX/X|"X1(X10X@X1PX/XXhX(1XH1ȒX1X(.X@.hXh'1pXX,9XX1X(X,9Xؕ/X7*X+9ȓXx'1ГXP_*X*9X/X2*X(9X1X$( X`(9(X8&00X@Xp'9HXph0PX)`X&9hX1pXD)X&9X1X(XP&9X1X )X&9ȔX0ДXԴ-X%9X1X(Xp%9X1Xp*(X00XHX0PXX(XhX-9XD)ЕX(XhXXXXXX( XP(8X(.`X@.X/XȖX89ЖX1ؖX\X@89X8&0XX79X1X4)(X790Xph08X)HX69PX1XXhhX59pX1xXt)Xp59X1X)X59Xx1X DЗX1ؗX8X1XxX1X0X08XCHXp49PX1XXChX49pX@ 1xX0(XP 1X(X/XȘX29ИXH/ؘX X19Xh1X0#X0198X(9HX:9XXhXDT.xX,Xx~XXX8XXVșX0(Xh'1X$X?9XX1X8X?9 Xؕ/(X`=@Xx'1HXD;X@9XXX(X8/X(XB9X0X,XA9 XM/(X(8X @9hX0--X(.X`1XXh10X18XHX0g9PX0XXhXpg9X1X1XW/0X08XxX+X|X``+Xp+X0XȝXX؝X,X0DXX+Xh^0X(Xj9XX0*X1Xg)XPz9X1XXy9X0ȞXs؞X y9X80XqX`w9X(0XpXu9 X0(X\m8X`u9@X0HX`kXX u9`X0hXxXt9X/X,Xt9Xh0XiXt9X0ȟX؟X@t9X0XPXt9X0X(Xs9 X0(X8Xs9@XX0HXgXX@s9`X@0hXexXr9X(0X\cXr9X0X`X@r9X0ȠXؠXr9X0XXXq9X 0XXq9 X0(X^8X@q9@X0HX\XXp9`Xк0hXZxXp9X0X(XX@p9X0XVXp9X0ȡX\TءXo9X`0XRXpo9X@0XPX o9 X00(XO8Xn9@X 0HXTMXXn9`X0hXKxXpn9X0X JX0n9X0XLHXm9X0ȢXhFآXm9X<0XhXpm9Xȹ0XDX0m9 X0(XP8Xk9@X/HXf)XX k9X1XX9X1XlX9X1ȣXأX9X1X8Xp9X.X X~9 X.(X8XP~9@X1HXXX}9`X 1hXdxX|9X81XX@|9XP1XX{9Xp1X1X1X1X1X1X1X1 X1(X10X(18X81@XP1HXX1hXl)X/Xh;X9Xp1XȥXP9ХX(b0إXX9Xx1X,X9X>0X(X@90X18XHX9PX1XXlhXЋ9pX1xXԺX9X1XX9Xe0XȦX9ЦX1ئXXp9Xe0X(X9Xr0X(X90Xr08XdHX 9PX1XX`hX9pX1xXX9X1X`X9Xc0XȧX@9ЧX1اXX9X>/X81 XH1(XP10XX18X`1@Xh1HXx1PX1XX1`X1hX1pX1xX1X1X1X81XX1X1Xh1ȨX1ШXx1بX@1X1X1X1X1X1X1X81XH1 Xh1(Xx10X18X1PX1`X1pX1X1X1X1X1X1ЩX 1X(1X81X1 X10Xp1@X(1PX1pX@1xXH1X`1Xp1X( 1X1X.X1X1X1ЪX 1تX 1X0 1X8 1XH 1XP 1X` 1Xp 1 X 1(X 10X 18X 1PX 1XX 1`X؊1hX(!1X/XX!1X/ȫX!1X-X XV0XXHX@ 1PX,hXP 1pX-Xph0XV.ЬXd'(XF/X(X9:X8"1 X0X 5:8X@"1@XPX4:XXH"1`XpX3:xX0XX.:XP"1XX0-:XX0XЭX':حXX"1XXP':X`"1X Xp&:Xh"1 Xx0X0&:8Xp"1@XPX%:XXx"1`Xp*pXp%:xX"1XX%:X"1XPX`":X"1X(ЮX:خX"1X+X:X"1Xt*X :X"1 X0X:8X"1@X8PX`:XX"1`XdpX:xXP0XlX`:X@0XjX:X"1XЯX0:دX"1XXp:X"1XX :X(/ X0XP :8X.@Xb*PX` :XX"1`XpX :xX#1XX:XH 1XX0:X#1XаX:ذX#1X+X:X#1XX:X81 X80X@:8Xx0@X`PX 9XX1`XpX09xX #1XX9X80X|X9X(#1XTGбX9رX80XX9X0#1XTl+X`9XH#1 X0X98X`#1@XPX9XXx#1`X4pX9xX#1XX 9X#1XX9X#1Xl&вX9زX#1X%X9X#1XX9X#1 X4'0X98X$1@XPX09XX $1`X pX9xX($1X X9Xx0XX9X8$1X)*гX09سX@$1X'*X9XH$1X)*X9X0 Xt0X98XP$1@X@PX9XX`$1`X pXP9xXh$1XX9Xp$1XX@9Xx$1X'*дX9شX$1XX9Xr0X$X9X$1 X#0X098X$1@X!PX9XX$1`XD"pX9xXe0X"X@9X$1X#X9X$1Xl$еX9صXf0X%XP9X$1XDX9X0 Xį0X98X$1@X%PX9XX$1`X&pX@9xXc0XX9X$1XX9X$1XжX`9ضX$1X)X9X$1X"X9X$1 X50X98X%1@X\PX9XX%1`X )pXp9xX%1Xd"X 9X %1XT)X9X0%1X!зX@9طX8/Xp\*X9Xph0X4Xp9X0 X0X98X@%1@XPX09XXP%1`XpX9xXX%1X)X9X(f0X+Xp9XHf0X -иX`9ظXh'1Xd.X9X s0XX`9XPs0 X`0XP98XXs0@XtPX9XXx'1`X pX@9xXs0XXp9Xs0XPX`9Xs0XйX`9عX`%1XX9Xp%1X X@9X1 X0X98Xx%1@X/PX9XX%1`X1pX 9xX%1XX9X%1XX9X%1XкXP9غX%1XtX9X$0XlX9Xt0 X0X98X8&0@XPX9XXt0`XpX9xX t0X X9X0X4X9X%1XtлX9ػX%1X?X09X%1XX9X%1 X0XP98X%1@X<PX9XX%1`X4pX9xX%1XpX@9X&1XXp9X&1XмX9ؼX &1X,X9X0&1XLX 9X@&1 X0Xл98XP&1@XPX`9XX`&1`XpX9xXp&1XX9X&1XPXp9X&1XнX9ؽX&1X"X9XPf0X1X 9X&1 X0X98X&1@XLPX09XX&1`X)pXе9xX&1XXд9X&1X0X`9X`f0X2оX9ؾXpf0X3X9X&1XX9X&1 X\0X98Xp0@XPX 9XXH0`X8pX9xX0X$X 9X0X,Xp9X/X-пX`9ؿX&1XtXP9X'1XX9Xc0 XL0X98X'1@XPX9XXPd0`XpX 9xX('1X,X9X0'1X (XФ9X8'1XX9XH'1XX@9XX'1XX6XУ9X`'1 X70X98Xp'1@X8PXP9XX'1`XpX@9xX'1X9X9X'1X;X9X5X( /XDX91X8:1 X0X@:18Xx:1@XPX:1XX:1`XpX:1xX;1X،X;1X<1XX<1X1XX=1X1X|JX=1XX>1XxXh>1X>1 X0X>18X(?1@XPX@?1XX?1`X$pX?1xX?1X8X?1X@1X8X @1X1X X?:X@1XX?:X1 X#0X>:8X@1@XLPXP>:XXA1`X0pX>:X,5X( /XXL:X8:1XXL:X A1XT X L:(X0A10XPq@XJ:HX@A1PX`XI:hXPA1pXXPI:X`A1XXH:XpA1XxXpH:XA1X1X@G:XA1X2XF:XA1X$ XE:(XA10X@X E:HXA1PX|`XD:hXA1pXXPD:XA1XXC:XA1XXB:XA1XX B:XB1X`XA:(X=00Xz8X@PX=0XXX=0X=0X/ XXX/`X0C1hX/pXXC1xX.XxC1XC1XC1XC1XC1XD1X D1XPD1XXD1X/XD1X/XD1XE1XE1XHE1 XXE1(XE10XE18XE1@XE1HXF1PXF1hX/pX0F1xX/X8F1X/X8F1X@F1XPF1X8&/X`F1XhF1XxF1XF1XF1XF1XF1XP/XF1X/XF1XX/XF1XF1 XF1(X8/0XF18XX/@XF1HX<0PXF1XX/`XG1hXh/pX G1xX/X(G1X%1X@G1X%1XXG1XpG1XxG1XG1XG1XG1XG1XG1XXt:XH1 X,0Xt:8X.@XPX0t:XXH1`XpXs:xX H1X8QX0s:X0H1XhXpr:XX.XXr:X.XSX q:XHH1XHX@p:Xx. Xt 0Xo:8Xx^0@XPX`n:XXXH1`X'xX:X?/XX@:X0`1X\rX:X8`1X0#X:X`E/X@7,X@:XH`1X,X: XP.(X)8X:@X`/HX+XX:`X &/hX)xX`:X(/X-X:XU/X+X:X81/Xp(X`:Xpr0XdX:X.X1 X: XP`1(X)8X:@X.HXf%XXP:`XX`1hX,xX:X``1XPrX:X0X\*X`:XP0XX:X.X&Xк:X/X@ ,X: XX/(X@)8X:@Xh`1HX<XXP:`Xp`1hX"(xX:Xx`1X-X:XG/XTq"X:XG/X",X`:X/X"X:X40XGX: X`1(XDr8X :@X`0HX,XX:`XP/hXtxXа:X/X+X@:X[0X#X:X`1X,X:X.XTn%X:X /X ,X: X`1(Xx,8XЪ:@XHL1HXO&XX0:X,X0X|JX@.HX`a,xX{&Xx<0XPX:X00XX:X(a1X&.X: Xa1pXa1xX|X@1XXtX XXt X8Xpc@XdHXePXfXXh`X$ihX`pXxX XjX\X,kXPlXtmXnXoXXcXpXrX(sXLtXpuXvX xXDyXhzX{ X|(X}0X~8X@X@HXPX XXb1`XpX b1XHb1X8X*0X/8XhHXn<pX80xX *X <X.X'X<X[0Xo+X0<Xb1X-X0<Xb1Xa"X@<Xb1X-(X<0Xb18X-HX@<PXb1XX-hXp<pX0xX&XБ<X`0XX<Xb1XPXP<X(/XP*X`<X?0X+X<X/X(XЌ<0X08X$HX <PX1XXЋ+hXЋ<pX/xX$-X <XXH/X(X0<X0XX <X0X#Xp<XI/XD(X<X?0X<&(X <0Xb18Xp-HXP<PX/XX0,hX<pXb1xX-X0<X81X,X<XY/XЙ,X0<Xx./X'X <X(J/X(X<X@/X@&.(X0<0X08X*HX0~<PXc1XXi)hXp}<pXc1xX@FX|<Xc1X&.X{<X c1XEXz<X(c1X4AXy<X0c1XBXy<X@c1X-(X0x<0XHc18XtCHX`w<PXXc1XXQhXv<pX`c1xXdh)Xu<Xhc1X+Xt<Xxc1X@DXt<Xc1X!Xs<Xpr0X-Xr<Xc1Xh(X0r<0X.8XToHXq<PX`/XXЬ-hX`o<pX1xXhXo<Xc1X<XP Xf"X*X1XH X0<(X00X@@X<HX1PXxt`XО<Xc1XpWXc1Xc1X8qXd1Xe1XlXe1X`X/Xe1Xe1Xe1(Xe10XІ@X<HX0PX]`X<hXf1pXZXf1XZXf18Xf1@XZxXhW/XX f1XHf1XXPf1Xe1XXp<Xpf1XL(X0<0X08X]HX<PXf1XX`ZX/Xe1Xe1Xe10Xe1Xe1XX<Xpf1XX<X0X]X<Xf1X4Z X/pXb1xX XB0X̬Xf1XX0W/XP8X/X0X]X@<X XX*X 1XP,X< Xf1(X,8Xf1`X/hX4)pX,XPB0Xp)X X g0X})XDXg1X)X0W/X)X)(Xg10X ~)8X~)PXW/XXz)xXW/X)X-Xg1XXX`/X)XLGXB0X,2XD @Xh1hXh1X h1X0h1XHh1X@.XXXh1`X s)pXp<xX/X)X <X`h1X/%Xph1Xh1XT<,Xк<Xh1X ,X<X/X_X0<X1 X,0X<X*xXH.X"X Xh1X0X8X@<X0XX<X 1X X<(Xi10X)@X<HXf1PX$`X<hX.pX$,X<X1XX@<X/X]X<XX i1X0i1 XPi1@X`i1HXi1hXi1Xg(XA&Xg(XG(X-XC&X &Y1Y4i-Y< Y0(Y8Y`<@Y1HYtXY0<Y0Y0Y.Y.YY/`Y1hYxY<Y0YY<Y1YpY<Y0YTY`<(YxFY +Y9YP,YBY@Y8Y*!@Y'xY(YxFY +Y9YP,YWY.Y.YY/XY@1`YpY<xY0Y@Y`0Y$Y<Y/Y#Y@<YvY,Yv(YHY$%YXY1YlY0<Y0YPY<Y1YpY<Y1YX[Y0< Y0(Y8Y<@Y1HYtXY<Y1Y?Y<Y( 1YYp<YbYT[ YȂ1 Y+ YY Y1 Y4[ Y YY( Y YPW Y0 YH8 Y YW/` Y0h Yx Y`< Y`/ Y Y YW/@Y/HY)XYp1YW/Y@-Y/YХ-YPB0Y-YPi1YV Yg1(YXpY0W/Y0Y,YH1YeY<(Y10Y@Y`<PY1XY|hhY <xYx/Y-Y<Ypr0YhY<Y1YtY <Y1Y<Y<Y1 Y0YP<@Y 1HYXY<hY01pYhY<Y@1YgY<YP1YdgYP<Y( 1Yf Y<(Y800Y@Y`<HY``1PY `Y`<hY`1pYd-Y<Y /Y-Y<Yh1Yd>Y`<Yx1Y Y<Y@ 1YeYP 1YfHYT)PYPY)XY-`Y)hY(7pY-Y(Y /Y Y<Y1YY<Y0YYp< Y/(YX8Y<@Y/HY|ZXY<`Y1hYXxY <YX/YY<Y.0YY<YX/YY<Y.YY<Y1YY< Y1(Y8Y<@Y@1HYhWXYp<`YȄ1hYPVxY<YDV0YhY(Y0YYP<Y@1 Y(WXY@1`YVY@1YVY,Y$Y $hYrY@o+Y1Y})(Y<0Y08YHY<pY1xYY`<Y@1YUY<Y,Y . Y1(Y8Y`<@Y@1HYUXY0<Y,Y1Y/YJY81 Y@1(Y`U8Y<`Y,Y01YTY81YE1YPY`1Y1YTY1(YІ10YP@Y1xY1YTY(1YX1Yt,Y<Yh1Y4YP<Y?/YI(Y<Y0@/YO(Y<Yx1 YT0Y<8Y1@YTPY1XYȇ1`YTpY؇1xY1YTY1Yp)0YdY<Yc1YXY<Y.YQ#Y<Y1YYP<Y81 YO0Y<XY(`Y`&hYw"pYxYD-Y$4+Yd&Y-Y$-Y Y 'Y9!Y-Y x"Y;,Y"Y-Y@Y@)HY`Y-xYH1YX1Yp1Y1Y1YЈ1Y1Y 1Ym'Y&Yt)Ym'Y+Y",Y& Y' Y" YPO,( Y80 Y18 Yp%.H Y@<P Y0X Yh Y<p Y1x Yw Y< Y1 Y$ Y@< Y0 Y Y< Y1 Yv!Y<0!Y18!Y n,H!Y<P!Y0X!Yh!Y<p!Y1x!Yxw!Y<!Y0!Y$!Y<!Yh0!Ypb"Y@="Yxh0"Y`b("Y`=0"Yph08"YPbH"Y ="Ydx#Yd#Y1#YW/#Y1$Y0W/0$Y /$Y@1$YP1$Y@1 %YP1p%Yh1x%YDI%Yp1%YT%Y1%Y%Y _%Y1%YdO%Y&Y1&Y8&Y1@&YN`&Y1h&YO&YC0&Y &Y1&Y4O&Y'YЊ1P'Y1X'Y8h'Y=p'Y1x'Y'Yp='YG/'Y1'Y1'Y1'Y`1'Yp1'YG/'Y1'Y1'Y1(Y@1(YP1(Y1(Y1 (Y1((Y10(Y018(Y81@(Y1H(Y1P(Y1X(Y1p(Y01x(Yп(Y81(YE1(Y(Y`1(Y1(YԿ)Y@=)Y1)YP )Y=()Yȇ10)YD@)Y=H)Y1P)YX`)Yp=h)Yp)0p)Y )Y=)Yx1)YR)Y` =)YG0)Yԃ)Y =)Y``1)Yp)Y =)Y81)Y8*Y =*Yc1*Yx *Y =(*Y`00*Y @*Y =H*Y.P*Y`*Y =*Y*Y*Y*Y*Y*Y*Y*Y*Yؿ*YM+Y(+Yp+Yx+Y(+Y/+YQ.+Y1+Y"0+Yا+Y1+Y/,Y`,Y(1H,Yph0P,YQ.`,Yhk0h,Y1p,YQ.,Yhk0,Y0,Y<,Yhk0,Y1,Y,Yhk0,Yx'1,Y,Yhk0-Y/-YL-YХ -Y(10-YPB08-YL@-YlH-Y@1X-Y`1`-YMp-Yp1-Y1-YL-YH0-Y8I-Y1-Y-YC0.YXH.Yh0P.YC`.Y=h.Yxh0p.Y=.Y=.Yph0.Y`O'.Y=.Y1.Y0.Yp=/Y6/Y//YL/YХ /Y10/YPB08/YL@/YlH/Y؎1X/Y1`/YMp/Y1/Y01/Y/YH0/Y,I/YC0/YL/Y@10YLH0YP10Yh00YC0Y=0Yxh00Y=0Y0=0Yph00Y`O'0Y=0Y11Y01Yp=81YhIP1Y6X1Yh0`1Y7p1Y=x1Yxh01Y@1Y0=1Yph01Y71Y=1Y/1YL1YХ1Y`12YPB02YL2Yl2Y1(2Y102YM@2Y1P2YH0X2Y Ix2YC02Y@2Y12YH2Yȏ1@3Yh0H3Y6X3Y=`3Yxh0h3Y @x3Y=3Yph03YM3Y=3Yh03Y@3Y=3Yxh03Y>3Y=4Yph04Y4Y=@4Y0H4Y4Yb14Y,4Y14Yؐ14YhL4Yf1 5YHb1H5Y15Yf15YP5Yh15Y5Yh15Yl5Y06Y86Y/ 6Y`6Y6Y*7Y17Y07Y|R8Y18Y} 8Y1(8Y088Y=@8Y1H8Y|X8Y=8Y0W8Y0Y8Y}.8Yȑ18YY8YY8Y19Y1@9YPYH9Y@a1h9Y1p9Y19Y19YY9YY/9Y19Y/:Y01:Y/8:Y@1@:Y/`:YP1:Y0:Y4Q:YY:YPTY:Y0:YH:Yt0;Y1P;Yp1X;Y%1x;Y1;Y~/;Y1;Y1;YȒ1;Y0Y1>Y0X/0>Y 18>Y\1X>Y81`>Y8X/>YH1>Y`1>Yp1>Y1>Y1?YY?Y0YY?YEY?YY ?YWY(?YUY0?YMY8?YpBY@?Y"0`?Y1h?YP]0?Yؓ1?Y.?Y1?YЄ1?Y1?Y/@Y10@YY8@YY@@YЁYH@Y0YP@Y~YX@YPY`@YpYh@YЛYp@YpYx@YlY@YP{Y@YtY@YoY@YqY@YxY@YpvY@YPnY@Y|Y@YyY@Y0sY@Y(1AYXXAYXAY@1AYKAYAY@?YAYMYAYPBYpBY`1BYXBY  CYx1(CYK0CY`CY@?YpCYMYCYT CYp(DY1@DYXDY8DY1DYKDYEY@?YEYMY8EY4 HEYpEY1EY`FYД1hFYJpFYFY0YYFY hGY1GY'HY1HYDJHY'PHYgYxHY'IY(1 IY'IY@1IYDJIY'IYgYJY'JYX1JY'@KYp1HKYDJPKY'KYgYKY'HLY1`LY'LY1LYDJLY'0MYgYXMY'MY1NY0k'NY1NYGNYNYYNY4!OYpOYЕ1OYL' PY1(PYJ0PY"#pPYYPY8&(QY1@QY0k'QY(1QYGQYRYЎY8RY4!HRYpRYH1RY0k'`SY`1hSYGpSYSYЎYSY4!SYphTY1TY@(UY1UYIUYD(PUYYxUY(VY1 VY0k'xVY<VYЖ1VYGVYVYYWY4!WY1WY0k'@XY1HXYGPXYXYYXY4!XYpHYY1`YYYY01YYJYY0ZYYXZY ZYH1[Y'[YX1[YDJ[Y'[YY[Y'\Yp1\Y' ]Y1(]YDJ0]Y'p]YY]Y'(^Y1@^Y'^Y1^YDJ^Y'_YY8_Y'_Yȗ1_Y'``Y1h`YDJp`Y'`YY`Y'haY1aY'bY 1bYDJbY'PbYYxbY'cYH1 cY'cY`1cYDJcY'cYYdY'dYx1dY'@eY1HeYDJPeY'eYYeY'HfY1`fY'fY1fYDJfY'0gYYXgY'gYȘ1hY'hYؘ1hYDJhY'hYYhY'iY1iY' jY1(jYDJ0jY'pjYYjY'(kYp3/@kY'kY 1kYDJkY'lYY8lY'lY@1lY0k'`mYP1hmYGpmYmYpYmY4!mYphnY1nY0k'oY1oYGoYPoYpYxoY4!oYppY1 pY0k'pY1pYGpYpYpYqY4!(qYpqY01qY0k'@rY@1HrYGPrYrYpYrY4!rYpHsYx1`sY0k'sY1sYGsY0tYpYXtY4!htYptY1uY0k'uYؚ1uYGuYuYpYuY4!vYpvY(1vY0k' wY81(wYG0wYpwYpYwY4!wYp(xY1@xY0k'xY1xYGxYyYpY8yY4!HyYpyY1yY0k'`zY1hzYGpzYzYpYzY4!zYph{Y(1{Y0k'|Y@1|YG|YP|YpYx|Y4!|Yp}Yx1 }Y0k'}Y1}YG}Y}YpY~Y4!(~Yp~Y1~Y0k'@Y 1HYGPYYYY4!YpHY`1`Y0k'Yp1YGY0YYXY4!hYpY1Y0k'Y1YGYЂYYY4!YpY1Y0k' Y؝1(YG0YpY0YY4!Yp(Y1@Y0k'Y1ȅYGЅYY0Y8Y4!HYpȆY@1Y0k'`YP1hYGpYY0Y؇Y4!YphYp1Y0k'Y1YGYPY0YxY4!YpY01 YxY4Y@1YJYY=YY0YY YP1Y!#@Y`1HYHPY`"#Y8YY0YY #HY1`Y0k'Y1YGY0Y0YXY4!hYpY؟1Y0k'Y1YGYЏY0YY4!YpY1Y0k' Y1(YG0YpY0YY4!Yp(Y /@Y'YYH1ȒYDJВY'Y;YY0;YY:YY0Y8Y'HY&ȓYp1YL'8YX`Y1hYJpY"#Y`Y`=hY1pYȠY\=Y0Y Y@_=Y0Yt Y`\=Y1Y~Y\=Y1YY[=Yb1Yx Ye=(Y00Y@N@YZ=HY1PY`YZ=hY1pYYZ=Y`0Y Yj=Y(0YYpX=Y(J/YYl=Yb1YYW=Y1Y`P* YW=(Y(/0YO,@Yf=HYG0PY7`Y@V=hY``1pYdY@T=Y/YYg=Yx/Y`YS=Y`c1YEY`=YXc1YDYP`=Yc1YD Ypa=(Y@c10YD@Ya=HYc1PY`Y`b=hY(c1pYDY_=Y c1Y\Yc=Yc1Y|Yb=Yb1YYR=Y0YLQYR=Y1Y Ypd=(Y/0Yd@YpQ=HY`/PYW.`Y`P=hY?0pYYN=Y/Y_YM=Y81YY0M=Y.YDYK=Y@/YYK=Y0Yl YI=(YP10YC@YI=HYXH/PY`Yh=hY0pYYi=Y0YOYI=Y?0YY0G=Yb1YRY@E=YI/YYD=Y[0YX YC=(Yb10Y@Y0B=HYx./PY``Yk=hY/pYYA=Yb1YYPf=Yb1YY0e=Y81YO,Y0@=YY/YHYd=Yc1YPM Y?=HYpa*PYb*XYt"`Y$T,hYI,YԥY1YY_=Y0Y<Y@_=Y1YHxY_=`YxY:Y;YD;0Yا1@Y1`Y1Y1Yp(/Y1Y1Y1Y/Y 1Y(1Y01 YP.0Y81@Y`.`Yh1pY@1YH1YP1YX1Y00Yh.Y8.Y8.Y`1Yh1 YH/0Yp1PYx1`Y01pY8/Y.Y1YT( Y0*(Y)0Y(@YT:HY~PY XYhYT:pY~xY YYT(Y0*Y)Y(YT:Y~Y YYT:Y~Y Y YP$(Y@* ZU1`ZU1ZU1Z U1 Z(U1`Z0U1Z8U1Z@U1 ZHU1`ZPU1ZXU1Z`U1 ZhU1`ZpU1ZxU1ZU1 ZU1`ZU1ZU1ZU1 ZU1`ZU1ZU1ZU1 ZU1`ZU1ZU1ZU1 ZU1`ZU1ZU1ZV1 ZV1`ZV1ZV1Z V1 Z(V1`Z0V1Z8V1Z@V1 ZHV1`ZPV1ZXV1Z`V1 ZhV1`ZpV1ZxV1ZV1 ZV1`ZV1ZV1ZV1 ZV1`ZV1ZV1ZV1 ZV1`ZV1ZV1ZV1 ZV1`ZV1ZV1ZW1 ZW1`ZW1ZW1Z W1 Z(W1`Z0W1Z8W1Z@W1 ZHW1`ZPW1ZXW1Z`W1 ZhW1`ZpW1ZxW1ZW1 ZW1`ZW1ZW1ZW1 ZW1`ZW1ZW1ZW1 ZW1`ZW1ZW1ZW1 ZW1`ZW1ZW1ZX1 ZX1`ZX1ZX1Z X1 Z(X1`Z0X1Z8X1Z@X1 ZHX1`ZPX1ZXX1Z`X1 ZhX1`ZpX1ZxX1ZX1 ZX1`ZX1ZX1ZX1 ZX1`ZX1ZX1ZX1 ZX1`ZX1ZX1ZX1 ZX1`ZX1ZX1ZY18ZjO`ZW(`8nOP`PY@C>J>!K>(!K>HC(J(K(xK(aO(cO(0eO(`gO(kO(lO(@nO(oO(qO( sO(yO(@{O(|O(O(W(W(@ W( W( W(W(W(0W(W( W(W(W(W('W()W(@W(AW(CW(EW(XGW(HW(OW(PW(HRW(SW(UW((WW(XW(hZW(\W(]W(_W(@aW(bW(dW((gW(hW(kW(hmW(oW(pW(HrW(xwW(yW(zW(X|W(}W(W(8W(؂W(xW(W(hW(@W(W(W(@W(W(W(ȘW(hW(W(W(HW(W(W(HW(W(W((W(ȫW(hW(W(8W(W((W(ȺW(hW(W(W(HW(W(W(`W(W(W((W(W(hW(W(XW(W(W(XW(PC8JXC J`CQpJQhC8JpC !DH!Dx!D!D!D"D8"Dh"D"D"D"D(#DX#D#D#D#D$DH$Dx$D$D$D%D8%Dh%D%D%D%D(&DX&D&D&D&D'DH'Dx'D'D'D(D8(Dh(D(D(D(D()DX)D)D)D)D*DH*Dx*D*D*D+D8+Dh+D+D+D+D(,DX,D,D,D,D-DH-Dx-D-D-D.D8.Dh.D.D.D.D(/DX/D/D/D/D0DH0Dx0D0D0D1D81Dh1D1D1D1D(2DX2D2D2D2D3DH3Dx3D3D3D4D84Dh4D4D4D4D(5DX5D5D5D5D6DH6Dx6D6D6D7D87Dh7D7D7D7D(8DX8D8D8D8D9DH9Dx9D9D9D:D8:Dh:D:D:D:D(;DX;D;D;D;DDX>D>D>D>D?DH?Dx?D?D?D@D8@Dh@D@D@D@D(ADXADADADADBDHBDxBDBDBDCD8CDhCDCDCDCD(DDXDDDDDDDDEDHEDxEDEDEDFD8FDhFDFDFDFD(GDXGDGDGDGDHDHHDxHDHDHDID8IDhIDIDIDID(JDXJDJDJDJDKDHKDxKDKDKDLD8LDhLDLDLDLD(MDXMDMDMDMDNDHNDxNDNDNDOD8ODhODODODOD(PDXPDPDPDPDQDJ8OOXOOO(OXOȉOpOOOOȏOOOOOxOO(OOhOOOOHOإO8OOHOxOHOhO(OhOOhOxO8OHOHOطOȸOhOhOO O(OO8O(OOhOOXOOOOOOOOOO@OXOxOOOOOHOOXOHOOxO8OxO(OOOOOP PPH P8 PXP8PPxPxP8PPPPh!P%PH'P(P(+P,P/P2P4P7P08P:P>P@PxCPHPxJP8NPQPSPH_PeP fPxgPhPPiPiP(jPkPhmPnP@pPqP0rPrPsPHtPvPXwPwPxPyPzPx|P}PPPPPPPPPP PHPPXPhPPXPP(PXPHPXPhPPPPPPhPPPXPPPPP8PPPPhPxPhP(PPPXPXPxPPPPP8PPQHQQQQH Q Q QxQQxQQPQQ8QQQQQxQ( Q Qh!QX"QH#Q#Q&Q(Q)Q*Qx*Q,Q-Q/Q0Q2Q5Q6Q8Q:Q;Q(?QBQhEQGQGQ8IQJQKQLQHQQ(TQWQYQx[Q^Q _Q_QaQcQdQfQgQiQwQzQQQQxQhQQ(QQHQQQؘQQQQ؟QQQxQQhQQXQXQQQhQhQQQQQQ0QXQQQQQ8QQQQ0QQQQQ(Q(Q8QQRRRXR RHRRRRRR8R!R&R)R8,RH/Rx0R82R3R3Rx5R7R(9Rh=R>R@RARCRDRER@FRhHRHMRNRPRSRSR8VRhZR[RbReRhRnRqRhsRtRwR{Rx|R(}R~RRRR8RR8RȌRRRȐRXRR8RhRxRؘRؙRXRRȦRR8RHRRȹRxRXRRxRRR0RXRRR8RRRRXR(R8RRR8R`RR(R RRRRXRxRRhRhRRRRS@SxSSSS8SSS S S S(SSSS8ShSxSSxSSSPSS8SSSSxSx S!S"S#SX$SX%Sh'S)S +S,S.S.SH1S2S3Sh5S(8S9SH:S;SS?SAShBSBS(CSHDSHESFShFSGSHShIS0JSXJS8KS(PSxTSxXSZSZS[S\Sx]S8^SX_SbShdSdSHeSeShfSgShSiSXkSlSmSnSoSpShqSqSrSrStSuSuS8vShvSxwSXxSxS8yS`zS{S|S(~S~SShSSSȇSSS(S8SxS؏SShSxSShSXSSSSSSS(ShSSSؤSئShSHS8SSSS8SSSxSSSSSS8ShSSShSSSSSSS8SSShShSSSxSSxSS8SSSXT@TTT T TT8T8TxTTThTTTT(#T'Th(TX*T-T.T@/T1TX2T4T5T7T7T8T88T:ThU @U(AUCUxDUEUFUFU(HU8IU8LUrU8yUUhU(U(UxUXUhU8UȓUUhUțU8UȠUȢUUxUHUUUUUUHUUUhUUU0UUHUUU8UUU8U8UUXUUHU8VVV8 V( V0 VV$V'V-V/V(4V 5VX;V=V>V?V@VAVxBVIVLVNVQVRVSVUVVVWVWVhXVXYVh[V_VhgVjVqVtVuVvVvVHxV8yVzV|V0}V~VV@VVV8V8VVVpVؖVV(VVXVVpVVxVVV(VȲVxVVxV VVVxVHVVYYY(YXYYYYYHYxYYYY8YhYYYY(ZXZZZZZHZxZZZZ8ZhZZZZ(ZXZZZZZHZxZZZZ8ZhZZZZ(ZXZZZZZHZxZZZZ8ZhZZZZ( ZX Z Z Z Z ZH Zx Z Z Z Z8 Zh Z Z Z Z( ZX Z Z Z Z ZH Zx Z Z ZZ8ZhZZZZ(ZXZZZZZHZxZZZZ8ZhZZZZ(ZXZZZZZHZxZZZZ8ZhZZZZ(ZXZZZZZHZxZZZZ8ZhZZZZ(ZXZZZZZHZxZZZZ8ZhZZZZ(ZXZZZZZHZxZZZZ8ZhZZZZ(ZXZZZZZHZxZZZ Z8 Zh Z Z Z Z(!ZX!Z!Z!Z!Z"ZH"Zx"Z"Z"Z#Z8#Zh#Z#Z#Z#Z($ZX$Z$Z$Z$Z%ZH%Zx%Z%Z%Z&Z8&Zh&Z&Z&Z&Z('ZX'Z'Z'Z'Z(ZH(Zx(Z(Z(Z)Z8)Zh)Z)Z)Z)Z(*ZX*Z*Z*Z*Z+ZH+Zx+Z+Z+Z,Z8,Zh,Z,ZxChJhcWhCIJICJC1J1CJC JCPJ8!Kh"K#K$K%K&K'KH)KX*K+K,K(.K/K1K2K2KX4Kh5KP6K(7K8K:KX;Kx>KAKBKCKCKDKFKGKGKHKJKKKKKxMKOKPKQK(SKHTK8UKXVKHWKXKZK[K]K8`KaKbKcKdKeKgKiKkKpKqKtKXxK8|KK8KXK؃KЄKK`K(KKxKȑKȓKKxKKKؙKȚKXKHK8KKXKKؤKKXKxK(KHKKKطKHKhK8K8K`K(KKKKK(KhKhKKxKKxKKKKXKKKKKK(KKKKKKK(KKKXKKKxKxK8KXKKKLLLLLLXLLL LLLLLLLLLLLLLLLL L!L"L#LH%L&L'L(L)Lh*LH+LX,L-L.L/L2L3L4L4L5L6L7L8L9L:L;LxL>L@LALBLDLELhGLhILKLLLHML8NLPLPLQLhVLYLZLx[Lh\Lx]Lx_L`LxaLcLgLhL8lLnLoLqLrLsLtLxLhyL{L|L8}LH~L8LhL8LLLLLLLLhLLhLȟLLLLLLhLxLXL8LLLLȬLحLLLLLhLXL(LLظLLLPLLLLLLLLLLLLpL8LLLLLLLLLLLxLLLLLLxLxLLLLLLLLLLLLLhLhLxLLLLLLLLLLL8L LLLL8LxMM8MMMMM8 Mh M M MX MXMhMMXMMMMMMMM(MMxMM!M"M#M$M%M(M)M`*M8+M,Mp-M8.M8/M(0M1M2M3M3M4M6M7M(8M9M:M;M;MM?M@MAMBMCMDMEMFMGMHMhIMhJM`KM8LM8MM(NMOMOMPM(RM(SM8TMUMVMVMWMXMYMZM[Mx\Mx]Mx^M(`MbMxcMeMfMgMxhM(jMjMkMlM8nMoMpMrMhsMHtM8uMhvMHwM8xMhyMXzM{M|M(~MxMXMM`M8MHMMMMM(MXMxMHM8M(MMMȒM(MHM(MMMMMȚMțMMMM؟MȠMMMأMMxMMȧMبMMMMMMMMXMXMHMXMMMM`M0MMػMؼMM(MHM(MMM8MXM8M8MxMXMMMxMXMHMMMMM(MMMHMHMHMHMHMM8MhMMHMMMM(MMMMMXMNNhNHNNNN N NxNHNN(NhNN#N(N(-N8.N/Nh2NX3NH4Nx5N7N89N:N;N=NH>N?N@NANDNHNLNONPNQNXUNhXNXYN\N^N_N(aNHbNdNhfN8hNmNoNpNrNwNxxNhyNHzN8{N|N|NXNȁN؂N8NxNȆNNNNXN8NNN8NhNNNNNNNNșNNNNXNXNHN8N(NNNNȦNNNN@NNNNدNȰNHNxNHNHNhNXN`N(NN8N(NHN(NXNNNN8NN8NhNNNNNNXN8NNNNN(NNNNNHNNOOO O OX OH O8 O(OOOOOOpO8OOOOOOHO8 OH!OX"OH#OH$O((O()O*O+O+O,O-O.O0O1O3O4O(6O(7O8OH:O8;O8O?OhAOXCOHOIOKOLONOQO(UOhWO8XOYOYOZO[O\O]Ox^OH_O(`OaOCxJCVJVCJCQJQC^ J^CJ`nWCJCJCeXJeChJlWCJCJCJCxJx CJpW(C@JqW0CJW8C9J9@C78J7HCxJPCJXCJ`CJhCJpCJxC:J:C8JChJCJChJC`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDD D D@ D` D D D D D D D@ D` D D D D D D D@ D` D D D D D D D@ D` D D D D D D D@ D` D D D D DD D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDDD D@D`DDDDD D D@ D` D D D D D!DJPHkQlQhQQQfR LS@LS`LSLSLSLS@S/T0T00Th3T3TXMUVVhVVVVVV(VHVhVVVVVV(VHVPWYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYYYYY Y@Y`YYCJCvJvCJChJCPJCJCJCxJxC'(J'CJCJCJC"J"CJ CJ(CJ0C(J8C`J@CaJaHCPJPC]XJ]XCJ`CEhJЃOЄOPOOpOO؇O O8OxOOOPOOO@O@OOOXOؑOpOOȔO0OOXOؗO8OOЙOOO@OOPOOOOOPOO0O OOOOOOOOOO@OOOO OOصOضOOOOO8OȻO@OO`OOpOOOXOOOOHOxOOO O`OOO O OpOO@OO8O`OOOXOOPO(O OXOpOO OOOOOpOOhO0OOOOOOOOXOOOO`OOOOHOOO`O0OpOxOOPP PXPPPPPPPPP P P`PPPPxPPpPPHPPPP0PPhPPP P PxPPPx"P(#P$P$PP&P&P&P'P'P8)P)P)P`,P@-P-Pp0P0Pp4P85P5P7Pp8P8P;P@;P;P?PX@P@PBPxDPDPEPIPIPIPJPKP`KPKPPOPOPPPQP(RPRPpSPSPSP8TPTP UPPUP`aPXcPePXfPgP hP(iP`jPjPjPkPlP@lPlPmPmP0nPoPpPqPrPhrPrPpsPsPtPtP(uP`vPvPwP8xPxxP8yPhyP(zPhzPP{P{P{P|P|P ~PX~P~PPhPP؉P`PXPPPXP0PؗP`PPPP`PPPPP؝P PPXPPP8PpPHPPPPPXPPدPPP@PPسP PxPP@PPPHPPPPPPPPpPPPPPP@PPPPP`PPPP(PPPHPXPPPPPP8PpPPPP PPPP8PPPXPPXPP P0PXPXPPPpPP PP P`PXPP8PxPhPPP8PP8PPPPPP0PhPpQ@QQQQQQQQ@Q QQ@Q Q Q Q Q Q0 Q(QQpQQPQQQQQQQHQQQQQQpQQQQ Q8!Q!Q"Q#Q#Q$Q$Q`'Q(Q()Qp)Q+Q8+Q+Q,Qx.Q.Q.Q 0Q`0Q0Q81Q1Q3Q04Q4Q6Q7Qh7Q9QX:Q:Q=Q=Q>Q@Qh@Q@QAQCQCQDQFQFQGQHJQJQKQ(LQXLQPMQMQSQTQ`UQ@YQYQZQ8\Qx\Q\QX_Q_Q`QhbQbQxdQeQxeQ(gQhgQgQ hQPhQpjQjQ kQxkQkQkQ lQmQ@mQ({Q~QQ0QXQQ؅Q@QQxQ؈QPQQQhQQQЏQQXQQhQXQQЕQQHQ0QQQXQQQpQQQQQЧQQ@QQ8QةQ8QQQQ@QQQ Q@QQ0QhQQ`QQQQQQXQQ@QxQQQQQQXQQQQ8QQ@QQQQ0QpQhQQ8QPQQQQpQQhQQhQQQ QQQQQ Q QPQ(RRRRHRPRRRR@ R RRRRRRRRRRRRRRPRRh"R@'R'R)R)R*R+R,R.R/R0R1R2R2R 4R5RH6R`8R8R9R9R:R;R=Rp?RARARBRBRXCRXDRDRERFRGR8GRHR8IRMRNRxORORPRHQRQRSRVR0WR[RX[R[Rh\RdRXeReRfRgRkRkRxlRoR`oRoRHrRrRtR@tRXuRuRwRxRxR{R|RH|R}R}R}R~R~RRRЀRRRR(RRRHRRpRhRRRȏRR`RpRRRR@RpRRRЕRRHRRHRxR`RRpRRR RRRpRRpRXRR RRPRRRHRRRRR RhRRPRRXRRRRRнRPRR0RxRRRRRRRRXRR(RRRpRRR0RRR`RRR@RR@RxRRPRR(RRRxR(RR8RRhR@RR@RRPRRRR`RRSS SPSSHSSpSS S S S SX S SS0SpSSSS@SS@SSSS SxSSSSSSSS8SSSXSSPS SP S S`!SH"S"S#Sp#S($S$S(%S%S@&Sp(S(S0)S*SX+S+S,S@-S0/S/S/S1S 2S3S4S`4S5S 6Sx6S8S8S`9S:S:S;SX;S;SpS@?S?S?S@S@BSCSDSESESGSHGSGSPHS@ISJSKSKSXQSQSRS USUSWSWSYSHYSZS8[Sh\S\SX]S^S_S`S@`SbS@cS(eSfSgShS@hS8iShiS(jSkSxlSxmS0nS0oS`oSoSXpSprSxsSsStS@uSxuSvS(wS xSySySySzS|S}SP}SS`SSS`SSSPSSS SXSSpSSSSЌSSS ShS8SS SPSSSpSHSSSHSxSHSSؚS`SSSМS S(S0SpSSSS8SpSSS SpSSShSSS SةSS@SثSS SSShS8S@SSSSHSS(SHSSHSSPSS0SxSSSS0SS0SSSSSS`SSS8S0SSSSPSxSSS SS8SSHS`SSSS`SSSS8SS`SSS`SSPSSS@SSS8SPSSSS8SS0SST@TT8TTTP T T T`TT8TPTTTTTTT(TTTT TT8TTT'T)T)T+T8,T,Tx.T/T/T`0T2T2T@3T3T5Th6T6T;TU?U?U@U@UAUAU8BUxCUCUEUXEUPFUxGUHUIUIUIULULU(MUMUMUNU@NUNUNUOUOUOUPUHPUPUPUX[U8\Uh\U\UP]UyUP}UPUUЂUUpUPUPUUUU8UUUUUUЖUU@UUU UhUءUhUUФUUЦU8U0UpUتUUȬU`UUخU`UUUȵU(UUhUUUUU UPUU@U0UUUhU UUUUUhUUUPU(UUUUXUUU(UUUUUUXUUUUVVVV`VV0VhVV8VVV V V V Vp V V( V Vh V VxVVVHV0(V+V-V .V`.V0V0V 1V4V`5V5V6V@7VP3P>P3hAP3 BP3PBP3BP3EP3GP3GP30JP3KP3LP3 MP3XMP3MP3MP3NP3PP3QP3HQP3RP3TP3TP3xUP3VP3@WP3pWP3WP3WP3(XP3`XP3XP3XP3YP3HYP3YP3YP3YP38ZP3hZP3ZP3ZP3([P3`[P3[P3[P3 \P3`\P3\P3\P3]P3H]P3]P3]P3]P38^P3h^P3^P3^P3_P3aP3xfP3fP30gP3@hP3hP3iP3(kP3xlP3mP3`nP3PqP3sP3sP3puP3vP3wP3xP3yP3zP30|P3}P3h}P3~P3P3P3P3@P3pP30P3pP3ЃP3@P3hP3P3ЇP3ЋP3P3XP3P38P3P3ЍP3hP3P3ЏP3P3@P3xP3P3P3 P3PP3P3ȑP3ȕP3P3P3(P3ЛP3P3P3P3ПP3P3(P3P3آP3P3hP3P3(P3xP3ȨP3P3P3HP3P3ȰP3P3P3P3P3 P3жP3xP3P3P3(P3P3xP3P3hP3P3P3P3P38P3xP3P3PP3XP3P3P30P3(P3P30P3`P3P38P3P3P3P3PP3P3`P3P3HP3P38P3pP3P3P3XP3P3PP3P3P3P3@P3@P3P3P3P3P3PP3@P3P3P3P3P3P30P3P3P3PP3P3pP3P3P3P3 P3XP3P3P3HP3P3P3P3P3P3(P3P3P3P3P3`P3P3P3P3P3P3P3XP3P3P3Q30Q3Q3Q3Q3PQ3HQ3xQ3Q3HQ3Q3 Q3X Q3 Q30 Q3 Q30 Q3X Q3 Q3 Q30Q3Q3Q3Q38Q3Q3Q3pQ3Q3xQ3(Q3Q3Q3XQ38Q3Q30Q3PQ3Q3Q3Q3Q3PQ3Q3xQ3Q3` Q3 Q3!Q3"Q3"Q3#Q30$Q3$Q30&Q3h&Q3&Q3(Q3)Q30*Q3*Q3+Q3(,Q3,Q3,Q3-Q3 .Q3/Q3H/Q3/Q3 2Q32Q33Q34Q385Q35Q3H6Q37Q38Q39Q3:Q3(;Q3;Q3;Q3Q3>Q3?Q3 AQ3pBQ3BQ3@CQ3HDQ3DQ3DQ30EQ3PGQ3HQ3HQ3IQ3IQ3XKQ3KQ3LQ3MQ3MQ3 NQ3XNQ3NQ3(OQ3`OQ3OQ3OQ3PQ3@PQ3xPQ3PQ3PQ3QQ3HSQ3UQ3UQ3hVQ3VQ3VQ3WQ3PWQ3WQ3XQ3ZQ3 [Q3[Q3\Q3 ^Q3h^Q3^Q3_Q30`Q3`Q3aQ3aQ3`cQ3eQ3HfQ3fQ3phQ3hQ3iQ38iQ3piQ3iQ3@lQ3plQ3lQ3`mQ3mQ3oQ3PoQ3oQ3oQ3pQ3PpQ3pQ3pQ3qQ38qQ3xqQ3qQ3qQ38rQ3prQ3rQ3rQ3 sQ3PsQ3sQ3sQ3sQ30tQ3htQ3tQ3tQ3uQ3PuQ3uQ3uQ3(vQ3xvQ3vQ3vQ3 wQ3PwQ3wQ3zQ3XQ3Q3ЁQ3Q3HQ3Q3Q38Q3(Q3Q3Q3Q3Q3Q3(Q3 Q3Q3Q3Q3Q3Q3HQ3Q3ȖQ3hQ3@Q3Q3Q3HQ3Q3Q3Q3Q3ȠQ3PQ3Q38Q3xQ3Q3Q3(Q3`Q3@Q3pQ3hQ3Q3(Q3xQ3Q3Q3HQ3Q3ȬQ3Q38Q3pQ3Q3Q3 Q3ȸQ3Q3XQ3Q3Q3(Q3Q3ؼQ3Q3XQ3Q3ȽQ3Q38Q3pQ3Q3ؾQ3Q3HQ3Q3Q3PQ3Q3Q3Q3Q3Q3HQ3xQ3Q3Q3PQ3Q3Q3Q38Q3pQ3Q3xQ3Q3Q3Q3Q3Q3`Q3Q3Q3Q38Q3hQ3Q3Q3Q3HQ3xQ3Q3Q3Q3Q3Q3PQ3Q3Q3Q3@Q3Q3Q3Q3(Q3`Q3Q3Q3Q3HQ3Q3Q3Q30Q3pQ3Q3Q3Q3XQ3Q3Q3Q3HQ3Q3Q3Q3(Q3XQ3Q3Q3PQ3XQ3Q3Q3Q3XQ3Q3Q3Q3Q3xQ3PQ3Q3pQ3Q3`Q3@Q3Q3pQ3Q3Q30Q3hQ3Q3Q3 Q3hQ3Q3Q3R38R3R3pR3R3R3R3R3R3 R3p R3 R3R3`R3R3R30R3hR3R3R3R3XR3R3R3R3@R3R3pR3R3PR3R38R30R3R3R3hR3R3 "R3"R3'R3@)R3*R3p*R3*R3P+R3+R3`,R3,R3x-R3-R3(.R30R3H1R31R3p2R3@3R33R3H4R385R36R38R38R3X9R3:R3x:R30;R3=R3>R3?R3?R3(BR3BR3CR3 ER3ER3pFR3XGR30HR3IR3MR30NR3NR3(OR30PR3PR3QR38SR3SR3@TR3TR3TR30UR3pUR3UR3UR3WR3ZR3\R3\R3aR3aR3bR3PbR3HdR30fR3hfR3 gR3hR38hR3phR3hR38kR3mR3nR3oR3pR3qR3@qR3qR3qR3rR3sR3htR3uR3uR3uR3@vR3vR3vR3HwR3yR3X{R3|R3`}R3P~R3@R3R3@R30R3R3R38R3R3ȃR3R3`R3R3ЊR3R3R3 R3R3xR3R3 R3R3R3xR3R3R3R30R3R3R3R3R3R3@R3pR3R3R3R3PR3R3R3R3ЫR3R3@R3xR3@R3pR3ذR3R3R3R3@R3 R3R3R3طR3R3R3(R3R3@R3R3R3пR3R3PR3R3R3XR3R3pR3R3R3R3PR3R3R3R3HR3R3R3R38R3pR3R3R3R3XR3R3R3R3@R3xR3R3R3(R3pR3R3R38R3hR3R3R3R3HR3R3R3R3 R3XR3R3R3R30R3`R3R3R3R3pR3R3R3R3R3R3@R3xR3R3R3 R3PR3R3R3R38R3pR3R3R3R3@R3R3R3R3R3R3R3hR3R3PR3R3R3pR3R3hR3R3R3R30R3R3R3R3R3R3R30R3R3(R3S3S3S3S3pS3xS3S3hS3S3S3S3S3S3( S3X S3 S3( S3 S3 S3PS3S3S3S3S3@S3S3S3@S30S3S3XS3S3XS3S38S3S3S3!S3#S3$S3&S3'S3(S3h)S3)S3*S3,S3x-S3-S3-S3.S3 0S3p2S32S383S3 4S34S305S36S36S37S39S3:S3S3>S3P@S3@S3AS3BS3xCS3CS3DS3ES38FS3FS3GS3HS3IS3JS3KS3LS38OS3hOS3OS3OS3OS3QS3RS3TS38TS3VS3VS38WS3WS3XS3XS3pYS3YS3pZS3`[S3\S3]S3]S3^S3_S3h`S3cS3dS3dS3eS3fS3fS30gS3gS3`hS3hS3iS3hjS3(mS3mS3XnS3nS3pS3 qS3qS3rS30sS3sS3ptS3uS3wS3xS3zS3zS3{S3P|S3p}S3~S3S38S3S3S30S3S3@S3XS3S3xS3 S3pS3S38S3HS3HS3ؐS3БS3@S3S3S3S3 S3S3S3S3S3PS3S3S3XS3НS3PS3S3S3`S3S3S3S3XS3XS3 S3S3S3ȧS3S3S3`S3`S3ȮS3`S3S3ЯS3S3PS3S3S3S30S3hS3S3رS3S3@S3xS3S3S3 S3XS3S3S3S30S3hS3S3شS3S3HS3S3S3S3(S3XS3S3S3S30S3hS3S3طS3S3HS3S3S3S30S3pS3S3S3(S3hS3S3S3S3PS3S3S3S3S3pS3S3S3@S3S3S3S3(S3hS3S3S3S3S3S3S3S3S3S38S3pS3S3S3XS3S3(S3S30S3S3S3HS3S3HS3S3S3hS3S3xS3S3hS3@S3S3XS3S3hS3S3S3S3XS3XS3S3S3(S3XS3S3S3S3S3S38S3(S3S3S3 S3PS3S3S3S3S3 T3T3hT3T3T3T30T3hT3T3 T3 T3@ T3p T3T3T3(T3T3T3T3T3T3T30T3hT3T3T3PT3T3 T3H T3 T3!T3@!T3p!T3!T3!T3"T30"T3`"T3"T3"T3"T3 -T3.T30T3H4T36T3 7T3P7T37T3`8T38T38T38T3(9T3h9T39T39T3>T3H>T3>T3>T3>T3 ?T3X?T3?T3?T3@T3DT3DT3ET3JT3MT3OT3OT3PT3PT3QT3@QT3xQT3QT3QT3 RT3hRT3RT3RT3ST3XST3ST3ST3TT3PTT3TT3TT3UT3@UT3xUT3UT3WT3\T3]T3H]T3]T3]T3]T3^T3_T3aT3HdT3hgT3hT3 lT3xlT3mT3oT3qT3rT3HrT3xrT3rT3rT3sT3uT3vT3vT3vT3vT3 wT3PwT3wT3wT3wT3xT3@|T3|T3H}T3x}T3}T3}T3T3pT3T3؂T3T3@T3pT3T38T3ЇT3T3T3T3 T3T3HT3T3؎T3T3HT3T3(T3xT3ȔT38T3xT3T3ؕT3T38T3hT3T3ȜT3T30T38T3pT3T3T3 T3XT3T3ȠT3T38T3pT3T3СT3T3@T3xT3T3T3 T3PT3T3T3 T3 T3T38T3pT3T3(T3T3T38T3T3HT3T3T3T3@T3xT3T3T3T3T3(T3XT3 T3T3T38T3hT3T3T3T3@T3pT3T3T3T30T3hT3T3T3T3(T3XT3T3T3T3T3T3T3hT3T3XT3T3T3T3XT3T3T3T3T3HT3xT3T3T3T38T3pT3T3T3XT3T3@T3T3XT3T30T3xT3T3T3PT3T3@T3pT3T3T3xT3T3T3@U3U3U3U3(U3U3(U3U3pU3(U3U3U3 U30 U3h U3 U3U3`U3 U3U3xU3U30U3xU3U3PU3U3U3U3@U3pU3U3U3U3U3"U38$U3&U30(U3*U3-U3-U30.U3.U3.U3 /U3P/U3/U31U3 2U32U3H3U3x3U33U3P4U3`5U35U3 6U36U3@7U38U3(9U3:U3P;U3;U38=U3p=U3?U3P@U3@U3hAU3`BU3BU38DU3DU3EU3EU3FU3 GU3GU3GU3pHU3@JU3KU3KU30OU3`OU3QU3@QU3xQU3QU3QU3RU3PRU3RU3RU3RU3(SU3XSU3SU3SU3TU38TU3pTU3TU3TU3UU3HUU3UU3UU3UU3 VU3PVU3VU3VU3VU3 WU3XWU3WU3WU3XU30XU3hXU3XU3XU3YU38YU3hYU3YU3YU3ZU3@ZU3pZU3ZU3ZU3[U3[U3[U3p]U3aU3(bU3hbU3bU3bU3cU30cU3`cU3cU3cU3dU30dU3`dU3dU3dU3dU3(eU3XeU3eU3eU3fU30fU3hfU3fU3fU3gU38gU3pgU3gU3gU3hU3PhU3hU3hU3hU3(iU3XiU3iU3iU3iU3jU3HjU3xjU3jU3jU3 kU3PkU3kU3kU3kU3 lU3XlU3lU3lU3mU38mU3mU3mU3mU30nU3`nU3nU3nU3nU3(oU3XoU3oU3oU3oU3 pU3XpU3pU3pU3pU3(qU3XqU3qU3qU3rU30rU3hrU3rU3yU3U30U3U3U3xU3U3U3U3(U3U38U3hU3U3U3U3@U3U3U3@U3xU3U3U3@U3xU3xU3U3U3 U3XU3U3ВU3U30U3`U3U3U3@U3U3U30U3`U3U3pU3ȟU3U3(U3XU3U30U3`U3U3U3УU3U30U3`U3U3U38U3pU3U3U3(U3pU3U3بU3U3@U3PU3U3U3U3HU3 U3PU3U3U3U38U3pU3U3سU3U38U3hU3U3HU3U3U3(U3hU3U3U3U3U3pU3U3U3(U3`U3(U3U3U3U3U3@U3xU3U3U3U3U3hU3U30U3hU3U3U3U3HU3U3U3U38U3pU3U3U3U3HU3U3U3(U3U3U3(U3XU3U3U3U3(U3U3U3U3HU3xU3U3U3U3@U3U3U3U3 U3XU3U3U3U3U3U3@U3U3U3hU3U3U3U3xU3pU3U3U3U3 U3U3U3U3U38U3pU3U3U3U3@U3 U3PU3U3U3U3U3PU3U3PU30U3`U3U3U3U3@U3U3U3U3 U3XU3U3U3U3HU3U3U3U30U3hU3U3U3U3HU3xU3U3U3(U3`U3U3U3U3HV3V3V3V3V3V3XV3 V3 V3 V3 V3P V3 V3 V3(V3XV3V3V3hV3V30V3pV3V3V3@V3V3V3V3PV3V3V3(V3hV3V3V38V3V3V3V30V3hV3V3V3V3HV3V3V3V3(V3`V3V3V3V30V3`V3V3V3V3 V3PV3V3V3V3V3@V3xV3V3V3V38V3hV3V3V3V3@V3pV3V3V3 V38 V3h V3 V3 V3!V3@!V3p!V3!V3!V3"V30"V3`"V3"V3"V3"V30#V3h#V3#V3#V3#V30$V3`$V3$V3'V3-V3p-V3.V3.V3/V3x/V3/V3p1V35V306V36V36V3`7V38:V3x:V3:V3:V3 ;V3X>V3>V3?V3p@V3@V38AV3@BV3BV3CV3IV3HIV3JV3KV3@KV3KV3KV3LV3PLV30NV3`PV3PV3PV3XQV3@RV3SV3(TV3pTV3XUV3UV3VV3VV3XWV3XV3YV3HZV3ZV3ZV3ZV3([V3\V3x]V3]V3(^V3`^V3^V3^V3pbV3bV3cV38cV3cV3cV3dV3@dV3pdV3dV3dV3 eV3XeV3eV3eV3fV3HfV3fV3fV3gV30gV3hV30jV3mV3mV3 nV3XnV3nV3nV3oV3PoV3oV3oV3pV3HpV3pV3pV3qV3HqV3qV3qV3XrV3HtV3tV3uV3vV3HwV3wV3xyV38zV3zV3 {V30|V3h|V3|V3~V3V3V3V3HV3V3V3`V3V3V3HV3V3ІV3V3PV3V3V3V3V3V3؉V3V3XV3V3ȊV3V38V3hV3V3ЋV3V38V3pV3V3ЌV3V3V3ؓV3V3V3(V3`V3V30V3V3HV3V3V3V3V3PV3V3ؤV38V3hV3V3ХV3V3@V3V3(V3`V3V3V3(V3XV3V3V3V30V3hV3V3دV3V3HV3V3V3V3V3жV3XV3V3иV3V3PV3V3V3V38V3pV3V3V3 V3XV3V3V3V3(V3hV3V38V3V3V3V3PV3V3V3V3V3V3V3`V3V3V3@V3,Z3-Z38-Z3p-Z3-Z3-Z3.Z3P.Z3.Z3.Z3.Z3/Z3P/Z3/Z3/Z3/Z3(0Z3`0Z30Z30Z31Z381Z3p1Z31Z31Z32Z3@2Z3p2Z32Z32Z33Z3P3Z33Z33Z33Z304Z3`4Z34Z34Z35Z385Z3h5Z35Z35Z36Z3X6Z36Z36Z37Z387Z3p7Z37Z37Z38Z3P8Z38Z38Z39Z389Z3x9Z39Z39Z3 :Z3h:Z3:Z3:Z3;Z3@;Z3x;Z3;Z3;Z3Z30>Z3`>Z3>Z3>Z3?Z3H?Z3?Z3?Z3?Z3(@Z3`@Z3@Z3@Z3AZ3@AZ3xAZ3AZ3AZ3 BZ3XBZ3BZ3BZ3CZ3@CZ3xCZ3CZ3CZ3DZ3XDZ3DZ3DZ3EZ38EZ3hEZ3EZ3EZ3FZ3@FZ3xFZ3FZ3FZ3GZ3PGZ3GZ3GZ3GZ3 HZ3XHZ3HZ3HZ3HZ3 IZ3XIZ3IZ3IZ3IZ30JZ3hJZ3JZ3JZ3KZ3@KZ3pKZ3KZ3KZ3LZ3PLZ3LZ3LZ3LZ38MZ3pMZ3MZ3MZ3NZ3PNZ3NZ3NZ3NZ3(OZ3`OZ3OZ3OZ3PZ3@PZ3xPZ3PZ3PZ3QZ3PQZ3QZ3QZ3QZ30RZ3hRZ3RZ3RZ3SZ3HSZ3SZ3SZ3SZ3@TZ3TZ3TZ3UZ3PUZ3UZ3UZ3UZ30VZ3hVZ3VZ3VZ3WZ3@WZ3xWZ3WZ3WZ30XZ3hXZ3XZ3XZ3YZ3PYZ3YZ3YZ3YZ3(ZZ3hZZ3ZZ3ZZ3[Z3H[Z3x[Z3[Z3[Z3(\Z3`\Z3\Z3\Z3]Z38]Z3p]Z3]Z3]Z3^Z3`^Z3^Z3^Z3_Z3@_Z3p_Z3_Z3_Z3 `Z3X`Z3`Z3`Z3`Z3aZ3HaZ3aZ3aZ3aZ3 bZ3XbZ3bZ3bZ3cZ38cZ3hcZ3cZ3cZ3dZ30dZ3`dZ3dZ3dZ3eZ38eZ3heZ3eZ3eZ3fZ3@fZ3pfZ3fZ3fZ3 gZ3PgZ3gZ3gZ3gZ3(hZ3XhZ3hZ3hZ3hZ3(iZ3hiZ3iZ3iZ3iZ3(jZ3XjZ3jZ3jZ3jZ30kZ3pkZ3kZ3kZ3lZ3PlZ3lZ3lZ3lZ30mZ3hmZ3mZ3mZ3nZ3PnZ3nZ3nZ3nZ3 oZ3PoZ3oZ3oZ3oZ3pZ3HpZ3xpZ3pZ3pZ3qZ3@qZ3xqZ3qZ3qZ3rZ3@rZ3prZ3rZ3rZ3sZ3@sZ3psZ3sZ3sZ3tZ3PtZ3tZ3tZ3tZ3 uZ3XuZ3uZ3uZ3uZ3 vZ3XvZ3vZ3vZ3wZ38wZ3hwZ3wZ3wZ3xZ3@xZ3pxZ3xZ3xZ3yZ38yZ3pyZ3yZ3yZ3zZ3PzZ3zZ3zZ3zZ3({Z3`{Z3{Z3{Z3{Z3 |Z3P|Z3|Z3|Z3|Z3}Z3H}Z3}Z3}Z3}Z3 ~Z3P~Z3~Z3~Z3~Z3 Z3PZ3Z3Z3Z3(Z3`Z3Z3ȀZ3Z3(Z3XZ3Z3Z3Z3(Z3`Z3Z3ЂZ3Z38Z3hZ3Z3ЃZ3Z30Z3hZ3Z3ȄZ3Z3(Z3XZ3Z3Z3Z3 Z3PZ3Z3Z3Z3(Z3`Z3Z3ȇZ3Z30Z3hZ3Z3ЈZ3Z3@Z3pZ3Z3Z3Z3HZ3Z3Z3Z3Z3HZ3xZ3Z3Z3Z3HZ3Z3Z3Z3Z3@Z3pZ3Z3ЍZ3Z30Z3hZ3Z3؎Z3Z3HZ3xZ3Z3Z3Z3@Z3pZ3Z3ؐZ3Z3@Z3pZ3Z3БZ3Z38Z3hZ3Z3ȒZ3Z38Z3pZ3Z3ؓZ3Z3HZ3Z3Z3Z3 Z3PZ3Z3Z3Z3Z3HZ3xZ3Z3ؖZ3Z3@Z3Z3Z3Z3(Z3hZ3Z3ИZ3Z38Z3pZ3Z3ؙZ3Z38Z3pZ3Z3ؚZ3Z38Z3hZ3Z3țZ3Z3(Z3`Z3Z3МZ3Z3@Z3pZ3Z3НZ3Z38Z3pZ3Z3ОZ3Z30Z3hZ3Z3ПZ3Z30Z3hZ3Z3ȠZ3Z30Z3hZ3Z3СZ3Z30Z3`Z3Z3Z3Z30Z3hZ3Z3Z3 Z3PZ3Z3Z3Z3Z3PZ3Z3Z3Z3Z3HZ3Z3Z3Z3(Z3XZ3Z3ЧZ3Z30Z3`Z3Z3Z3Z3(Z3`Z3Z3Z3Z3(Z3`Z3Z3ȪZ3Z38Z3hZ3Z3ȫZ3Z38Z3pZ3Z3ЬZ3Z38Z3pZ3Z3Z3Z3HZ3xZ3Z3Z3 Z3PZ3Z3Z3Z3Z3PZ3Z3Z3Z3 Z3PZ3Z3Z3Z3Z3HZ3xZ3Z3Z3Z3PZ3Z3Z3Z3Z3`Z3Z3Z3Z30Z3`Z3Z3еZ3Z38Z3hZ3Z3жZ3Z38Z3hZ3Z3ȷZ3Z30Z3hZ3Z3ظZ3Z3@Z3xZ3Z3عZ3Z3@Z3pZ3Z3кZ3Z38Z3hZ3Z3лZ3Z30Z3`Z3Z3мZ3Z30Z3`Z3Z3Z3Z30Z3`Z3Z3ȾZ3Z3(Z3XZ3Z3Z3Z3Z3HZ3xZ3Z3Z3Z38Z3hZ3Z3Z3Z3(Z3XZ3Z3Z3Z3Z3HZ3xZ3Z3Z3Z38Z3hZ3Z3Z3Z3(Z3XZ3Z3Z3Z3Z3HZ3xZ3Z3Z3Z38Z3hZ3Z3Z3Z3(Z3XZ3Z3Z3Z3Z3HZ3xZ3Z3Z3Z38Z3hZ3Z3Z3Z3(Z3XZ3Z3Z3Z3Z3HZ3xZ3Z3Z3Z38Z3hZ3Z3Z3Z3(Z3XZ3Z3Z3Z3Z3HZ3xZ3Z3Z3Z38Z3hZ3Z3Z3Z3(Z3XZ3Z3Z3Z3Z3HZ3xZ3Z3Z3Z38Z3hZ3Z3Z3Z3(Z3XZ3Z3Z3Z3Z3HZ3xZ3Z3Z3Z38Z3hZ3Z3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3Z38Z3xZ3Z3xCgxJgC>J>CJCJCJC1J1C@JCJCiJi C}HJ}0CJ8CpJ@CJ]WHC]WhC(JpCX@JXxCJCJ8WWCJC<PJ<CJC3J3C(pJ(CCCCCCCCtCCC Cu(C0CC8C@CYHCPC_XCz`CpCxC4CMCCsCCCvCuClCxC@pCHnCȗC`CCCC C(ChC_+EH7+EH7+EX7+EX7+Eh7+Eh7+Ex7+Ex7+E7+E7+E7+E7+E7+E7+E7,E7,E7,E7,E7 ,E7(,E70,E78,E7@,E7H,E8P,E8X,E8`,E8h,E(8p,E(8x,E88,E88,EH8,EH8,EX8,EX8,Eh8,Eh8,Ex8,Ex8,E8,E8,E8,E8,E8,E8,E8-E8-E8-E8-E8 -E8(-E80-E88-E8@-E8H-E9P-E9X-E9`-E9h-E(9p-E(9x-E89-E89:I<J'JP'0J@KhKK8!K3"K,#K,8$K3$K, %KP'(%K,%K,&Ky&K,'Kr'K,h)K,x*K,*Kr+K,,K3(,K.K81K,p1KP'x1K,(2K,x2Kr3K,H3K3X3Klx4K,4Kl5K,5KP'5K,p6K,6KP'6K,8K,(9Kr8:K,x:K3>KH8AK,xAK3AK}8BK,pBKP'xBK,(CK,xCKrDK,HDK3DK,8EK3HEKH(FK,hFK3xFK}(GK,`GKP'hGK,HK,hHKrHK,8IK3HIKl(JK,xJKl(KK,`KKP'hKK,OKPKPKP'PK,QK,HSK,hTK,XUK,xVK,hWK,ZK,([Kr\K,h\K}h^KlX`K,`K3aK,bK,cK3cKHcK,8dK3dK,eK,fKP'fK,(pK,qK,hK3XK,xK,K3K,8K3KP'K,KP'K,KxKP'K,HK,KP'K,KЉK,8K,K,8K, KP'(K,xKK,K, KP'(K,xK,K3ȜKlhK,KlXK,KP'K,8K,8K,hKpKxK,KpKpHK,hK,KqKqسK,K,K,hK,K3K,KP'ȺK,غK]K]KH]KH]XK,KExKP'K,KP'K,HK,K,K3K,K3K,K3KH]K,K,K3K,K3K,K3K,(K,hK3K,K,K,HK8PK8K3HK,K,K,8K,(K,K,K,HK,K,K,K,XK3XK,KP'K,xK,KP'K,K,(L,L,PLP'XL,L,L,L,LP'L,LL, L, LP'(L,L,8LrL,LlL,8L3HLppL,L,L,L,L9L,L,L,LP'L,L,LP'L,hLL, LP'( L, L,!Lr!L,!Ll"L,#L3(#Lpp#L,h%L,&LP'('LH]'L,(LP'(L,)LP')L,*L*L,h+L,+LP'+L,x,L,,Lr-L,.L,0L,82L,x2L32Lt83L,3LXo(4L,x4L`5L,X5L3h5Lu6L,X6L3h6L}7L,X7Li7L,H8LА8L,09LP'89L,:L,h:Lr:LP';L,;LP';L,LP'@>L,?L,8@L,8AL,pALP'xAL,8BL,GL,IL,(KL,(LL,`LLP'hLL,`MLP'MLH]XNL,NLr(PL,hPL3QL,YL,ZLP'ZL,[L,[L3[L}\L,\LP'\L,]LЉ]LЉ_L,`L,aL3aL,xcL3cL]cL]gL,(hLP'0hL,iLrXlL,8nL,8qL,xrLtL,xL,yL3({L,h{L3x{L}8|L,p|LP'x|L,X}L,h~L,XL,L3L,L,ȔL,L3ؕL,ؖL,L,LP'ȝL,؝L]L]L,(L3ȠL,LrȡL,L9L,LrL,L9L,LP'L,L,إLyL,xL,ȧLsXL,L8L,(L,hL3L,HL3L,(L9L,8L,pLP'xL,PLP'XL,hL]pL]ȲL,Ly8L,xL3L}L,LP'ȵL,xL,ȶLHL,LL,PLP'XL,L,HLrعL,(LLP'L,L3L@hLP'pL,L3LH0LP'8L,LL,@LP'HL,L,XLrL,ؿL,(LL,XL3hL@L,XL3hLHL,XLL, LP'(L,L,8LrL,LLP'L,L3L@PLP'XL,L3LHLP' L,pLL, LP'(L,L,8LrL,L,LL,8L3HL@L,8L3HLHL,(LL,LP'L,L,LrL,LxL,LP'L, L30L@L,LL,8LnLP'L,L3 LlL,LlL,L}L,LP'L,L,LrL,PL(LL,8LL,L,(L38L@L,HLL,hLyLP'L,PL3`LtL,(LnLP'L,L3LlL,LlL,L}L,LP'L,L,LrL,8LL,8LL,L,(L38LyLP'L,L3(LtL,LxL,L,L3L@L,(LXL,Ln8LP'@L,L3LlL,XLlL,XL}L,PLP'XL,XL,LrM,MM,(MXM,M,MyMP'M,(M38MtM,MxM,X M, M3 M@ M, M M, Mn MP' M, M3 Mlx M, MlxM,M}M,MP'M,M MxM,M,HM3M,8M3M,M,M,HM3M,8M3MP'M,MP'M,M]M]"M,@"MP'H"M,#M,@#MP'H#M,$M,@$MP'H$M,%M,@%MP'H%M,@&MP'H&M,X&M]`&M](MP'(M, )MP'()M,)MP')M,)MP')M,*M]*M]x*MP'*MP'*M,P+MP'+MP'+M,8,M,-MP'-M,-M3-MppX.M,.MPX/M,/MP'/M,@0MP'0M30Mf(1M,x1MP(2M,`2MP'h2M,(3M,x3M3M,H4MH5M3X5M86M,6MP87M,p7MP'x7M,H8M,8M38Me(9M,x9MP(:M,`:MP'h:M,h;M3x;Me;MP'MP'>M,?M3?MeAM3CM,XCMPDM,@DMP'HDM,EMP'XEM3hEMtEM,8FMPFM, GMP'(GM,GM,(HM38HMyHMP'HM,HM3IMtIM,IMPJM,JMP'JM,xKMP'KM3KM}XLM,LMPXMM,MMP'MM,HNM,NM3NMy0OM,OMPM,XPMXQM3hQMHRM,RMPHSM,SMP'SM,PTMP'XTM,TM3TMu(UM,xUMP(VM,`VMP'hVM,WMP'WM,hWMiWM,8XMPXM, YMP'(YM,YM,8ZMPZM, [MP'([M,[M,\MHg\M,\MP]M,]MP']M,^M,^My`M}8bM,bM|cM,cMXo8eM,xeM9fMH]8gM,hM,hM3@jMP'HjM,jM(hkM,hkMPlM,PlMP'XlM,mM,hmMuXnM,nMvoM,oM@ppM,HqMHn8rM,rMlsMP'sM,`tMP'tMH]XuM,uMevMP'vM,`wMP'wMH]XxM,xMzyMP'yMH]xzM,zM{MP'8|MH]|M,(}MH~M,~MM,xM,MP'M,M,MM,ЃMXM,M3MM,MsM,MpM,MHuHM,MtxM,MP'M,M,MXoMMiHM,M3M((M,hM3xM`M,HM3XMM,8MlHM,MP'M,hM,MrHM,M3Mu8M,xM3M}(M,`MP'hM,(M,M,XMi(M38MtM, MP'(M,؜M,Mi(MtM,0MP'8M,M,8MiXMtM,PMP'XM,M,HM`ȤM,MPk(M38MM,M,MP'M,ЬM, MXoMtMP'M,MiM}pMP'ȲMH]xM,ȳMhM,MP'M,xM,ȵMyM,MsM,M9M,MP'M,M,йM`PM,MPk M,M,HMА8M3HMM,XMHM,M`MP'hM,HM,8M,Mp(M,`MP'hM,XM,MP'M,M]M]xM,MrXM,M3M}M(hM,MP'M,MrM,HM3XM}M(hxM,MP'M,`MP'hM,M3M}8M,M(h(M,`MP'hM,M,@MP'HM,XM]`M]hM3hM,M3hM,M3hM,M3hM,M3hM,(M,XM,M,M,hM,M,0MP'8M,HM]PM]8M,xM3(M,HM,M3(M,M0 M0M,M,xM,8N,xN3N,N3N,N3N,N3N,N,hN,XN3-N3P.NP'X.N,.N3`/NP'h/N,x/N]/N]2N,2N3x3N,3N3h4N,5N05N07N,X9N,:N,:N3;N,(=N,h>N,?N,(@N3AN3LN,8ON,PN,XNP'XNH] ]NP'(]N,8]N]@]N]_N,H_N3HaN,hpNH]hqNH]wN,xN,yN,hzN,X{N,8|N,N,8NrHNXoXN,N`NPk8NtN,XN3hNuXNH]8N,N}xN,N3ȋN0PNP'XN,8N,Ns(N,xNzXN,NN,NP'ȐN,N,N3ؒN,ȓN,NN,hNN,ȗN,N,N3N,ؚN,N,8N,xN,hN,XN,HN,8N,N,N,N,اN,(N,xNrN,XNXNP'`N,N3Nl(N,xNlN,hNnN,HN3XNtN,0NP'8N,N,N,شN3NnhN,NPhN,NP'N,N,طNrxN,N3ȸNxNP'N,N3йNlHN,Nl8N,xN3N}XN,NP'N,HN,NP'N,N]N]HN,N3N,XN,NP'N,N,N3N,8N,N,@NP'HN,N,8N3N,xN,XN,N,N3(N,8N,pNP'xN,N,HN38NH]N,O,XO3(O,O,OP'O,O]O] OP' O, O3 OP' O, O3x O, O3h O, O3X O, O3HO,O38O,xO3(O,hO3O,XO3OP'O,@O3OP'O,O3OP'O,O3XO,OP'O,O] O]O,O3O,hO,OrX O, O3 Olh!O,!Olx"O,"O3h#O,#OP'#O,$OnH(O,(OjH)O,)OP')O,(*O,h*O3 +OP'(+O,x+O],O,X,O-O,X-Or.O,/O,0O,01OP'81O,2O,@2OP'H2O,X2O]`2O]3O, 4OP'(4O,4O,5OP'5O,(5O]05O]H6O,6Or7Ol8O,(9Olh:O,:OP':O,X;O,;OrXOl>O,0?OP'8?O,?O,HO,IOP'IO,KO,HUO,UOP'UO,UO]UO]WO,WOP'WO,XXO,XOP'XO,(YO,`YOP'hYO,YO,0ZOP'8ZO,ZO,[OP'[O,([O]0[O]\O,@\OP'H\O,\O, ]OP'(]O,8]O]@]O]]OP']O,^OP'^O, ^O](^O]^OP'^O,^OP'^O,^O]^O]h_O,_OP'_O,H`O,`OP'`O,`O]`O]8aO,paOP'xaO,aO]aO]gOP'HgOP'~OP'~OP'@OP'OP'OP'OP'`OP'OP'OP'8OP'OP'O{O `O O OȼOOh؆OyOȼOOȼOh8OrPOOАOȼOXOhOhxOwO{O@OyOr0OiȌO OhOXOOOȼ0OXhOpOȼxO OOXOOȼO OOXؔOhxOwO{OrOO(OOА`OhOpOOOO(OЧOاOOАOH0OOOȪOOH(O OhxOwO{ȭO`lЭOrOHO}OOȯOO OXO hO OOpȳOhxгOwسO{O`lOrOHO}OO`0OHO0OHOOOHO`O` OhOxO`O8OЯOO0O@OPOO`POhOpOOOhxO0mPOPv`OxhOOpOxOOOOO`OOOА(Oh0Ohx8O0OOOhOxO@O0OOOO O(Ohx0Ow8O{@O`lHOrPO}XOlxOHOOO@OPO`O Ox0Ohx8OPv@O0mHO`O {OOOOhxPOy`O0mhOPvpOHxOzOxO {OOhxOPvOzO {O0mOpOOOOX O0OOOOpOO`O OOO`OOPvOhxOz(Ox`OPvhOzpO {xOO OxOOOO`OHOOOPhPPhxPwP{P`lP P P P {( P0m Px Phx P P P0mP { P8PP {P P0mPPP PPPP P(P0P HPPPP(PHPP P `PhPPPP0mPPP@PxHPpPk(P8PP {PЉP0m"Phx"Pw"P{"P`l"PЉ#P`&Ph&Pp&P'Phx'Pw'P{'P`l'Pl'PlH)PX)PXh)PP)P)P)P )P p,Px,P,P,P,Px-P`-Px0PX0P 0P 4P4P4PH4P4PX5P`h5P {5Px5P`5PА6P6P 06P 8P8P 8P8P`8P8P8P8Px9P;P ;PX`;P;P ?P?Pp?Ph@PXx@Phx@P @Pp@PPe@P@P`@P0AP 8APPePAPBP0DPDPDPH0EPz8EPxPEPXEP( pEPhxxEP {EPEP IP(IP0IP8IPp@IPXHIPIPIP`IPhxIPpJP JP JP {JPxOPOPOP OP`OP`PPX8PPЉ@PPhxPRPАSP`SPhxTP XTPP'`TP `UPpaP`lbPbPbPcPpcPq dP fPhfPgP8xjPȼkP`lPH hlPlPH mPmPXnPHnP PnPpP0pP@pPpPАpP0(qP_0qP 8qP @qP rP0sP@sPtPtPHuP PuP_`uP wPwP`{P{P{P|P |P|P|P 0~P8~P~PPPXPЁPh؁P(xPpPPPxPЂPPPPPP P0P@PЊP0؊P8PP_P PP P P P (P( PȔPPpPP( P P P PpPؘP PPh P PPP`PhPpP`PhP0Pw8Phx@P{HP`l8PxPPkPhHP@XPX`PxPP8P@ЧP PH @PPP XPH ȫPXPP(P@pP xPHPPXP P (PPXP P`PXpP@PPX@PP PPX P8`PpPP P P`PpPPP PPP@PА0P^XP (P(PXPPPPPPvPxPȼPȼPhPЯP P_ P(P0PP@pPhxxPwP{P`lPP@P HPPP XP `PrPPPPhxP@(PkhP@PhxPwP{P`lHPPPPPX`PhPpPXHPXPhPpP P(PX0PhP@0P@PPXP8P@0PPP P P PPhxPwP{@PP PPPPhhPpPxP(PXPPXPxPPP HPhxPPwXP{`P`lhPrpPlxPppPiPP`PhPPPXPQQQXQHQ`QАhQQ@QhxQwQ{Q`lQQQQX`QQhxQwQ{Q`l Q( Q0 Q8 Q Qh Qk Q Q Q Q Q@ Q Q8Q@`QhQQr`QQQ QhxQwQ{Q`lQrQlQppQ(QQQH(Q0Q_@Q {QQQ`Q QH!QX!Q"Q0#Q$Q$Q0$QАp'Qhxx'Qw'Q{'Q`l'Qr'Qt'QXo'Q`'Qu'Q}'Qi'QА((Q 8)Q@)QH)QP+Q_X+Q`^,Q,Q.Q@00Q80Q0Q H1QhxP1QwX1Q{`1Qrp1Q4QX4Q`4Q 4Q 6Q6Q@9Q:Q_8=Q@=Q=QX=Q=Q@0@Q8@Q@Q@QCQ`0DQ (FQhx0FQw8FQ{@FQ`lXJQ`JQJQJQ8KQ@KQ pLQ `MQxMQMQSQSQTQ(UQ@UQUQ UQ UQrPYQXYQpYQ0xYQZQpZQZQH\Q`QxbQhxbQwbQ{bQ`lbQrbQ}dQdQ eQeQPveQxeQ0m@gQ(`hQ@jQjQА8{Q`l@{Q@P{Q{QP{Q{Q0`|Q |QА|Q8P}Q}QЉ(~Q 8~Q@~QP~Q_X~Q ~Q ~QQhxQwQ{hQpQQX(Q @QQА Q PQQQQQ@0QАQQȼQQQ Q_QQhQQHQhQQQQКQؚQQ`QQXQPvțQ {؛QgQЉQkQ@PQg(QQ Qhx(Qw0Q{8Q`l@QrhQQ}QXQ`Q QQQQشQxQXQx Q(Q8xQQQQضQQQQ8QHQ XQxQ@ȷQ طQH Q QHQQH(Q@Q HQPQXQ`QHhQpQxQQQQQ ȺQ@@Q QxXQhQxQQQ QQH Q(QHQQpQQXQ8Q`Q@QXQ Q Q Q QHQQ(Q0Q.8Q/hQ Q(QQ Q 0Qh 8Q@QHQ(PQXQ `Q Q Q QQQ Qh Q Q( Q QQQQ Q0QpQXxQQQ@Q Q Q`lQ@QQPePQ PQ xQ QQ`tQQhQ`tQrxQhxQwQ{Q`lQ`tQrQixQhxQwQ{Q`lQ`tQQh8Qy@R(RwR{RRhxRwR{R`lRyRs R Ri R R0Rf8R@RHRkPR``R8dR8dRP'R`tRP'R`lR Rw(R RRRRR0Ry8R@RHRpRRhRwR{RRp RRhxRwR{R`l R(Ry0R}P'RhxX'Rw`'R{h'R`lp'Rx'R)R )Rx)R_,R /Rhx/Rw/R{/R`l/Rr/R/R@/RH/R01Rr81Rx2Rx 2R 2R@2Rx84R_5Rhx5Rw5R{5R`l6Rr6R6R@ 6RH(6Rp8R 9R9R9R;R, ;R ARhx(ARw0AR{8AR`l@ARrHARPAR@XARH`ARBRBR BRrBRxhCRpCRxCR CRhDRpDRxDRDRXDRxDR ER@ERxFRGRxHRhxHRwHR{HR`lHRrIRIR@IRHIRMR ORORORXOROR ORxXQRx`QR0QR_VRhxVRwVR{VRrVRxVR@VRVRVRnWRlWRlWR}([R8[R p[R [R,x\R\R\R dRdRdRXxeR0eReReReR eRhfR fR fRkRkRkRkRkRXlR0lR8lRXPlR XlR0lR lR lRlRlR/lR lR (oR0oR8oR@oRXpoRrR,tR tR@huRpuRuR(wR 0wR xRhx(xRw0xR{HxRrPxRXxR`xRpxR@xxRxRyxRtxRxRnxRlxRlxR}{R{R (|R }R}R}R~R~R~RR RRXRxRR R@8Rhx@RwHR{PR`lXR`RrhRpRRyRtRxR@RRRnRlȆRlІR}RRR(R `RhRR RRR xRRRXȎRЎR؎R R؏RRRX(R0R8R RRXR БRؑR RRXPRXR hRxRRXȔR0ДRؔR Rx R,R@R R@`RR R(RpRxR RRRRhRhȚRhx0R RhxRwR{R`l0Rr8R@RPRyXRt`RxpR@xRRRnRlRlR}RRRR RR(R RHRPRRhR(R حRR0RRXRRRpRxR RкRR_ R(R 8R@RRR,hRHRPRPXR`R`R(R8R@R RRRR`l RPRPeRR0RR `RRpRеxRRhxRw R{(R8R`lRhxRwR{RR`lRhxRwR{RR`lRhxRwR{RR`lRXcXRRbRPRb R`l0RPe8R`RRbRw8RXcR R R RRRhRRkXRppRhxRwR{R@RppRPRP'Rf8Rhx@RwHR{PR@`RfpRPRhRP'PRfXR`RhRRhxRwR{R@(R0R8RHRPRP'XReRhxRwR{R@Re RP0RhhRP'ReRepRhxxRwR{R@ReReRPRP'SeSe Shx Sw( S{0 S@8 Seh SP SP' Sth Shxp Swx S{ S@ St SP Sh SP'StSy Shx(Sw0S{8S@HSyPSt`SPSP'XS}`StShxSwS{S@S} SPXSP'SSSStSyS S(SShxSwS{S@SySSSSPPSP'SuhShxpSwxS{S@SuSPSP'`ShSh Si Shx!Sw!S{!S@ !Si0!SP@!Shx!SP'"Su"St"Si(#Shx0#Sw8#S{@#S@P#SP#SP'8$S@$S8@%SHg%Shx%Sw%S{%S@&SHg &SPX&SP'`&S8h&S(S(S`(Sh(SX(S)SyH)S +S+Sp+Shh+Sp+S f+S}+S0+S +S +S ,S,S f-SX-S `-S h-S @/SH/S0h/Sh/SX/SXo/S f0S 0S 1Shx1Sw1S{1S`l1S@1Sy1S}1S|1SXo2Si@2SP'3S3S4Shx5S86SXH6S P6Sw8S9SX9S 9Sw 9S{89Shxx9S9S :S(:S`:Sp;S(hSX>S>SHnP?S?SX?S@SX@S@SuDSDSESFS0GSXGSXhHSJS JSKSXhQSQSQSQSQSRS RS 0RSHRS(PRShRS 0UShx8USw@US{HUS`lPUS@XUSu`USvhUS@ppUSHnxUSlUSeUS`|USzUSUSUSUSUSVSP'(YSZS[S [Sh]S ^S _S(_SX@_SH_S`S `SP`SX`SbShxbSwbS{bS`lbS@bSbScScSscSpcSHu cSt`cSP'8jSXPjSXjS`kShxkSwkS{lS`llS@lSc lSXo(lS0lSi8lS(@lS`HlSPlSlXlS}lSP'lSmSmS@nS@oSЯoShxoSwpS{pS@pSrpSu pS}8pShrSP'tStS0tSȼtStS`vShxvSwvS{vS@wSiwSt@wSP'0xS8xS@xSȼHxS`yShxySwyS{yS@ySiyStySP'zSzSȼ|S|Sȼ|S |S(S 0SpSSȼSSX؃S(S`S(`ShSȼpS 0SP'hShxpSwxS{S`lS@S`SPkSȈSSP'SSS`S S ЋS؋SS`SSS(SSSShSȏS`8SS S PS`XSS S ShxSwS{S`lS@Sc(SXo0St8Si@S}PSSP'S`SSShSЗSyS S( ShSpShSSsS pShShxSwS{SySsțSiShxSwS{S`lS@@SP'8S@SPSȠSSSȣSS8S @S SSS`ȥSАxSS`SS SPS ShxSwS{S`lS@S` SPk0SА8S@SHS`SpSP'0SxS`lS SPeShxSS(S(S`@SSkSSS PS S,S S_SP'PSXSSSS`S0hSShxSwS{SrS}S(hXS`ShSXSSS0XS`SXhSSS(ShSPaxS SS0HS XS S_SpSS S SȼSS Sp@SP'HSP'ShxSwS{S`lSrS}S(hPSSS`ShxSwS{S`lS}S(hpS`lSS SpS S8S@SpSXS_S `S@hSS S XS`pSSXS ShShx`S`lxSPe S SSXSX`S xSSSSSPSXXS pSSSTT`TXhT pTTP>T5TTT( T HTXTT@ TX(T TP>T7TT T T T0` T@pT@xTThTXT TPTP>XT5`T7pT,xTTT T_T T T T T( `T@pTxTTT T TP>T5T5TTT(T T TTTTT HTXT`TTXT T8T0HTTDTT T_'T'TH(TX(T()TX0)T 8)TP)T`)T)T3)T4)T )T`4)T D*TD*T*T0 *T(*TP0*T8*T @*T +T+T,TX,TX`,T h,T,T,TА,T0,TP>,T5,T5,T,T,T-T -T p0T x0T 0T( 0Th 0Th0T0T0T(0T(2T2T3T03T 3T 3T( 3Th 3Th3T3T4Th4T4T(4T 4T((4T 5T5T6T06T (DT58DT@DTpDT xDT GTHT@ HT(HTHHTXHT`HTxHTITXIT ITITIT08JT @JTP>HJT5PJT5XJT`JThJTpJT hNT0(OTXT`lYTPYTPeYT0ZTP([T8[T@[TPH[T`[T ^TX^T ^T5^T_T`T`T cTp(cT@0cT8cT@cT0dT 8dT0eT@eTeTfT fT@fTfTXfT @gT5HgT5PgTXgTPhT@hT HkT@PkTkTXkT kT5kT,kTkT_lT lT lT( mT@(mT0mTmT nT@nTnT0oTpoT `tTptTHPuTXXuT `uT08zTHzTPzThzT({TX0{T P{T{TD{T|T |T (|T50|TT Th(T8T@THT PTXTTXT T`TT3T T DȁTD؁TTPTT T TT TTXT TАT0T5T,T5TT_T(T T T(hTXpT T0TTTT T0T@TXT`TTXT T0T5T5TTT TThT(T@TTXT T T0T5T5TTT@TT TTTTTTXT T0xT T5T5TTTXT00TT`lTTPeT0TT(T0T PT T8T@TTPeT TTخTTTTXT ȲTHTT THPT0TT0(TXHT pTАxTTTHTTФTTXT TTTTФT@TPTTTTTАTT0T08TT T PT @T T(T`PT(XT``TPT(XT``TT0Tx8TPThT0TPTTTT TX(T T Tе`ThTXTTȼTT(TȼTTȼTTT8T0HT`0TTTȼTUUUXUUhxUwU{UrUXoU`UPkUtUuU}U0Us Uz(UUXU UhxUȼU0UXHU PUhxXU U U U U UX Uȼ U U U U U`p UP UUUXU U UhxUȼU U(UX8UUUU UXU UhUpU UU(U`UU@UXUXU U(U *U*U( *U`,U,U(,U`,U-U p-Ux-U0-U-U-U`-U.U.U0U0U1UX01U `1U`h1U01U 1U2U4U4U5U@5U H5UPP5U 6U6U6U7U 8Uhx(8Uw08U{88Ur@8UH8UlP8UlX8Un`8Ut:Uh:U:U :U(:U`h:UX:U :U:U :U>U?UX(?U 0?U 8?UnX?Uhx`?UЯ?UnPBUnCUhxCUwCU{CU`lCUnCUPCUh EU(EU0EUhEUpFUGUHUHUЯIUhxIUwIU{IUrIUIUlIUlIU}LULUPLULUP@MU MUMU MUMU NUPUPUФx[U\U\U\UyU`lzU 0zUPeHzUXzUhzUАzUzUzUPzU`zUzU0{Ux{U{UP|U }Uhxh}U }U}U }UP~UX~U~U@UU U `UU8UUU0`U(U`0U8UPv@UwPUxhUxU0mUXUhUАpUUU0 UUUUU@U` U(U0UPU(U0U0HUUUUUАUUUxU U UU_ؙUU@ UUUАȝU`UU8xU`UU0UPUUhUPxUU HUHUUUPUU_0U 8U ȰUUHUXUpUАxUU0ȶUU иUػUU8UUUUU0mUU0U0mPUUU8UPUUU0U U`lU_UUUhUU`UUȼUUhUU U0U8UX@UPaPUhU UU8U( U(Ux0Uh8UhxpU U UU8U(UUxUhUhx@U hU (UU8U0UU`UxUȑ(U@UАhU0U UUUU 0U 8U( @UV`lVV8VhxV Vvx VVVАV0 V(V_XV @(V`l+V +V (+V 0+V( 8+VH @+Vh H+V P+V X+V `+V ,V, ,V(,V8,V@,VH,Vx,V,V,V,V,V,V,V@,V,V,V,V,V,V0V0VX81VP1V X1V 4V5V5Vx5V`5Vx6VP7VpV>V >V {8?VAVAV`hCV pCV IVhxJVwJV{JV`lJVr JVl(JVlNVNVxNVkNVȼNVXOV`OVnxOVOV`OVpOV`OVhOVPVx PVh@PVkQVQVnSVhxSVw SV{(SV`l0SVn8SVjXVV`YVYVp\Vx\V\VH\VH\Vx\VPv\Vk\V0\Vh8]V H]VkP]Vh_Vhx_Vw_V{_V`l_V_Vr`hV`lxhV@`iV iV rV`lrV@sV tVuVpvVАvV`vVwV`xVhxxVwxV{xV`lxVrxVlxVlyVyVzVzV{V{Vȑ{V |V x}V}V`}V}Vȑ~V p~Vhxx~Vw~V{~Vr~Vl~VlPVhxXV0mhV`lpVPvxVzVxVV(VHVVVVkЄV0PVXV0pVV`VqpVV`VVVЯV0V VhxPV`V {hV Vh VvVVV`VkVȘVȑVv V ȠVXV`xVVvȤV xV`VV0VhV HVpVXxV VVȴVkشV00V8V pV(V`l V0@VPeHV XVȾVhxоVؾVȑV V VvV VhVhxpVwxV{V`lVhxVvVvVhxHVvVHVxV V VVxVV Vx(VXV`VVVxVVVVVV VPVXVx`VVVxVVVxVVV8 V(V0V8VжVVVVȼHVPVVhVVXVHVV(V0V`VhV@pVVVVV V V VPVxXV`V hVpVxVVV VVVVV0V8VhVpV`VطV(VV@VPVV(VVVV VV@VVVV VVV VVV8VphV8VhV VVhV8VhhVHpV8VV8VV8V@VpVxVVVhVVVhVV8V8V@VhHVxVVVVV@VpVVVV0V`VhVhVhVV((V0V8VX@VФpVxVVФVhVHVhV@V(Vh0V8VphVhVhVV8VVФVV8HVPVVVVHVH@VHVPV0VVȑVVVVVVФV@VHVФxVVФVȞVV8V8VФ(V0VФ`VhV8pVxVhVV8VVhVV8VVVpV8HVPV8XV`VhVpVVФVXVVpVPVVV0VX8V@VpHVPPVXV`VVVVxVVWWWФHWPWФWWW8WWhWW0W8W@WpWhxWWWWWWФWWhW8W@WHWФPWWWWWФWWWWФW@WpWWPWWWWHWWWpHW@xWȼW(W@WhpWxWWWW(WhWPWتW0Wp`W(hWpWxW8WWWWWWWpWXPW8XWWWИWW WWW(W(WWИ W0(W(0W(WWW W@WpWxWWWWW %W%WH%W%Wȟ%W8%W(&WX&W&W&WH&W&Wȟ&W8&W&W`'W@'Wp'Wx'W`'W'W'W'WP`+Wn+Wn+W(,Wj@,W}x,Wpp,W(h,W -WnX-Wn-W(-Wj.Wv8.Wup.Wl.Wx.W@p/WHnP/Wt/Wy/Wxn/W00Wkh0Wr0Wy0Wj1WHgH1W@}1Wf1We1We(2Wxd`2W(|2W2W3W8x@3W~x3Ww3W~3W(l 4W|X4W{4Wp4Wx5WX{85Wdp5Wg5Ws5Wv6W(~P6W6W6We6W`|07Wh7W7Wz7W8WXsH8Whm8Wp8Wt8W0r(9Wq`9Ws9WPq9W(t:Wp@:WHux:Ws:Wm:W} ;WX;WP;Wq;WuW8xh>W~>WXo>W`?WPkH?Wi?Wp?W0r@GWHGW_W_WХ@fWpfWxfW8fWЯfW(fWfWPgWjWȼjWHkWH@kWȼHkW xkWȼkW kWkW؇WPW WWHW(PWXW(Wȼ0WWWWW0WpWWhиWWWWȬWХHWpPW WPWXW`WhWxpW(xW(WWW@W@W`W`WؚWWWW؜Wx(W(0W8W hWWWWWW8W@WPpWWW hW(pWxW WWWW@WHWxWWPWWW Y_[H7[H7[X7 [X7([h70[h78[x7@[x7H[7P[7X[7`[7h[7p[7x[7[7[7[7[7[7[7[7[7[7[8[8[8[8[(8[(8[88[88[H8[H8[X8 [X8([h80[h88[x8@[x8H[8P[8X[8`[8h[8p[8x[8[8[8[8[8[8[8[8[8[8[9[9[9[9[(9[(9[89 [89_<0`'``P'xJJJOJ%JJJgJJJJJGJ(J0J8J@JHJXJ7`JhJpJXxJ2JJJJiJJ(cOhO8lOmO~OVVhVVV(VVxVVVXVV8VVxVVVXVVVHVVVVhVx W W(WWhWhWW!WX"W#W$W$WX%W0)W*W8AWFWSW UW_W`WPWxWWW@WpWHWWJnJNJ]JJJSJiJJb0JHJ'XJ`J^J`JkJJJJJtJuJJ|JJ0JlVlWl0BWlX^Wl0`Wl8WlȲWlWlWl@JHJsPJ`JhJpJJ#JJNJJJJJO`OOOOP@P9PdP@iPxP{PXPxPxUQPQHQPQQQRHGRlR8wR?S(ESuS SPSShSSSTTT(LT`\TpTqTuTȍTTTXTxT`NUNUUhUPUUUpU(U@ V V V`]VVJ,JJJ(J(J0J8JOHOOPOO@AP`PйPHPPPh+QxQ8QQQQQQQQpRfRlRxRRRXR6S?S0ESSXSSTTx\TqTuTЍTTT1UNUPNU`UHU U8PVVVpV8VV@JDXJ`JxJJJJJ[JG`KG KGdOGeOGkOG(mOGnOGHuOGvOGxOG(zOG{OGh}OGxVG(VGVGVGVGXVGVGVG8VGVGVGVGHVGVGVGVGhVGVGVGHVGVGVG(VGVGVG(VGxVGVGxVGVGPWG(WG WGh WG WGxWGWGWGWGWGWG WG(BWGhDWGFWGGWGIWG0QWGRWGpTWGVWGWWGPYWGP^WGeWGgWGPiWGrWGxWGyWG@{WG|WG~WG WGWGWGȌWGhWGWGȑWGhWG0WGПWGpWG0WGХWGpWGWGWGPWGWGWGWGWGWGPWGWGWG0WGWGpWGWGWGpWGPWG@WGWGWG WGJJ:JJJJ^ J(Jf8J@JHJpJJJJJJ pkO mO nO P}O hV  W  W RW W W JJJehSeJOOPO`OPOOO O`OPOOOXOOPOȲO`OOXOO(OXOpOXOhOOOOOO@OXOpOOPPPxPpPPPP8PX#P$P&P(P-P1P6P9PXAPJPpKPPPRPTPHTPPTPxcPjPXuP PpPHPPPPPP8PȹP(PPPP@P`P0PP8PpPP8PPPPxPQ@QPQ8QpQQQQQQ #Q(QH+Q+Q0Q2Q4Q7Q:Q>Q@QFQHKQxLQMQUQZQ`Q(cQeQ8kQkQkQkQ ~QHQQhQQQQQئQPQQ QQQ QQQQQQXQQ(R`RRRRxRRxR'R)R+R.RX0R04R6R8R:R?RARIR NR PRQRSRWR[RfRlRrRXtRyR`|R(RRpRRRRRRRR0RRpR@RRRRPRPRRRRHRHRRPRRRSSSS S S SSSPSpSSSShSSS` S!S"S#S8%S&S@)S+SP-S0Sh;SV`CVJV0PV0RVSV8UV@]VP`ViVsV(yV|V~V~VhVVHVȓVVV`V VxVVVV V(V0V8V@V(V(VVVVVhV(VPVVJXJ J0JHJPJGXJ`JhJpJxJyJqOrOHsO WBWPWWW WWWWJHJ0JJJJJ~JJ?J[J J(J0JHJPJXJ`JpJxJcOhOVVHVVXVWWXWHWW!WH"W#W#W$WH%W )W(AWBWpSWUW^WqWhWWWW0W`W8WpWWWJJJoJjJJjJUJ KH KfOpOPrOuO0wOxOpzO|OhOV(VVXVV8VVxVVVVV8VVxVVVXVVVXVVVVHVW`WWWWDWxQWXVWWWsW(}W~WhWWWHWWPWWWWHW`WWxWWXWWWWWWiOiO iOJ0iO@iOPiO`iOpiOiOiOiOiOiOiOiO iOjO/jO% jO0jO@jOPjO`jOpjOjO*jO@jOjOjOsO{8W{W{ W{W{VU(VUVUhWUhjWUWUWU(WUWUV,0V,pW,pjW,ȖW,W,0W,W,VVVxVVxVV W`W@WCW(MWNWuWȋWWWWPWXW0AWpWWWxWW`WWX W,BW8vWnvW(WHWWWKKKK K(K0K 8K @K HK PK XK`KhK*pKxKKKKKKKKKKKKKKKK K!K"K#K$K% K&(K'0K(8K)@K*HK+PK,XK-`K.hKpK/xKK0K1K2K3K4K5K6K7K8K9K:K;K<K=K>K?K@KAKBKC KD(KE0KF8KG@KHHKIPKJXKK`KLhKMpK8xKOKPKQKRKTKUKVKWKXKYKZK[K\K]K_K`KaKbKcKdKe Kf(Kg0Kh8Ki@KjHKkPKlXKm`KnhKopKpxKqKrKsKtKuKvKwKxKyKzK{K}K~KKKKKKKK K(K0K8K@KHKPKXK`KhKpKxKKKKKKKKKKKKK`KKKKKKKK K(K0K8K@KHKPKXK`KhKpKxKKKKKKKKKKKKKKKKKKKKK K(K0K8K@KHKPKXK`KhKpKxKKKKKKKKKKKKKKKKKKKKK K(K0K8K@KHKPKXK`KhKpKxK)KKKKKKKKKKKKKKKKKKKK K(K0K8K@K HK PK XK `K hKpKxKKUKKKKKKKKKKKKKKK K K  K! K" K#( K$0 K%8 K&@ K'H K(P K)X K*` K+h K,p K-x K. K/ K0 K1 K2 K3 K4 K5 K6 K7 K8 K9 K: K; K< K= K> K? K@ KA KB KC( KD0 KE8 KF@ KGH KHP KIX KJ` KKh KLp KMx KN KO KP KQ KR KS KT KU KW KX KY KZ K[ K\ K] K^ K_ K` Ka Kb Kc Kd( Ke0 Kf8 Kg@ KhH KiP KkX Kl` Kmh Knp Kox Kp K {B{_{G?    Ր@ ֐@" ֐ @B ֐@b ֐@ ֐@ ֐@ ֐@ ֐"@ ֐&@" ֐*@B ֐.@b ֐2@ ֐6@ ֐:@ ֐>@ ֐B@ ֐F@" ֐J@B ֐N@b ֐R@ ֐V@ ֐Z@ ֐^@ ֐b@ ֐f@" ֐j@B ֐n@b ֐r@ ֐v@ ֐z@ ֐~@ ֐@ ֐@" ֐@B ֐@b ֐@ ֐@ ֐@ ֐@ ֐@ ֐@" ֐@B ֐@b ֐@ ֐@ ֐@ ֐@ ֐@ ֐@" ֐@B ֐@b ֐@ ֐@ ֐@ ֐@ ֐@ ֐@" ֐@B ֐@b ֐@ ֐@ ֐@ ֐@ ֐A ֐A" ֐ AB ֐Ab ֐A ֐A ֐A ֐A ֐"A ֐&A" ֐*AB ֐.Ab ֐2A ֐6A ֐:A ֐>A ֐BA ֐FA" ֐JAB ֐NAb ֐RA ֐VA ֐ZA ֐^A ֐bA ֐fA" ֐jAB ֐nAb ֐rA ֐vA ֐zA ֐~A ֐A ֐A" ֐AB ֐Ab ֐A ֐A ֐A ֐A ֐A ֐A" ֐AB ֐Ab ֐A ֐A ֐A ֐A ֐A ֐A" ֐AB ֐Ab ֐A ֐A ֐A ֐A ֐A ֐A" ֐AB ֐Ab ֐A ֐A ֐A ֐A ֐B ֐B" ֐ BB ֐Bb ֐B ֐B ֐B ֐B ֐"B ֐&B" ֐*BB ֐.Bb ֐2B ֐6B ֐:B ֐>B ֐BB ֐FB" ֐JBB ֐NBb ֐RB ֐VB ֐ZB ֐^B ֐bB ֐fB" ֐jBB ֐nBb ֐rB ֐vB ֐zB ֐~B ֐B ֐B" ֐BB ֐Bb ֐B ֐B ֐B ֐B ֐B ֐B" ֐BB ֐Bb ֐B ֐B ֐B ֐B ֐B ֐B" ֐BB ֐Bb ֐B ֐B ֐B ֐B ֐B ֐B" ֐BB ֐Bb ֐B ֐B ֐B ֐B ֐C ֐C" ֐ CB ֐Cb ֐C ֐C ֐C ֐C ֐"C ֐&C" ֐*CB ֐.Cb ֐2C ֐6C ֐:C ֐>C ֐BC ֐FC" ֐JCB ֐NCb ֐RC ֐VC ֐ZC ֐^C ֐bC ֐fC" ֐jCB ֐nCb ֐rC ֐vC ֐zC ֐~C ֐C ֐C" ֐CB ֐Cb ֐C ֐C ֐C ֐C ֐C ֐C" ֐CB ֐Cb ֐C ֐C ֐C ֐C ֐C ֐C" ֐CB ֐Cb ֐C ֐C ֐C ֐C ֐C ֐C" ֐CB ֐Cb ֐C ֐C ֐C ֐C ֐D ֐D" ֐ DB ֐Db ֐D ֐D ֐D ֐D ֐"D! ֐&D"! ֐*DB! ֐.Db! ֐2D! ֐6D! ֐:D! ֐>D! ֐BD" ֐FD"" ֐JDB" ֐NDb" ֐RD" ֐VD" ֐ZD" ֐^D" ֐bD# ֐fD"# ֐jDB# ֐nDb# ֐rD# ֐vD# ֐zD# ֐~D# ֐D$ ֐D"$ ֐DB$ ֐Db$ ֐D$ ֐D$ ֐D$ ֐D$ ֐D% ֐D"% ֐DB% ֐Db% ֐D% ֐D% ֐D% ֐D% ֐D& ֐D"& ֐DB& ֐Db& ֐D& ֐D& ֐D& ֐D& ֐D' ֐D"' ֐DB' ֐Db' ֐D' ֐D' ֐D' ֐D' ֐E( ֐E"( ֐ EB( ֐Eb( ֐E( ֐E( ֐E( ֐E( ֐"E) ֐&E") ֐*EB) ֐.Eb) ֐2E) ֐6E) ֐:E) ֐>E) ֐BE* ֐FE"* ֐JEB* ֐NEb* ֐RE* ֐VE* ֐ZE* ֐^E* ֐bE+ ֐fE"+ ֐jEB+ ֐nEb+ ֐rE+ ֐vE+ ֐zE+ ֐~E+ ֐E, ֐E", ֐EB, ֐Eb, ֐E, ֐E, ֐E, ֐E, ֐E- ֐E"- ֐EB- ֐Eb- ֐E- ֐E- ֐E- ֐E- BGc?@  Ձ!F{"BH@ S@!`!@@A!@BtAB$S@aaTR  @{¨_!#|@!|BC9_qTT@B@Bha8_qTT@@hc8! C|@b8`5! hc8_{SFBhd A&!"spB}SA{¨_{  T@aH6 @1@T FJ`4 ` @{¨_@A7!{#{__{SA@ !DbB@ !@~ `@7``"RSA{¨_"T@T T__@T _T86RR_@{ cpC Rd|@c&a,0K c5sEhaJ4R@RaB @{¨_@cpCC{ !`4a@`4F?T`_ R @{¨_{`Db @@D@T@dBc@% @ad @!c 3{_{SΎ`@@cC)eD)SA{¨!ZSA{¨_{ @@`@@`@@`@@`"@@ @{¨{S[**@`F?T@`D?T`AR(@`F @@1@T@t 1@TuwZ)3[BSA@{Ĩ_@ctAc(M9c4CR1D_{5bBG{@@X{_{gBhES[ @W uETqATAW@@!ҠTW@@TSA[B{˨W@@ҡTSA[B{˨-SA[B{˨_@_rT_r@xax_dD{@S7cуc!`@@SA@{èeD{@S[*7Ѥd!@@߂qaT`TGT @!@ 4SA[B@{Ĩ`D@@!@SA[B@{Ĩ_{bBFST` 3R *"*4SA@{èa!D@4@!:s@*SA{è_{? 'fES*[@WtETꥎ JmT TW@@ATSA*[B {˨>iB) ? jTqT n W@@!ҠTW@@TSA[B{˨1W@@ҡTSA[B{˨-SA[B{˨_R{S@ <[r )! RK`B;ՀE. ?!R@h`@7!A RSA{¨_{S[*W:`B;ՀE. ?!R@h` * *s![B*SA{è_{R@S#[?kAT`b@5v@qab@A5RPnɃ@4a@!Q `b@v4a@!QPab@A5bR R54 R`bva@!Q[BaSA{è_{ccES[cb@'#TT  -#O5U@O`4#@R Ta!Fa!G@7!/FF3&a? 6`@7` a@7!aa lT@@7Ѡ  b @ 7р`E'@@B@T[BSAcC{Ũ_**qTBx@y?kT$q`T@?kcT?kT_T_{ @S[`D!`@5a 4 @x 5`D!@)a:A;E.@? h`@s=`C)k T` @!@a!|}a?` SA[B@{Ĩ9 @!އ"@1@T@1@Tb @a@@ #c1U!@T[BSA@{Ĩ_{`EST@b" c"M5" u`5@`@B@a!E@"@c@TCSA{Ĩ_*qTqT#<b_)Te$x#dbTeD_ccE{#B@8a@BSc4@Na!E@"@c@T {¨_{c@S[!T@#6*1T2 )!7`D!@@k`R"8h= TsAa|jaqT`Tx# @ `D!@K` RSA[BcC#@{Ũ_{a!ES[* @I*ҟ@4`D@۹iTO*!r-3k-ssF`E@@B@T[BSA{Ԩ_{S@[m7@m7@m 7[BSA{èSA[B{è_cc|E{S[@`@?Th%e%q @!Tq`4lTN`D!@_#!@4!`& 6b@6@@?`@1@Tu@1@Tt`` `@6G ``ҹ$@!Ҡ!@`7!сa`@@`[BSA{è_{S[`D!@d_0 @@?@@y@! 7@7!сa @!7@7Ѡ``@`7` xvs[BSA@{Ĩ_dЄE{CS[ck s @c|@`@s`@w`6@!@`:@`>@`F@`R@`:@k`>@o`B@{`F@{@y2@xB@T?D@Tc$@!RRR=@ \@@@1*1aT0 T@@@&*1aT0T@ @@*1aT0@ T@@@*1aT0T@@ *1aT0T@@ *1aT0`@T@@@*1aT0TU@@T@`7B@B@ ! vI`TC#@`@T@ 7B`,!@ vs`TC'@`@T@ 7B`,!@@ vw`TV+@@T@@7B`,!@ vTT/@@T@@7B`,!@ xv@ TW3@@T@@7B`,!`@ hv` TC7@`@T@ 7B-!@ Yvk` TC;@`@T@ 7B-! @ Ivo`TC?@`@T@ 7B-! @ 9v{`TCC@`@T@ 7BB@ ! @ )vp`T[G@`@T@7BB@ !@!@ v` @6`D!!@]J@6`D!`"@]A@6`D! #@]8@6`D!#@]/6`D!$@]'6`D! %@]@6`D!%@]) M X)W)!&&76@VbR@RT 7bV@RI@4bZ@>@ N[@k@o@{@@@; X)s@o** F @@`E@@B@T{ESF[GcHkIsJ_{S4@|@ugJ@RkmTc6@ca@9jTc2@|@c"f @@c1@T f BSA{¨_{hES[cks @ )@OOW)@KS@sXW@[@G_`@T@ 6@T@6@@T@7@aMR 8r{ @wV @*{ @ y *!@7{7@Iw kTab#x`a@!1@TacRCx %h 8qe****w@kT`c7xu*_kMTz{ o Lbo@@5*7@*7@1T{@9QsQ h{82 h;8 @b~@1@TRt h"8s***k TBc |@Cxab@B1@Tb! 96 @6@9T, @"ARR|@% TCBFic8@qTB@9A *<qTB@9B *?k T`D!'@~=A|@ha8B2h!8RBic8hb8B .7`7O@N{@S@W@AS@#[@W@G@[@K@__@+k`7` @@! T`D!'@[I{@9w@7`E@@B@Tk[BSAcCkDsE{ר_{S!@`(E?T`D!`(@[ Рc=!5`6&@dZ@@@$ T`D@!)@[~@R>a@@!1@TaRSA{¨_{#ccESB@8B uEa@ `47@`T@@aT@SA{Ĩ/@4`D@'-@@@TSA@{Ĩ_{SU a@7!aaSA{¨_{@ST@7`D!,@A[`PGC`/y+Ta@`a6aӓ?AT!_!T" ``@b1@Tu @1@Tt4+@5@SA{è_{A;S`E.@?4h` @@=4a!,E!@4a!G!@@SA{è_{i)E=C=#='=+=/=3=7=$@/'C+ )@}`E/@@B@TB{Ѩ_{dES@$@@1@T$  #c@c"B -a@ 57!aa 7!aa@&@"@B1@T"&tRa!E@"@c@TSA@{Ĩ_{  Ծa@ @{¨!@#@#5 {!`- `6!-" 7!-`7!.B7!@.7!.Ҿ 7!.Ҹ`7!/Ҳ7!@/Ҭ7!/ Ҧ 7!/Ҡ`7!0"Қ7!@0BҔ7!0bҎ 7!0҈`7! 1҂7!`1|7!1"v 7!1Bp`7!2bj7!@2d7!`2^ 7!2X`7!2R| @{¨_{!3e$$@C;`E.?`h`@$ @Ae@Tc @cxdT!@4g{(a!DB3!@Y{_@(A_{#@$~R ` 6`@7`` @{¨_{SssF[`EaJ@'?qT`lF! 5@lY ?q Ta",RX`.[4`D@C`E```lF!5@RYuFtGBB!)~"!B/!/ p/er`?`\aE`aEaEA`Wa0Ӌb2`b.c "@ h!Ra `Ra!E'@"@c@TSA[B{Ũ_{uFS.@SA@{èj*!R*bSA.@@{èbBE{#E@c/a!(GfFceG`XFa!E@"@c@T`{è_bBE{ E@.ccEa!(GcfFeGa!E@"@c@TA{è_{[0@yS`%R cxHϊҔ~Q1`T@2(_!| `@ySA\@[B3cC{Ĩ_{S@[T@7`D!@6@0{ !`D!6@'{%B;`E. ?փV@!R@h`w@vA2@sB$ s`@TW@R!z*`@[B*SA{è_tA@$?T{ @ `FCB"B `4 ! 7da!F"BpS4 !8da!|F"B0@`?֠5B@`?5SA@{èSA@{è_{$@S*@`?`4`?֠56@`?5SA@{èSA@{è_@94@A!4F_T @@!1T@F_ @@!1@T_@@!1@T_ 9A!F_q@E _ 9A!F_1@E _@`R_{@S @@@SA{è`?4SA@{è_BR@F" _{iA!F{_@ `_{'m @`(@`Si"9` `BhT!`W `W?k@T(hnB8a`/g.`H `@T@@elB8`P aLT n(a)h/g .'BmSA{è_@9B@806@9cb*"_ @A!F @@!1@T_ @A!F@@!1@T_A!E@9@F_q @!1@T_@A!F@!1@T_@ @0 `W_{SˠT_BГsSA@{è_@F_@F 3_@F3_@_T"@" @b#@C@_T" @"@b# @C ,@?|A,_{S0@[`v@?ր4@ @?`4 Cc E[BSA{èc\@SA[B{è_{ @S@`?`4 `? 5@@SA{èSA@{è_ @$@BQbb# @"$@BQbb$@@BQ @bb_!T $@"@Q! @@`R_$@"$@kTD}kT@B&@hdhdaTR R_$@@#Q!Q @!|@E D##@xaxcc|Cx!!_@ @!$d-T@fhbhbB |dx!!_@!T@!6@CcG`?Txa!@@T RR_@!T@6@`?*Txa!B@B0@B@ _ @`R_{c3@S[ks@7"|`T)T[BSAcCkDsE{ƨ[BSAcCkDsE{ƨ@-T@@@!@{@-T@`@ @sSA[BcCkDsE{ƨ_{CS[ckscJ?T"! ) ;({AkE[CsFSBScDzvU@h@;@cOb@@GsHO@@@ T@@c5@@h@ @f@{ASB[CcDkEsF_@!@(7 @A!F@F@!1@T_֡񡹹ATA R_-R_*A!E{#@5BBFc`&A4@?TAB`CRƠ&6`(*qTCcF aH@?Ta@*c qTCcF a\@?Ta*c@CB@E@@B@T{Ĩ_{R R{@R{S*_iT'A`@4@!`? @@?@@A8!H_TO@9R 9 jTRO`h3SA@{è_R Rb|{CcESb@OS*qTR:R6@RbRRE҇RSx`QŚ?$旟Bq@z!#8@T1T*dbR|@cˠ&@EO@@B`TcQbR 8*qĨ@z!T@SA{ʨ_A!F"`B@!@!H@R_ @`R__@@!1@T_@`R_{S@[T@H7a@wb3@sb S?4 zvkT?`4RSA[B@{Ĩ_T@a6C;{@E. ?`h`A@@!{!!`A s_ 4 S_@@"@AT@"@T@"@ATh@"h@TT@#T@BBp7@_T @R R_{ @S @`?`4 `? 5@@SA{èSA@{è_@@!1@T_@@!1@T_@@!1@T_@@!1@T_@@!1@T_@@!1@T_&Ҩ *Txixxhx_ kc4hTTҦ_ kTT&ҥF_G@D(@I @ BcѤ4bTb@yB@ib8ib8c4?(Tj+kk_d F TMyfxxfx kTcLybxxbxBkT_KTc ?i Td@y@id8F$Ң˂BBЄcA:K@? )Ї"Tb@yB@ib8ib8c4?(T("Bb TMydxLxdx k@Tc jTMydxLxdx kT˄cҟ TMydxLxdx k@Tc @A_&Ҩ *Txixh_ kc4hTTҦ_ kTT&ҥF_G@D(@I @ BcѤ4bTb@B@ib8ib8c4?(Tj+kk~_d F TMyfxf kTcLybxbBkT_KTc ?i Td@@id8F$Ң˂~B~BЄcB:K@? )Ї"Tb@B@ib8ib8c4?(T("Bb TMydLxd k@Tc jTMydLxd kT˄cҟ TMydLxd k@Tc @B_$|RD_TF @)EA)***jT@@1T1TRRB@RD@j@T@@1T1TRR_TBR_@ S?rTq Tq@TqaT?r!@qTqTqT?r`a !<  `_RkT4| S"B@@9_q@T(Gb ""B@9_qT#0@b   !" @9qZR_֖{S[U<?-TrT*@@@ykTB@A$CsB,T@lTBH T`@ykTc`Ac@Ts T`@ykaT`ASA[B@{Ĩ_{S[*?T_rTVb~*~ad@"Bk TsT?-T`Ta_?kTc`BcsB,T ?T _kT BSA[B{è_{S[U<?Tr`Tb*AD@y#Ak TsT?@-T@@_TA_x?kTB@ABSA,T?T _xkT ASA[B{è_{RSBBE[D@'Ҁ#RmT@#@  ~q*aT`ˢ a B_aza@J@T`ˀ!҂aҁAh 8TacQ? TzabK!@9@E'@@B@TvSA[B{Ũ_{EES[c#c@g TTs@Eg@@B@TH[BSAcC#@{ͨ_{RSBBE[D@'Ҁ#RmT@#@ Ӊq*aT`ˢa B_xazax@J@T`ˀ!҂aҁAh 8TacQ? TzaxbK!@9@E'@@B@TSA[B{Ũ_{EES[c#c@gTTs@Eg@@B@T[BSAcC#@{ͨ_{* <T ZsB` cTb@_kaT`B @{¨_A!F_@@!1@T_{ @S  @@@SA{è`?4SA@{è_{ @S @@@SA{è`?4SA@{è_{ Cc4G@9aha8?q T@9aha8?qA T@9aha8?qT<@8 RqAzB@@9qT@@95aRRaDqAT@@9qT@R`D@9d4q@AzB B@@9`h`8q!T@@95@@9`h`8qTqT qT@@9qaTR`D@94q@AzB B@@9`h`8qT@@95@@9`h`8qTqT!`4 R@R`RR @{¨_{@S @@@SA{è`?4SA@{è_{@S @@@SA{è`?4SA@{è_@_{@S@`?`4 `? 5@@SA{èSA@{è_ @@!1@T_@`@F@@Ag!1@TA'H@@!1@T_{@SSA@{è5Y`?4SA@{è_{@S@`?`4`?ր5@A9?qT@SA{è8YRSA@{è_@߈ *|SR_{S@[sTzs?@4RSA[B{è_{S@[sTzs?@4RSA[B{è_{S[@zssaTR?`4SA[B{è_i)A7(497c#@ @T@_*T @Gc c9#@ #'@!*!; AT|T@xd'c #d} h$9T@_TcQ9 @ @@R  R_@`R_@@_!@!1@T_@`R_@_{[@S-T`@xt\ 5 RRSA[B{è_{S4@Esa@SA {¨!҃@Dsa@`SA5{¨!u{BBES@@BR@ @5`@q T@@TRA!E@"@c@TJSA@{Ĩ_!#|@!|BC9_qTT@B@Bha8_qTT@@hc8$C|@b8b5!"hc8"b8_"|!!|@hb8q!TT@@hb8qT@ha8h"8"h"8c8`4 Ry_#|D!!|@Bhc8_q`TT@B@EBhc8_qTT@BB"c@cha89Bc8b4"RyT@@h!8_T@@$|@ehd8" Bbh$85P@9"jT_T@ @$|@ehd8" Bbh$85T@9"jT_{!@  @@B`@` @{¨_A!F @1@T @F_@_|_|_`@R!0 C_CqaT@l @f#~` bT!b @f(`@qTd 4 `jT@@d@e@C_{S*}+H ccфRcSA{¨_@F@APa!1@TAP!*_B;{@E. ?@h`A!F,@@!1@T{_B;{@E. ?@h`A!F(@@!1@T{_{A!ES @?SA;@E.@? h`@, ` R @T` R iTW`5s*5A;@E.@? h`@,RA!E?@"@c@TSA@{Ȩ_@A!F@!1@T_{@S @@@SA{è`?4SA@{è_{5@@q R{_*_BBF@EBE@_@y"@y_kAT@y"@ykTP!PRkT@&@B0k!T_!0_@T RR_D4G#hb84hb8Bhe8k@Tq_*RkT<SRR?khT !\S?khT!lS?kT!*|A "tSa6 _bR_@?@`TA76!|S RA !|S@RA?<rT!|SRR?raT !|S? @aT!|S?@aT!|S7!|S4ARR_"@@`kT`!`!""E_#_kT4T_{`у_*R!K(q,TgRKa$!$ 2"|`bT_RT!$c a*T_ R,q@TRKc '$c*c$ 2b|`iT_R! c$!*c$ 2b|`"|@@g{_&@@kK TQ `{`|~ &hdC&Aid)?kcT i`h` @"B`ӡh !`T@id@5c_cT`@5Q~@7h`i`BAh !`TAf@&A5_cT@5Q) *{_R_{A;S*@E.@? h`@q T"4BA@`J`@A` 3Rs"aQ!|~!!C$A"A3RBs"c&O##aCBCC CT  |}Ӽ`L)SA{¨_{|@R RA|@BxS!`?hTs*@D @{¨_{S*@҃jb8h"8B5saSA{¨_{S* R`@)DR)"L!xT!Q?1T!4 @!@! 2S5@"K_1kTsK"a ?|q T@aJq|)T!R 4 C)KB$d B*c$ )@4SA@{è_{S5[`!@@qT5RR @Meb@hb` ҇&jaija h!!(B`ӿTsf!d!~!!aTheb"h%B` BB~B !"_b5QSA@{è_{S@[c#5@qT`B)A5qTR` ҠB@@?kT`A)w@@ ?k `Ty6?"BTRB~bB #gb7bf!dт!~8!! TF@4҆D@@$DB`(Tbh!c _5QqTSA[BcC#@{Ũ_{ * R`!R) @{¨_qaT#h"8qaT#x"x#x"_@(S?rT?r@))G*TRg_{'@ y`6*T*'qT RR{g_ TIg&@K @T hh8-ih8 kT@TCia8bi`8kAT@TOߠ@iTIT  ˟T"Ӣx AThic8i Q! ?dqƐAib8/J-Q@aT?k`T/eqHT?k!ARR!!Mxb ? x"댑_`T  TcT_C;{B@E. ?Bch`!!Fc@ EcpC{ _A;{@E.@?!h`"R F!@"|{_A;{@E.@?!h` F!@?|{_A;{@E.@? h`@ `!'{ F_#`!@_TdxbBaT RR_ c,&Ec{E@@b AET#Rc9@\9 EH@B@TL{@ c,_{#cES**!5`@gqRRcc2*@!!Eg@"@c@T$SA@{ͨ_{R"BE C@Ҽ5R E@@B@T @{Ĩ_{$ @@!1@T_{AB@BA f !BT@@?aTAETc@ F_{@S @@@SA{è`?4SA@{è_{@S  @@@SA{è`?4SA@{è_P@96?qС!6?qС ! 4~`!@`7 _@!!E_ F _{@S@`?`4 `? 5 @@SA{èSA@{è_@ @ _{@S  @@@SA{è`?4SA@{è_{SAjTs?aAT@ARSA{¨_{@S@`?`4`?5 @`? 5@@SA{èSA@{è_{@SB@`?`4`?`5F@`?5>@`? 5J@@SA{èSA@{è_{@S  @@@SA{è`?4SA@{è_{@S @`?`4 `? 5@@SA{èSA@{è_{@S @`?`4`?5@`?`5@`?5@`? 5@@SA{èSA@{è_ֳ{S@[` @?`4?֠5R`@b6kT@@ ?4 `@[BSA{èRSA[B{è_{@S  @@@SA{è`?4SA@{è_{@S @`?`4 `? 5@@SA{èSA@{è_{@S@`?`4 `? 5 @@SA{èSA@{è_{@S  @@@SA{è`?4SA@{è_{@S@`?`4 `? 5 @@SA{èSA@{è_{@S @`?`4 `? 5@@SA{èSA@{è_{@S @`?`4 `? 5@@SA{èSA@{è_{@S @`?`4 `? 5@@SA{èSA@{è_{@S@`?`4`?`5@`?5 @`? 5@@SA{èSA@{è_qXW @?AmT! @@!1T_{@S@`?`4`?5@`? 5@@SA{èSA@{è_{@S@`?`4`?5@`? 5@@SA{èSA@{è_@!@ @`"@ T @@!1T F_{@S  @@@SA{è`?4SA@{è_{S@[`@?`4? 5w @s`j`|KT?@4RSA[B@{Ĩ_{ *qT@Xs* @{¨_{ *qT@Xs* @{¨_?kT{S***kT*k R_ RSA{¨_֕{ T`9 *|SR @{¨_C@aT9@T"R9@_MThc8"hc8c@9BJB*B9@9Cr_{@S @@@SA{è`?4SA@{è_{ @S @@@SA{è`?4SA@{è_{@S@`?`4`?5@`? 5@@SA{èSA@{è_@@3AM!1@TA @37_@@3AO!1@TA@3?_`@7A]!1@TA@7_`@7A@!1@TA@7_`@7APB!1@TAP@7@ _`@7A@C!1@TA@@7 _{ST`zt2@SA{è,{S[c4B)*`5qT ~`A)?kT!xS҆0q`֢R~~`abr# TRKR$@ *D D@$(Tadf!d!~!! @h!4  D@@DTQV[BSAcC{Ĩ_{!|@`ST|@[Ru@b@TPtD`ӿkLTT`@klT` @q3baB@BB~;)`5u[BSA{è_{#rS[*`T!cQ!?R!c`~4A; E.@? h`@A^J4 NR^ ~4@u6 [BSA{è_{ @ aR @{¨_{!R $@a ``zE`@@OOR aB`=`= @{¨_A;{ E.@? h`@` !ߜ!ߴ! F{_!Q?0qhTB4BHa8a""@ @@!1T=A@!1T8tA@!1aT3u F{_{ F @ @{¨ { @`@` @ @{¨_{ +@`@a@ @{¨!@{ @ @{¨{ @ @{¨{&ES[@_?Tq@ TlTTB@yqT#cE_@d@A#TSA[B@{̨RqT#cE_@d@ҁ!TSA[B@{̨ҟTz`x?kTsTqT? 'Tॎ @mTlTaє,Hxax*Fx`xM!ƚ kATT& Ț ҟT'ysx`kaTҎygxMxgx kTAT?T5J @Ts gs @y$@s @y$@7ss E4jB@ TqT##A E_@@T@SA[B{̨h`n-Ix`x(Gxax!ǚ kAT!? T' ɚҿTfyux kTzfxNxfxkTLTT 5s T+_JT@T˿qT#TCs=a !@y$?@a!@y$A7G@yf(3!ǚDx`xџk!Ě!@zsxkTx`xHx`x?kTaT_x $ 6ss_x $`6sss E_@@B@T[BSA@{̨_{ %R @{¨_{&ES[@_? Tq@TlTTB@qT#cE_@d@#TSA[B@{̨qT#cE_@d@!"TSA[B@{̨8ҟ- Tz`?kTs`Tq@T? 'Tॎ @mTT`є ~-GhaAxh! ?kAT,  `T !! ǚ! T`~fi`kTүyfNxfkTT_T%5) `Ts `fs @ $@s`@ $@7ss e4jB@ TqT#H E_@@T@SA[B{̨gn-~(IhfFx`!ƚ! kAT T& ɚҿT~ai`? kTzaNxakT!LTT 5s T+(_JT?@T˿qT#?`TCBs=` @$@`@$@7F@e(3!ƚDx`џk!Ě!@zs kTx`Hx`?kTaT_ $ 6sS_ $`6sss E_@@B@Tm[BSA@{̨_{ %R @{¨_{ @@" $@9SCBB )8qT<qT4qT@$q"-T(Q#    @9 @96 0*@@|SFK  &QQ@@|S@K    !@9  !|$ * {_{i S .[o&EKhi8@W& *TJhg8 ʚ_ kAT ˚j ʚLTis8 kT Tig8Phg8?kATT5Ts ,_jT@ T5˿qT @Tsos @9$ǚ@s@9$ǚG7ss4 EW@@B@T[BSA{˨_{ TTTB@9O%R* @{¨_{&ES@W?Tq*@T,TTB@9qT#cEW@d@ TSA@{˨qT#cEW@d@! TSA@{˨dM Tja8kT? T!*JEqT? 'T륎 KmT TW@A@T@*SA {˨-dkBk  TqaT]W@A@!T@SA{˨#W@G@TSA@{˨W@E@ҡTSA@{˨D_!!EW@"@c@TSA@{˨_{ %Rf @{¨_?T% {RT{__$@@҂}kTe@'xdhbe @hb@@_քc|@q!TkTCx$%xdc|Q|}7Ch$Q%hd c|_@(@@!LER_{S@`SA{¨ @_@a@/!R{ @`_ebac`c(b(`!8ec!cTg @` Dcb`aC(c(a8`@c!c_{H `'mH@`i@`/m+@`7m @`aTh `T!`Th!`T(!`T!`DT!R/ @` aA`A`A` @` @`A``A`1(!`h Ti@`A`JaHi)`A`#Dmj!j/n'Am/Bm7Cm{Ũ_{"@`'m` g!iT#`` iHT!iMTH`!iT  i@`HTARgA`'Am{¨_@@!1@T_ @@!1@T_ @_RA,_RA,_RA,_RA0_RA0_RA0_$@@!1@T_E{@C{v!E@"@c@T{¨_g_g_{ 4!R@9a8bS`B!*s~S|qTq5g!g ag!g a  B4n<Q(aS4@a @{¨_ @@A9 qR_ @!F @@!1@T_ @!F@@!1@T_ @@@!A?q_ @A9?qT[!1@T _@_@<_@!@B@! |_@BG@A! @?T{A{__{@Sr_R`?4SA@{è_{@S@`?`4 `?5R_RSA@{è_c E8Fc@֠@!1@T_@!1@T__{5@@q R{_{ 7*a*F @{¨_{q!FE{_@{qKT{_{S@@7!Au @sҟT`@@Aт7AsBSAR@{è_{@S@? @7р|SA{¨_{[@S@u@p@b@a@?T?@bу7B`@``T?JT?aBc@Baab?TT?Tt ` @@ 7!ASA[B{è_{S@@ 7!ApR`@a4kT @@@?A7aa@A"@_T3@??U SAR{¨_{[cXAS@@p@#9p@ ?s?@`@7``39*@ ѡ7`(qLTa@ ѡ7``4[BSAcC#@{Ũ_{ @@@B7!A `F@@F7!A`>@@>7!A`J@@J7!A @R{¨_{ @@ 7!A`@@7!A`@@7!A @R{¨_{ @@7!A`@@` @@ 7!A @R{¨_{ @@7!A! E @{¨!`@@@_A7!{R{_R_{@ B4*?`@@7!Aq"R` @*{¨_F(J4{#rF{_E_@7!AV_{ @@ 7!AG`@@7!A> @R{¨_{ @SUA @Z*a@7!aa)*SA{¨_{ @a@A ?`@@@7! @{¨ @{¨_{ W @R{¨_{R{_{SB@95F7b@B1@Tb$@,@"@c*cF?*a@*7!aa4SA{¨_@@_A7!{R{_R_@@_A7!{R{_R_{ @@ 7!A`@@7!A`@@7!A @R{¨_{ @@ 7!A`@@7!A}R @{¨_{ @@ 7!Aj`@@7!Aa @R{¨_{fR{_{ @^a@ ?`@7` @{¨G @{¨_{  @@7!A7`@@7!A.`@@7!A%`@@7!A @R{¨_{S @~t@~*@ @@Aт7A`.@@`.SA{è_{  @`@`@qT`@@7!A @{¨{|R{_{  @@7!Ap| @R{¨_{S@@7!At@R"a@~} @@kTjb @j"aѣ7aSAR@?@{è_{ @@ 7!A`@@7!A @{¨Z{ @@ 7!AxA;E.@? h`@AB?<qT"! @{¨_ @{¨6{ i@@ 7!AT`@@7!AKA;E.@? h`@AE?<q T!!SD @{¨_ @{¨{ ;@@ 7!A& @{¨{ $@@&7!A`*@@*7!A `6@@67!A @{¨{ a@ @{¨!@{ $@@&7!A`*@@*7!A`.@@.7!A`2@@27!A`6@@67!A`:@@:7!A`>@@>7!A`B@@B7!A @{¨.{ a@ @{¨!@֓k{ @@7!Aa@ @{¨!@{ @@7!Ava@ @{¨!@@@_7!Ae_ @@"@_Tc@@@QQqTa!4!X`x`! ~2m0g,l*j( Ҡg$`g  gҠg@g`gҠg `g`g gg`gg`gggggҀg gҠg@gg g@g g g g g g g gggfdPddccbba`nꋄ |qTa! 9!X`x`! ~fpfPf0ff~e|ezPexevdtdrPdpdnclcjbhbfad`bn`!X`x`! bUlSPdQdOcMcKbIbGaE`CnA/?~=`5QqTa!>!X`x`! ~2h0g-m+l)j'g# g dPddccbba`n / @p@`g@t@@|@`g@@@@'QLqTa!?!X`x`! ~mjihgPddccbba`n/qHTbqTqa~ aqGTTqcd aqFTnq@Tq`~ aqETTqETHTqETHTqETTq`ETqn~ aqDTqb~ aq DTTqcc aqPd~ aqBTTqBTbTq`BTq`~ axqATTqcc apqPd~ ak%q`@TTq@@TT q @Tb(Tq?Tq`~ aZ q@?TTqcc aR$qPd~ aM%q=TT%q=TbȈT%q=T%q`~ a?%q<TT%qcc a7%qPd~ a2-q T-qiT-QDqTa!p!X`x`! ~#h!gmljPddccbb a `n/+q5THT)q5THT)q5TT)q`5T)qn~ a)q4T)qb~ a)q 4TT)qcc a)qPd~ a+q2TT+q2Tb({T+q`2T+q`~ a+q1TT+qcc a+qPd~ a1qHT1qT1QHqTa!!X`x`! ~dccbba`n//Q0q(,Ta!!X`x`!  gdPddccbba`n/3q@(T(T1qT1Q ҁ šTAT!n~an3q&T3qn~ ag3q`%ThT3q@%Tb3qkT3qa~ aZ3q@$TPd3qjT3qc~ aPT9q@#THT7q #TT7q#ThT7q"T`7q@hT/7q~ a=7q!Tc7qgT7qb~ a3@9q TT7q T7qPd~ a)L9q TTD9qn` a!P9qb~ aH;qTTd9qThT\9qTd`9q bTX9qc~ a @;qTD;qn~ aX;qThTP;qTbT;q_TL;qa~ a`;qTPdd;q`^T\;qc~ a!1RkT)Rk T) qH Ta!!X`x`! @h@@g@g`g`ggg g geddPddccbba`nh@l@g@p@gg@t@@x@~ނRk@ThToRkTmRkTm LqTa!!X`x`! ~s gp gl gi ge gb g_g\gZfXdVPdTdRcPcNbLbJaH`FnDRkThTRkTTARk`THTRk T!Rkn~ a/aRk@TRkb~ a& Rk`TTRkcc a! RkPd~ aRkTTaRk`TbAT!RkTARk`~ aRk TTRkcc a!RkPd~ a݂Rk`T݂RkPf~ a!SRkTORkTO dqTa!!X`x`! ~dccbba`n/!RkTRkT qTa!P!X`x`! ~dccbba`n/~A;RkHT9RkT9 (qTa! !X`x`! ~dccbba`n/}a)RkTT)RkTHT(RkT(Rkn~ al!)RkTA)Rkb~ ac)RkTT)Rkcc aY)RkPd~ aS!RkHTᇃRkT臃 dqTa!!X`x`! ~Ad?c=c;b9b7a5`3n1//vRkThTjRk@TTAjRkTHTjRkT!jRkn~ aajRkTjRkb~ akRkTTjRkcc a!kRkPd~ avRk@TTavRkTbT!vRkTAvRk`~ awRkTTvRkcc a!wRkPd~ a  dqTa!P!X`x`! ~`nPddccbb/WRkhTCRkTC |q(Ta! !X`x`! f g g g gggfdPddccbba`n~RkTT tqTa! !X`x`! Pdudscqcobmbkai`gneARkTRkiT  dqTa!!X`x`! ~SfQdOPdMdKcIcGbEbCaA`?n=/Rk~ a72RkTHTA2RkTa2Rk`~ a*2Rkb~ a$ώRkTHT RkT T׉RkTTRkTHTiRkTTaRkTARbk TRk~ aRk@TaRkc~ aщRk`THT!Rk TˉRkPd~ a҉Rk@T҉Rkb~ aۉRk`TT؉Rkd~ aRkTT݉RkTRkb~ a(RkT(RkTiRkT(TahRkTT-RkTHT!-Rk`Ta-Rkd~ a!hRkd~ ahRkThRkg~ aRkTTߋRkTT!Rk`TTxRkTxRka~aaۊRkb~ a!Rk@TAϋRkn~ aߋRkf~ az_RkTTRk`TR`kTRk~ ajARk TTiRkd~ a`Rk TrRkPd~ aWRk@T(TRkT(TɒRkT(TRkTTRkb~ aA!ĒRkTTaRkTR`kTRk~ a1ȒRkc~ a+ŔRkThTAĔRkTTޒRk`TTϒRkc~ aĔRk`T!ĔRkn~ aĔRkTTaĔRkab aĔRkTĔRkc~ aaݔRkThTܔRk`THT!ŔRk TܔRkn~ a!ݔRk@TAݔRbkTݔRka~ aݔRkTTݔRkcd a/ݔRk~ aaRk TRk T!Rklm a!?RkhT9RkT9 qTa!!X`x`! ~dccbba`n/RkT qTa!0!X`x`! ~dccbba`n/~!Rk Th T!KRkTTJRkTT!JRk`TT/JRk~ ahAJRk`TaJRka~ a_JRkTTJRkbc aUKRkd~ aO~RkTT!~RkTT/~Rk~ aAA~RkTa~Rka~ a8~RkTT~Rkbc a.Rkd~ a(RkTTA6RkTTa.Rk`T/R`k Ta-Rka~ aa:RkT?RdkT!:Rkc~ aRkTTaRk`TbT!RkTARk`~ a Rk TTRkcc a !RkPd~ a R!rkHT!TQk)TD@Q?QPqhTa!!X`x`!  d@ l j h g ~ SR!rk(;T!QkT@@Q&QqTa!!X`x`! g m g g j g g @!g @g  Ҡg `g  g Ҡg @g `g| Ҡgx `gt `gp  gl gh `gd g` `g\ gX gT gP gL ҀgH  gE ҠgA @g= g9  g6 @g2  g/  g,  g(  g%  g" g g f d Pd d c c b b a ` n l ~ !`QkH T! Qk T@@Q QqTa!!X`x`! ~  g Ҡg @g g  g @g  g  g  g  g  g  g  g g g f d Pd d c c b b a ` n ~ R!rkT!QkT@@Q`!QqTa!!X`x`! ~ b `g g  g f d a ` n} !4QkhT(T!$Q~k g aq zR!rk`gTT!Qk@gTfT@@Q!DqfTAzR`!rk~ a] R!rkeTT! QkeT@@QHT!q@eT!Rn!rk~ aJ !q`dTRb!rk~ aA R!rk@cTT!Qckc a6 !RPd!rk~ a/ a#R!rkHaT!QkIT@@Q#QqTa!0!X`x`! ~ `  g f d b n !0Qk]ThT! QkT!bkd a "R"rk(\T@@Q!"q\TakTRn!rk~ a R~!rk g a  R!rkH6T!xQk TD@QHQtqTA!@!X`x`! ~ g  g  g  g  g  g  g g g f d Pd d c c b b a ` n !LQk!T!|Qk) T@@Q9QxqTA!0 !X`x`! ~ g j l Ҁg  g Ҡg~ @gz gv  gs @go  gl  gi  ge  gb  g^  g[  gX gU gS fQ dO PdM dK cI cG bE bC aA `? n= ! QkT!QkT@@Q`-QqTA!0!!X`x`! ~+  g( f& d$ b" a ` n !Qk@TT@@Q!+q?T@@Q!+q?T]Rb!rk~ a ]R~!rk g a R!rk=TkT!<Qk@=TT!Qk=Td^T@@Q!.q<T@@Qa!.q]T!uRn!rk~ a AR!rk;TT!,Q~k g a @@Q!3q9TRd!rk~ a R!rk8TT@@Q!3q8TេR~!rkg a R!rk@7TT!Qk7TbVT@@Q!4q6TAR`!rk~ a R!rk5TT!Qckc a !RPd!rk~ a R!rk3ThT! Qk@3TT! Qk3T@@QT!x ^R!rk@TT!Qbkb a3 ^Rc!rk~ a, AR!rk@ TD@QT!@q TD@Qn!Dq$T!_RPd!rk~ a !Pq TD@Qb!Tq`"TaRa!rk~ a R!rk TT!Qk TD@QT!`q TD@QPd!dqTኂRc!rk~ a!Hq TD@Qa!LqT!Rn!rk~ aR!rkTD@QT!Xq@TD@Qc!\qTRb!rk~ a!@qTD@Qn!DqT!RPd!rk~ a!قR!rk@TT!$QkTT!QkTD@QT!PqTD@Qb!TqTaʂRa!rk~ a!`q TD@QPd!dqTʂRc!rk~ a؂R!rkTT!Qk@TbTD@Q!qTA؂R`!rk~ aD@Q!qTD@Qd! qT؂Rc!rk~ a~D@QQ,qHTA!@$!X`x`! drPdpdnclcjbhbfad`bn`/^R!rkh T!tQkiTD@Q@1QpqTA!$!X`x`! ~K gG gD g@ g= g:g7g5f3d1Pd/d-c+c)b'b%a#`!n/! QkTT! Qk@TD@QHT!@%qT!*Rn!rk~ a !L%q T*Rb!rk~ a+R!rkTT!Qckc a!+RPd!rk~ aR!rkTT!8QkTT!QkTD@QT!D5q@TD@Q`!H5qT/R!rk~ a!T5qTD@Qc!X5qTRb!rk~ aR!rk@ThTD@Q!`5qT!RPd!rk~ aaR!rkTT!Qnk` aRb!rk~ aAR!rkTT!QkTD@QT!6q`TD@Qd!6qTRc!rk~ a!@=qT!Rn!rk~ aR!rkTD@QT!P=qTD@Qb!T=q`TaRa!rk~ at!`=q@TD@QPd!d=qTRc!rk~ agR!rkLT!4QkiTx@Q1Q0qTA!%!X`x`! Z`.gRlPjNZ`,gJPdHdFcDcBb@b>a<`:n8~6!lR!rkHT!HQkTX@Q@-QDqTA!,!X`x`!  `@"`g gdPddccbb a ` n/~R!rkT!QkITH@QQqTA!,!X`x`! @#gglgj@!gnPddccbba`~~XR!rkTT!lQkTT! Qk`TX@QHT!)q T!LRn!rk~ a!)q@TLRb!rk~ aMR!rk TT!Qckc a!MRPd!rk~ aXR!rk TT!QkTbTX@Q!+qTAXR`!rk~ aYR!rk`TT!Qckc ax!YRPd!rk~ aqoR!rk T!Qk)Tt@Q QqTA!0!X`x`! ~^ g[ gW gT gQgNgLfJPeHdFPdDdBc@c>b<b:a8`6n4/2X@Q:QXqTA!5!X`x`! Pf&0f$f"e ePeeddPddccb b a`n/R!rkT!QkTt@Q8QqTA!6!X`x`! ~dccbba`n/~R!rkT T! QkT(T!Qk`TT! Qk Tx@QHT!qT!(Rn!rk~ a! qT(Rb!rk~ a)R!rkTT!Qckc ax@Q!$qT/^R!rk~ a_R!rkTT! QkTx@QT! q@Tx@Qb! q@TA^R`!rk~ a! qT^Rc!rk~ a!R!rkTx@QHT! qT/R!rk~ as!qTaRa!rk~ ajR!rkTT!Qk@TT!@QkTx@QHT!qTRc!rk~ aS!qT!RPd!rk~ aJaR!rkTx@QT!$#qTx@Qb!(#qTR`!rk~ a7!0#q TRc!rk~ a.*R!rkTT! QkTx@QHT!<#qT/*R!rk~ a!H%qTa*Ra!rk~ a*R!rkTT!Qbkc ax@Q!`%qT!+RPd!rk~ aa0RArk`Th T!H6Qk THT!+QkT!4QkiT|@QQ0qTA!08!X`x`! ~`n/~/~R!rk~ aR!rkTT! Qk`T|@QT!/q T|@Qb!/q`TA~R`!rk~ a!/qT~Rc!rk~ a RArkThT|@Q!/q`T!RcArk~ a@Q!q`T@Qn!$qTARbArk~ a3RArkTT!@Q~kg a3RArkTT_RArk@TT!LQck~ az@Q!d,q@TrR`Ark~ ap@Q! q@T@Q!@"q TacRaArk~ ac t@`g] @Z |@WgS @P p@MgIgFhD @Ad? l@< g9g5`g1@g-2g) @&d$e"Pc eecf0f0dPfpfg  @ f gg`g@!gfg0gPgpgggaio`g`ggk`gg@ggҠg@"gggg g g@g@g`g`gb @g gg`g@#gҀggҠgg~gzgwgs gp glbj @g`elc g`g\`gX@gT#gP gM@gIgEҠgA@$g=c; @8a6m4 g0Ҡg,`g( g$Ҡ$g d g gg`g@%g Pd Pb gҀg g Ҡg`%gmjc`/cmPd gpf%g gm g gfg/gg l@abҀg/PdPdfgd//aPdPdPdPd`g|ia`PdgifbPda}/{/ybw`u/saqdobmaknidg/ebcaan_d]b[aYnWdU/SbQ`O/MaKdIbGaEnCdA~?`=/;c9b7d5b3c1a/n-b+/)d'a%`#Pd!c/cbd~pf/b` / a dband0f~b`/ad/b`/adband~l~an g2g2g`gc`n`abg g~a @~ggc`fnPdnndacchj g`gg|`zdx`v/t/rbpcncl`jPdhbfPddga~_i]~[PdYPdWbUnS`QcObMnK`IcG/E/CdAc?b=a;n9d7Ҁg3 g0d.n,b*`(/&a$d"~ fb`fdn gfb ` n b/ gbandlfb`bg`fn gfda/b`/adband`cdanc`/bb/d`dc/Pd/cbdbanc~b`/adbcanb/da}`{Pdycw/ucsbqdo/mbk`i/gaedcbaa_n]d[~YbWnUbS`Q/OaMdKPdIdGbEaCcAn?Pd=`;d9n7c5b3d1b/a-c+b)n'Pd%`#c!dgndbacbPdb g aaabPd_ARkTRkhTq THT4qT qpQqqTЂRk RkhT aRk $š @q R_{@S[6S@?rT?r@ATqaT`@9 qaT`@y`@q!EF T*|5FESA[B{è_qTHT4qT$q pQq q R_{*|@y@p6<@!4 x` {_{@S[6S@?rT?r@ATqaT`@9 qaT`@y`@LPq!EF T*I;P5FESA[B{è_{@@(S?rT?r@ATqaT@9 qaT@y@?Pq!EF T*.P5FE{_{@@&S?rT?r@ATqaT@9qaT@y@{q!EF -T*{5EF{_{@ @+S?rT?r@_TqaT@9 qaT@y@*5*8!EqF *RR *_T*85 *45 R* *r4*4**Eq!FFE{_{@ @*S?rT?r@?AT_qaT@9_ qaT@y@Dq!EF R *?Ta*Y8 5*65h5**qEq!FE{_{*S[*e**(5**j*kTq3R[B*SA{è_{* Y{@y@ap6s|q!4b!(#B|~c 3R* @{¨_{* ?{@y@ap6s|q!4b!(#B|~Ψc 3R* @{¨_{* %{@y@ap6s|q!4b!(#B|~c 3R* @{¨_{ES[c*ck@7_ T*# k-T{e@?k! bx%qs%E7@@B@T\[BSAcCkD{Ǩ_{* z@yp6@SXT5 @{¨*h@<` !4b ~!#Y* @{¨_{ES[c*ck@7ҟ T*m# k-T{e@?k! bx%qs%E7@@B@T[BSAcCkD{Ǩ_{|z@y{4M_{uz@y{0L_֟qT*j* _T`xR R_{)J*4  *_T*4 *T*5@xRT*q`xR{ R_{ES[c*k+R@?T**#4****# ҿk-T{`@?k! bx q*s%*E?@@B@Tr[BSAcCkD+@{Ȩ_{ES[c*kc@7T***\C k-T"{f@?k! bx&qs&E7@@B@T2[BSAcCkD{Ǩ_{ES[c*kc@7JT*_*X6 4** *%4*X R[D k-T#{a@_kB x!!qs%E7@@B@T[BSAcCkD{Ǩ_{ES*[ck@7ҟqaT @9 qaT @y @ck-TC{a@_kB z!!q9s~@?T*** k-TC{a@_kB x!!q9s&E7@@B@T[BSAcCkD{Ǩ_{@@(S?rT?r@ATqaT@9 qaT@y@Lq!EF T*L5FE{_ҁ!@_A;{E.@? h`{@xA_A;{*E.`? h`@$@x C) K )!@{_,@!,_,@!Q,_@!F_@T!G_T!TG{&q!;{_;_B;{E.`?@h`@@CTC Da{_A;{E.@?!h` $@ ${_.@!1@T_A;{E.@? h`@@!1TF{_{1TW!F *?qE!F{_{1TB!F *?qE!F{_A;{E.@? h`@|@?1T'!F ?qE!F{_0@0Dd? @@@1@T@"@@1@Td_{D;E.?{h`{@ !E#@?AP@A#@R`?1T3R R!E?@"@c@TF @{Ȩ_{ХF4@ @`AT@ccFT@`@1@T @@!1@T@@n@!1@T` @{¨_4@BF @`T!@a`!FT@!1T_{A;E.@?{ h`4@`@"@B1@T"aY{B;E.`?{@h`{D;E.?{h`{C;SE.?`h`/-@SA{è(@@!1@T_@@ @K_F@`@TR__!R_@!{ @_{a@R{!a_@_{Scҁ@[ ?@ѵ}hu`@Ts@a @@@? 4`@ @x h5@&@!s@@?t@@ ##"" aDTJ[BSAcC{Ĩ_{SДF[ҀEE@?@`*R6EE@?SA[B@{Ĩ_*Fa4E;E_{  BF@CE @cC@E{¨DE @{¨_{S[`@T` @xu A?5@RSA[B@{Ĩ_d !{Sj@!'4T@SA{¨_{S`**R6<@SA@{è_p{S[;c`@iT` @}hwta@@ @?aTh ?a@a@ ?a&@ ?` @h7[BcCSA{Ĩ~$@ @bC;{E.?`h`@A@_LT @F!xb?{__֠`_"R?|A _"R!1|A _BR?|A})_@q_@q_{cESb@ҍ4~~ @5a@jE@@B@T&SA@{Ĩ_{cE@d@TE@@B@T{¨_BFC C@C _{ @9_qTB >BFT@D @dЄBB@$ @{¨_{ES[#**#@BB` BB b~@B|gE@@B@TSA[B@{ը_{B;[E. ?@h`SU!Ec @"@g7FA#:3*PBzscsc}V!TEg@@B@TSA[BcC{ͨ_B;{E. ?Bh`A{!` B@BABFB;{E. ?Bh`A{! B@BABAwB;{E. ?Bh`A{! B@BABB@d{  @{¨!cF! {BESd\@[`cksE@ҟTa@P)?a"TP)!TA;E.@?y@ h`@ T`C`(75y@R@RA!  R  R R*QR R3_k T"H`| A@h` "@ 4@T3@r@B@3+@T@4$@"!|}BlSja ja@&kaBKB j!j!k!@c@R!@ ` A! 7{` z`z`*clSO@RO@ G "|7@G@h [l\p;@7 ?T@R"IA!6#>/A"IA! B("IA!#A!RBB`,l@RaA! A!`*RBB~rA!`7@A!3@A!`A5B߼B!@6JA!`ԼNA!ϼ@RA! ǼJA!BnNA! Boӹ RR!EB"@c@T{@SA[BcCkDsE_{S[cIu^B@j`8+q@T `@@{R~aBa@?|+qTCR"R8j48"|RuRSA[BcC{Ĩ_R_{ sE`@4a@@R`@r @F{¨_֡'!! @@ @_֠'A_֠'A_֠'A_֠'A_{2XG`R``{_{BES@@BR@ @95`@q T@@TR!E@"@c@TjSA@{Ĩ_{@ShaT `@` TbH!PSA{¨_F`@_{q!EF{ _F @_F@_{S*R`<3#sB4sB @9`4R 0 Rs"a@R!`@95R׋s@RӋ ."R@4cE@b!c@54EA! !@3RRRAR@*SA{è_BFB`@@` @_`Al_@_?q_@_p@_F@_F@_@_FE_||b@B1@Tba!@_{ ֮`!`076R>:9Z9R Taj`8!Q?xqhT*1*QxqHT*"9^+T%*qhT*B!!R*B҈Bk(T*G*}*?*u*6v4E7@@BaT[B*SA!cC!kDbsE{Ǩ#E7@@B@T~SA[BcCkDsE{Ǩ_{S*[c#4!! }4!*!N@ R@7!*! @@* ;@@T@66"*!;@*<*"',!*!*v7~@**!Ђ!!?@ @T@`6* *A"! @4A9 qTqT!*!SA[BcC#@{Ũ*bҨ*bң*bҞ@SA[BcC#@{Ũ_"R{S[*c#5t @FEtӲ`5&@9879cRT*"h*"cF@**bZ!T @8A4!*! P*R9@A*! "T4DߎqT!*!=     `  @SA[BcC#@{Ũ_{S'b *@@ 5 R*@]4*҆*s SA@{è_{S*[RBF~!@@LEha@4B)@4*lv*v@@* vSA[B{è_{qRS**R4*kTsXSA{¨_A;{E.@? h`"R@ |@"|{_A;{E.@? h`@ |@?|{_A;{E.@? h`{@|@_{S@>a@ ?`@7`SA{¨SA{¨_{S@q0a@ ?`@7`SA{¨SA{¨_{S@[a@ ?`@7`SA{¨ھSA{¨_{S@E@`@`@@ ?ր@7рSA{¨SA{¨_{S@*@p@ ?ր@7рSA{¨SA{¨_{S@@X`@V@ ?ր@7рSA{¨SA{¨_{S@@<` @:`@8`@6@ ?ր@7рSA{¨nSA{¨_{S@پ @` @@ ?ր@7рSA{¨USA{¨_{S@@@ ?ր@7рSA{¨>SA{¨_{S@@`@@ ?ր@7рSA{¨%SA{¨_{S@@վ`@Ӿ@ ?ր@7рSA{¨ SA{¨_{S@v@7рSA{¨SA{¨_{S@a@@7!A`@@7!A߽@7рSA{¨ԽSA{¨_{S@?@`@`@`@`@}@ ?ր@7рSA{¨SA{¨_{S@ @f`@d`@@5@ ?ր@7рSA{¨SA{¨_{S@@@ 7!A@ ?ր@7рSA{¨zSA{¨_{S@B@7рSA{¨eSA{¨_{ ѽ @{¨,{ ǽa@ @{¨!@{ a@ @{¨!@{  @A@ @{¨{ @ @{¨{ 4`_ @{¨_{ u`4`_ @{¨_{B;cE.`?@h`[S@kUT @V@+@`Tb@{BB1@Tb?*a @ ѡ7` `95SAcC+@[BkD{ƨ_s@bT{ҠR{ R{  ! @K`5RF@A4 R{_֣cD{SДE[v@cks@@һ{;G ҺZF{@ 5.Vj5P`@ @A@_AT?+*@˖*4)qT5*G565`_8(qT T5G!!@,5 95U5[BSAcCkDsE{ƨ_{C;cDSE.?k@[zh`TlF!!@9G @! ' {@'}{ F!&@w74 !R@x@Z–5?}4FA @@?!T#@`? z@ۏ65&oU[BSAcCkD{Ũ_{ES[cks@wGF@?TR( `@!T@6c2@?qTTR}@_`69~`733@!@3`@T @ O;#S1@#&@1T3*3@3@;@?aT@kA:T;@;@?@?T T;@3?@;; 96k{,+TWG7@@TG@@  77@O@*i7@"Rl}*@7!ѡa,77@RG@*S@@gS{*`5g@*g@|$6@"@ @@K"4@"7@V"7@"7@!7!|@@!@k!T@p @k7@C@" R) c7+ 47@`@ @? T@@?dqA T@ @ qTXq T!@B,@!,BWB|@7 7@W@( @# @,@f$@|@kTdjc8qIzT0qT|@kMTejb8qIzT0q@TBq!TcsBcja8qdIzT!LTlqaT Tcjb8BqdIz@TtqT3sB7A7@7;ܺ)(׺) Һ)ͺ˺+@ 7@sB7! K@!Tha8_qDIz@T_0qTsB77@@TK@@!9? T R{G@@`7A@{AK{@47@tAoAg@.#cBK@9 @?9T TT_T7?|7@?@ 6   |7g@^g@[X^7@7` @tT͇6EO!Ew@"@c@TϓSA[BcCkDsE{Ϩ_$҄ R{S!@cE[ks@WG@3 T@73@@xSR`6!3@ @!W|@7`@3@ @R|73@ @"M||`@1@T`D@@!FaTH"!xG`@-& !@q4$q@ T#c !$ xS*'Uw7F;`@#c?H@6CAO@ `"5K@ O@S@6 WG%`6@7р`9g@qlT*TO@@7!A% ؘ 7`  FT@7!A@ `^1@T ` ̋Һ $ @7!сa|`   AT@a6!@7!aܸtb Ea@@?TtL;T@a7!¸;@7!a;@`=  U`-T@7!!@7!a ;5`T@7!A7@><`@7``v #4A@7!Aai@F7"Rz7`@7``X(;@TS@S@?9Ӏ3ˀs3 @@9qIzTZ0qT~@_8(qT9ҟҙAR TZ9˔ 5z7z 7@ky8(qaT$  z@6&5z@76ւџTz@6BTz7  z 7@7`7@+7@@@D7?@ҡv@!T@A7I `#rz6ҡ 5ގ5"Ry@*7!сa?7@?Vz 6@7р`?@ @!T@7S?z <79FT"Ry*@7!сa6Y ##z87!G`@!@@?T#@!T@7 5z66 @57р5Z"Ry@*7!сaM6`D@!T@!E_!T  @6!0G!@Ty&@`@"@!E_AT @!F_T@@`TZ @@7`5@7!сaXp˰qk T@TCi pҡ  @ 7р RՆ*@7!сa7S@@7!Aܶ@7`ն$39@7!aĶ4J`#@@ @O5@7!ѡa8 !@@@=5~@7!ѡ @7U"{u4AT!LD!@Tx2@`*@@ TT@BE?AT@_T9@7!сaeU7@7!ѡaY $2@7!сaL5"Rx6@ 7Ѡ<`3@8#xG@@7@`@6y4@T@eT@4&x* "RKx*@7!a #x 6Vخ&7?T@7р`n7@x6,!Ra@7!aa޵ @T@@Bxx373@"Rx 7@7р`ĵnx`7w V6``R$G@k`@7``&mT $14$1RJ %1!EW@"@c@T~SA[BcCkDsE{˨_{cW;SE.@?j`!'[ksq#5*`@D?`@1T@7Ѡ`U@T@6`ur!T"B B@A95 Uur T@7Ѡ@2"B M@*7!ѡa$x7!xG!@&5R6`@a@u@kT7a@'<1@"R?w*a@A7!a`5 R`07*@a@9C-&z @ R9|@_!7;7@`@?T;@?aT!RaR9xS|@7|*T(1(0"R?v*?@a@7!a{{@ 7ac`@!xt`? TE. ?j`!) 5?@$@A$@!A$7;@`@?T!|\u`7@-BB*0"Rv*@7!с{{{@6 aR@9a4xS@7*w7R9`@Q`qTT7E. ?j` $@ $ E. ?j` $@ $SA*[BcCkDsE{Ȩ_{S@@!ET@"@'Ҁ6ca@F?T{@7!A(;@9#@6cE@!c@@ȴFA/`@7!AE'@@B@TSA{Ũ_{D;E.`?րh`ScF@a[+DcESA@@{è!c@ȏFT`@1@T`{`@ 7`@SA{èSA@{è_{' ES[c*k@s@741AT*"R*9С4! +$؏*B|@*!5B4ˏ*B|@*!+" !#*"F*!+b@*!@,*,*"ҡ!&@4*b! @4*!, @4*!-@4*!@-*!-"!#*A;ՠE.@?5h` @UTG@D0@0u@*F!T@7Ѡ "TU`@7Ѡ`A3. @7!A5!#*"y**Q6!#*"k**C6/*>6d,)!E{  @K!R BE{S@@=!R{   !-{ +f 5|@4!?4!q R @{¨_{`C!EF_u{ _{S*5|@q!RsV! abA i@B1@T@4)SA{è_{_tAtAB "A@!1@TA{_{ N@ @{¨_{F@{@_{  !-A;{E.@? h`  a! v{_A;{E.@?!h`{ @+{ wT  `!.Z @{¨@+{  !/L{ 5!/B @{¨_{"B S@SAR{¨E{!! S `~SA R@{è3{S[Ea@!@?TB;ՠE. ?Th`V`4vBzuvTa@!@ ?[BSA{èvSA[B{è_{S@[@!@?TB;ՠE. ?Uh`(`4ҟ TvztFTa@!@ ?SA[B{èFSA[B{è_{S@[a@!@?TB;ՠE. ?Uh`5ҟ TvztTa@!@ ?SA[B{èSA[B{è_{S[, *b@95xQdqT Q$qIT?|qR @zǟ_kaTsR^ `Ta_8SA*[B{è_{' )ES @[#='=+=/=3=7=;=?= @?J4#E!R@*! +ҏC*B|@*!5B҂)c7`@@@Rȉ.*R%{a`0!F{S*   !`1A;E.@? h`T  !2az@!Qaz5 R`zw?az@!QazSA{¨CqTSA{¨w)SA{¨_{SsE[i*`@4!`34!3@`@!@4`@щ`@Е@!4{`@u@B@3!5rc@B!`5``@]B*a@R`@*a@@RA`@SA[B{è{SsE[*`@!5C`@!5=`@`@!65c@`6!"`@|`@!&a@@R `@q 4`@!`3`@g@`@!T@?}48NA4>ma@@R`@S   !6@{@S[-a@*7!aݯ[B*SA{Ũ_{)E=C=#='=+=/=3=7= %@/'C+ )@!E/@"@c@T{Ѩ_{S`E`4 @K@@0@H@@f`~>1@``@69DB @! 7@ ?@@T|@5DУ @!7@ @`@6FФ @B`8@! @ 4`@7`V`@h @7``MSAA`@@{è_{ ~@` aT`g `(TAe!EF!` @!1TE @{¨_ց!@@ @!@@ @!@@ @! @` *<'`@ $`@ !`'{ `@aR @{¨_@@@@ @@F_@@@F_{S!E[h@ck+;@)@7  @@5X``1`@ @!T@6!=43@ @T@eATD! =@`@@6@`@b_ TE!%@_`@7``<  @1@T `@7``/3@!E7@"@c@TSA[BcCkD+@{Ǩ_ с!E{S@["@7SrTr!@_q @T_qTD$R$R~rc@5#@`sF j38iR!E7A"@c@TƆ{@SA[B@ _{BE !8C@4!E@3@z!(Fҁ!E@"@c@T @{è_ց!F@aT@GaT@X!TG{4@@ @{_փcE{d@Ce|`6 @`R @a6 R!n!E@"@c@T]{¨_{@Sc @C`?֠@A7!UR*a@7!aA4R*SA{¨_{q!FE{_փcE{!Fd@یC! | @` @!T@7@A7!!E@"@c@T{¨_{[Sc#T4RbI]~Z@w @W`@7``R5T`@X;ՀE. ?!>k``5yb`@`6`ͫ {u*5+TRE. ?k``@A$@!A$7``[B*SAcC#@{Ũ_{[(@s{FSМWDckRAc>*7@*@Qv@`@1@T``@T@6`V@`6@@W@7ЬJqKTT @7!сamaT @@1@T@`@ 7`]*@Q;`@7``P@7р`I9?qT@7@@@`@7Ѡ`0?qT!F@!@4 !`?i !`dSAcCkDsE*[B{Ǩ_{D;E.?{h`Z{C;BES[E.?ckssh`@@G a! 37QC@T;@Y;`2@27@7р`˪7@;@7!F?@T@!F_T6`2@2&`,`'G F@!1@T!Fa @1@T F@!1@T!F @1@T F@!1@Ta2@a @ @7 l>!Fi!!@BB!6@6-@OF!T@@7C,߫@7!a7@7 /7@ GC@xC@t?@r;@pn!E`2@2G@"@c@TSA[BcCkDsE{ɨ]! "!@ `@@)B  A)!&!@@AB @!&!b@e@9B @q!%{S@#bRATSA{¨`%SA{¨%{ @"bA @{¨%!@% @b@a@cX@%@BF#@d@cb@B @%@9@4@!1T"@95#@9RRq!aR`%_@9@4@!1T"@95#@9RRq!aR`%_{ Z`Aa @B8l @_T @{¨!@% @{¨}%{ D`Aa @B8l @_T @{¨ !@l% @{¨ g%@@B` @!@3B @@ [%` @!@3 S% ` aAc@M% @!XE{4@{ !@=%@@{ !@B @4%@ !@/%(@6 )% &%{E;S*E.?֠h`[*c@k A A֢6@*?6q@THTq@T q` ! ! q !`!  $ !F @1@T ZF@@7@`"~TSA[BcCkD{Ũ_{  @T@ ! $@?(?4' @F{¨_{ 0@@27!Az_ @R{¨_{ T @F{¨_`!@${ @!b @ @{¨$!@$!@z$ `A@u${S*[cbkR+\94u68*ctC`?ր6@Y$!F @1T $qTqTqT q!! !  ` $7$a@7!aaZF@@7@`~SSA[BcCkD+@{ƨ_{(@S @5*@SAG`{¨$ A@$ A@# `A@# A@#{ @ !b@@@T @{¨`B @# @{¨`#@" AA@b@!@B @#@!@#A @#@cT@d!C@B 3c @#!!@!!`GD@qZ`@T@6#*#{ES[3XA@ҔF~ҁJw`6"@@  =w6@!T@7@7!AI@B 3`q#E@@B@T.[BSA{Ĩ_@[#b@ B @V# @cCc-B@3H#{!D@ 3@] !@'  @{¨_{E @֦8 TȠ8`TȠazBlF@@@sb"! E@@B@Tπ @{è_քDQ*@xqT!` !@ {D! !@ F?T#@F`TDb @!!@ @@TD!@"@ #@@@c1@T#AR@@{_qT*{D!"@ {_R_{@@?q`TDB B!`#@  D@!# !`6~ {_քDF@T@% @%!$g { _Tb@F_!E@!1`T C$5 @{¨_{ _Tb@F_!E@!1`T C$5 @{¨_ @cD{`@!,! R{_ R_PGA@?TD{@!% {_R_`@D{@!% R{_ R_{SsBsB(t@s"@4D!%@ R RSA@{è_{!` 5 @{¨D!&@  @R{¨_$@T{^q{__{S8@[cM 5@`:@B1@Tt:Ҙ+EB`@`@JTzu@?ATSA[BcC{Ĩ_{*?q TD!@'@  Oc"R!xcD!'@w {_{B;S*E. ?@h`*@7OR33z3SA{¨_{:@@{_{!E@_@TDB @!@(@G @R{_{!(@BD@@b @6 {_{S@ŶT*@b!~֎:@sʂJ@*@!J!|@!3AT3SA{¨_{SF[cEk `@y 4@@ӋҙRR@nw@yJkJTNq@58@@T@@6E @@?`@@E!1@TҀ 6@7Ѡ`@y`y`@yk`T`y@8e`E @@?`@v@yREQE#@?|EN6EE@?b.SA[BcCkD{Ũ_{S*[c@*=@F*E'6'Fh@E!ˁ\E҂E@?^ *4EE@? EEITR[B*SAcC{Ĩ_{T` J1AT {_{S@[ٵaT&iҢҖʢeVVPu@56sӓs~ĵTL@sӓs~TLⲍ"޽zb2ABQ|SA[B{è_@{  @sӓAT3@TAT @{¨_{A! @BD@@b @{_@D|}hdCc`ETE{B@!`){_Chdc| Bhd hc__{*?q TD!*@!"Ra !@D!*@{_{B;S*E. ?@h`*@533SA{¨_A;{*E.`? h`@_q TD!+@ `"tC!D!+@t R Rb\9A! a9{_{S!E[b@#@'AT@!7DB @!,@c& @R@J@kT2@4 @`56@*2@4#@@!1`T 0G!,@=ҁ!E'@"@c@T}SA[B@{Ũ_{Sqa@7!aaSA{¨_{D!-@  @!T@!7D!-@@!1@T{_$@!  |(@!!@5{{S(@!!@5.@b@_B?mTb!a@7!ARSA{¨_{S(@!!@5 2@b@_Bğ_BЁb@7!ARSA{¨_4@! .YyXy{!S @x@5*`D!@.@3R*SA{¨_@bBD! /@@b @A;{*E.`? h`@_q)T`D!/@w "AJ`D!`0@k!A #RRc "Q9C# #9{_@AT@7`D{a@! B @T{_@_{SRߛ`5*aRn@5A!!0@*SA{è_{S@ccE!P@d@?_!@@1@`6@`@`E?@@B@T{SA{Ȩ_bBE{SB@@?#RaB2 6`@7``ҡSA{¨_{@SbBE[#cOH@OT@*=6@Rb 5'@/@TRsssR1T˿JT TTs˟ T{5S RORa!EO@"@c@Tt{SA[BcC{ʨ_{@A(@ a!@!`DB @!1@ ?`@@(@@a!LET`DB @!2@n`@7`@K @{¨_@CQdq( T!8!Hc8ca! `3_3_ __`,_4_ 4_``%_`4_ր_ր_4_ 5_5_5_ 6_`6_@`F?@T`E? T`F?TccFbB@?6_7_@7_ր_dD{ @!7@{_3__@ _@ _{@`D"B@5!-@ @!T@a7`D"B@5!8@@!1@T{_{S(@b2@@_Bğ_BЁ@7!ARSA{¨_{S(@`.@@_B?mTb!a@7!A~RSA{¨_(@{@Sc0@c\@`?a!DT@7cC_@SA{èc9ISA@{è_bBF{ _T`@ @{¨bBFC 95 @{¨_{ _T`@ @{¨bBF`IC@95 @{¨_bBD!`9@@b @4bBD!@:@@b @,bBD@@b @%ccD{`@!@ @ @{_{*B;eDE. ?{@h`@B@;y{#@` ET`!nR@  @`ccDa!`@R R_ R{_{S5@1Tu&@ATb@A@!1@TA&Ra@!1@Ta&SA@{è_{S1Z@ @5SA@{è_{#@`4FT`apR@  @`ccD!<`@R R_ R{_{  `hD@`4 `@7``` `@6`F``T @{¨_{S@p@?#@bC7"@SA{¨{`DG@5R{_`LD{@ `4`F@* 5* @{¨_{ (@ka&@ @ {¨-cc<4{bBES*[cks@@_!6A@T@64@#Cc4O@4K@@!T@6A!`5G@@a!DTf@5 =A! 7R`XE7O@4K@@T@67@G@´@4 @ @3[3@ 4W@ @T@6K@_54?@*1;@*B,K@*Ru"*!= *7"*a!*! "`E_@@B@TnxSA[BcCkDsE{̨_{cxFSa!E[*k+Js"@? 4"B<@{~|k`kTsATXғR9RwB<B@;J@c `@4aC*AIvy4*B<! +sZsNB*B`+sy9 v*!=bҶkz*Ba=*?J*#E*`E?@@BTSA*[BcCkDsE{Ȩx`E?@@B@TwSA[BcCkDsE{Ȩ_{S@[a!E"@/T@6 @bsS @Tzua!D`Ta`4@#Cs+4'@`E/@@B@Tw[BSA@{ƨ_a!TG{5R>@@{_a!TG{5!R>@@`(6 @{_a!TG{5aR>@@{_ր@!T@A7{![R@ v{_@?<T@!@ |_#!C!` RKDxa!уx?T|@|_{`Da!ES@"@Ҹ4~$@ҼqAT`@7``6 RvRa!E@"@c@T!wSA{è_{S@^R %@!T@6SA{¨`a@7!a SA{¨_{S?@AR  @!T@7ͦ%R,R@@<TA@@3ss~#RCcKF`Tx`!xxAaTc|@s|qҀS`T4@@7@`ŜSA{¨_@@!1T_ @{P`F@!1@T{_`F_@a!G_@T{R {_@_@a!G_@T{ R {_@_@a!G_@T{a#R {_@_@a!G_@T{(R s{_ @_@a!G_@T{,R c{_$@_{`GC@T.R R`F?@T#@`T@6 @1T `Db @!?@S@$@A$_R{_@cc(E@T{aR@ 8){_\@!@T@T !@RA_{D;[`E.`?քh`S@ccc(E@#TC?T@aR 8^@u@T!!}Ӥ`CR5`}Ӣ\xy^s`@CA ?RwSA[BcC#@{Ũ_{S`Ea@@`E?T`.R@` @``@1@T`a!F !@T@7 @dFE@BB@B @" @eFF@BB@B @`@7``ڕ@SA{è_{ _T`@R @{¨`C 5 @{¨_{ _T`@R @{¨C t5 @{¨_{ _T`@"R @{¨@C`&^5 @{¨_{ _T`@R @{¨vCH5 @{¨_{ _T`@bR @{¨`C &25 @{¨_{ _T`@BR @{¨JC@5 @{¨_{*BQS_q( Ta!TEJ@5@a!GTa!EATa!TE<@5@a!GTa!ET@@mT`FT@@?mTATssE qT`Fs$@1@T@1@T*@7!ѡa@7р`ssD`Fs@SA{è_@$@TCQqT@!@я`D_{*a!8Dު 4۪4{*@@`D{_@@dF T$@A T!@@?@z@T_ qTT_qT_qATa!F`E_k<_qT?a!F`Ek/?a!F`Ek$?a!F`Ek ?a!F`Ek?a!F`Ek0`D_{ bBEa!F !C@Dd5 a!E@@"@c@TGn @{è_{D;@@C`E.?`h`{è_{@S0@0``@2@21@T`^`@1@T`@`@7``2@2zSA@{Ũ_{I;jJE==#=`E.?C'=+=/=3=7=D@/'C/ ) i`@`E/@@B@Tm{Ѩ_{i)E=C=#='=+=/=3=7=$@/'C+ )@`E/@@B@Tm{Ѩ_{C;a!D`E.@?{`h`B`!@#a!DC;{!@`E.@?`h`B R{_{ R`@cT@7 @as_mTb( @{¨_{a!PFS@T*_ qT_qTSQqiT/TqT`F,@BR@8qT@T5 @BR @/qT@BRa!F!3'41T@BR@1 TqaT`5@5`E`DSA@{è_{D;`E.?{h`r{@?1aT ?,q T`D! @| @5!R ?|q)T`D! @nR7@?\q T`D! @c@?q T`D! @Y@?q T`D!` @O@6`D! @F@?1aT ?q T@D!@ @8 R{_{ @Z 6@lF! @'@F @{¨_{ @E 6@lF! @@F9 @{¨_{A95@D! @ A9 4@D!@@E{_{A95@D! @ A9 4@D!@@F{_A95@D{@! {_A9@E?qA!F_@?qT@D{@! {_$@@!1`T__{A!E@#@_q T@D! @ @!4@D!%@@@F A!F=C!a4 @A!E@"@c@Tl{¨_{D@@D!` @m A! @@f{_{D@@D!@V A!@@O{_{ qA!E{ _{qA!F{ _@G{@!1!-{_@Bc@T@lF{@?!`{_#AB` @$ "_Tc@#@!1T__BB@_T@lF{@?!`{_"@b#AB` @$ "T_mTbA"|@!1T__@T@E{@!{_ց @@_T@@@Cd@cF? T @T!ABB@@FdT!@$ @@!1`T__{@S"@E!`@ @B@@e# t@AT5AZu=`<SA@{è_{@S"@E!`@oCB@e# t@e5@Zu`=`<SA@{è_{ckhA[@S@@BR$T@@c1@T*@ ѡ7`ÐT5`@ T@lF!`@)TZAR[B*SAcCkD{Ũ_{BBESA@w,b@7Bbb7@qT{@-T@G!@R5a T@G!@@ RA!E@"@c@ThjSA@{Ĩ_փ@@D{@!{_@E_"!@{SRJi4`?@FSA{¨_{SR8i4SA{¨SA{¨_{S!R$i4`@@SA{èSA@{è_{S!R i`5 a@Ҁ?1aT@FSA@{è_{S!Rh`5a@?*1T@F?q@EA!FSA@{è_{SRh`5`?*1T՞@F?q@EA!FSA{¨_{CcESa@!-C"4@@F?AT@?ATBB!@D!"@`?A!E@"@c@TeSA{Ĩ_C;{@E.@?`h`@`AxaO*!bx! !? T@lF!"@]{_{S* @T@7@D! #@L B;@E. ?*@h`@]`6 bbF9!R! R!*ab9SA@{è_{S* @T@7@D! #@# B;@E. ?*@h`@5`4abF9"RB "" bb9SA{¨_{CcESd@bBBxF!# 5 @5Bx|A!E@"@c@TkdSA{Ĩ_{b@BT@6b@_T!R"h b@?KT@E!#@c`!}bha`h! R{_ @@@@D{@!`${_A!F @1@T @F_ @@@D{@!${_{A!E@_ T@DB @!@(@1  @@@D!$@|{_ @@@@D{@!%l{_@D_ @@@@D{@!`&Y{_@F_{[@ESc!@@'@XEXDVE?T8YqT׿&#@T 4@@c @B&?p@7``@7`'@@ҡT[BSAcC{Ũ#@R`@7``'@@!T@@SAB'c @[BcC{Ũp'@@@TqcSA[BcC{Ũ_(@7 @!@6@D{a@!{_ @@!1T_@F__(@7 @!@6@D{a@!{_@!1`T__{@@F_T@E_!c-@c!`(I@D!)@{_{S@@9?qAT@"@9_qAT!d 5a@@?Tz 5@D!)@sR RSA{¨_(@7 @@6@D{a@!`{_?r@EA!F_(@7 @@6@D{a@!I{_?r@EA!F_(@7 @@6@D{a@!2{_A!FCR@E_j_(@7 @!@6@D{a@!{_X@@E?qA!F_(@7 @!@a70@@D{a@!{_{S*A!8F[cks4`@T@ 6 Qq TCc E*cd@`? A!8Fs@ 4 qT@ET[@F T@7Ѡ`Xx@@{.@.@?"?q@z`TR27@@1@T@@1@TBR@*7!a3@7`,7.@T`.@ T@lF!*@Z4 @9 @!R@F qEE_k@1TEDSA[BcCkDsE{ƨ_{S* @T@7@D!`+@e B;@E. ?*@h`@3`4a@"B Ԛ!aSA{¨_{S* @T@7@D!`+@B B;@E. ?*@h`@`4a@"B Ԛ""bSA{¨_C;{@E.@?`h`@`Axa*!a " !? T@lF!+@ {_O{SA!E#"@/`` =@T@7@D!,@`brcb f e"d2cBSh`5R0W@Rr_k T@G! -@aC)R@ @BQ d@cQQd ) `)`T R2@UFAT6@T`͚`A!E/@"@c@T.a{BSC#@_{S@@T@tSA-{¨P@@!T@6T `@_b@TSA{¨`9`@TbASA-{¨0BBF_T{jaT}*{_#|@_{ @ @B @_T@D!-@L @IT\R`@ T@G!`.@7 Rc @{¨_{ ,`A @{¨_{ T3a@? Ѐc Aa@!a @Fb  @{¨_{WD1TA!F *@E?yA!F{_{BD*1aTA;@E.@?BBF h`@{_{*D*1aTA;@E.@?BBF h`@{_{ D*1TЙ`*5=^33 `@@!1T@F @{¨_{ C*1T`*53sbA`k@+7!A@F @{¨_{C*1aTA;@E.@?BBF h`@{_{ @!T@!7@D!.@C*1Tn` RRc @{¨_{SؤT[SsG`@>4`@!`/: @~c~`@R!1bSA{¨_{ T6`@  a@!@?!Ѐa @F @{¨_{ T`@  a@!@?!Ѐa @F @{¨_{[@cXFST @ Ҁ?!T @!T@a7*c @?T` a  @T@@6U@@T@`@!T@A6F@T@*T@ZSA[BcC{Ĩ_@4{ .T `@ `@ T@!?!Ѓa @F @{¨_{ T`@  a@!@?!Ѐa @F @{¨_{ aTu `@cc @F @{¨_{ ۣT_`@  a@!@?!Ѐa @F @{¨_{ TB`@  a@!@?!Ѐa @F @{¨_{Sa@?q T@Da! @ t@44@D!%@@G!/@UD@TT@! 0`@*SA{è_BBG{SA@T @@4@@ ?sSA{¨_{S!Ra`5@aTėҠ?1aT@FSA@{è_{S"@_T! @aT@SA{¨!RaSA{¨_{CcESa@C!-s`5@aT}@?1aTu@FA!E@"@c@T]SA{Ĩ_{CcESa@#!-B`5A!G@!@[aTJ`?A!E@"@c@T]SA{è_{ @AT1@Ta A @0{¨a Ac@1 @{¨ @{¨_{c$@7@S[@"TXE4`@D!`1@*`JTzu@AT[BSAcC{Ĩ_{@BT@6@B@_Tʢ=AaTٖ`{_BBE{A@B*1TƖ RERR%  @qT@qT(@qT@qT@qT@qT0@qR`R R  R R@ R` RRxRERyRaX6?qb RaR!?qRR!R{3RFR3|Re3"3P6qaR` R!qR!~RERs9w9R{9aH6?q RR?qRcA999IA!E@fc@T\{è_{rB1TN!!E  E{_{`B1T<!!E *"BF!  E?0@q{_{JB1T&!!E *"BF!  E?@q{_{4B1T!!E *"BF!  E?@q{_{B1T!!E *"BF!  E?@q{_{B1T!!E *"BF!  E?@q{_{"BESA@!!D@3@!@2R<á7@?qA5T@TT @ G@ 5*1T@HT`@7``  R G!2@t G!`3@m`@`6R`!!E@"@c@T[SA@{Ĩ_{"BESA@Ҳ!!D@3@!!3<\7@?qA5TL@TT?A G@$ 5*1T@HT`@7`` R G!4@  G!5@`@`6R`!!E@"@c@T{[SA@{Ĩ_{!!ES"@aR x @!T@7C5R%R` @<T@b@ |54`@7`T$R*ҵq*4a@7!aaD7@!!E@"@c@T2[SA@{Ĩ_{$ES[*!!E@-4| `T D!5@>ab@*| `@U|@!g aJT@| g0 `T G!@p#@R^"*xTz`3sG`@] 4`@!`Y K 6 G!`@M@ E@@B@TZ[B*SA{Ĩ_@Cs{"BES@@4Ea~"R7@@ҡT@SA"R{è@@!@TZSA{è_Hh{ST@4G@4@!SA{¨_{%ES[*!!E@/hg} 4 `GT D!5@F# \a^++@*`++@{++@'@ `IT+@n!(b8d'+ +@ `DT+@n!8b(`'+'@|g aJT|g a$T G!@+@^R!^ *@TZ E/@@B@TZ[B*SA@{ƨ_*@Cs*H{#cES*!!Eb@'`4T@ `T D!5@a@*1{@[#@|g aJT|g a$T G!@I^R *3TSZ E'@@B@TY@*SA{Ũ_{#cE d@`5R@!!FTWR1T@ Ra!!E@"@c@TY @{Ĩ_{"@ @T@ 7 DB @! 6@T3sG`@4`@!`Rc @{¨_{!!FSi`4` @ b@*@0@@T  DB @!6@hҒ  D!@7@\4R@*SA{è_"BE{C@កR 3 @BT@"7 D!@@_ T!@B@ | CR#Rxo`6|@ @!!E@"@c@TX{¨_{@S!!E#@AT@6@!@?ATTs'@4aTj RR!!E@"@c@TXSA{è_{ @!T@6@!@?T DA!.@2<TCR _ T G! 8@  Rby @{¨_{ @!T@6@!@?T DA!.@ ~<TR @_ T G!8@ Rb @{¨_{ @!T@6@!@?T DA!.@U<T`R Rc @{¨_{ @!T@6@!@?T DA!.@Tґ`R Rc @{¨_{ @!T@6@!@?T DA!.@ T`R Rc @{¨_{ EB @ @3BCӂ/rA RIу!@$?K|@_ Tҁ_G TAa)?T҄ Ҁ Úg $xe Útx%^ӥ*_T@dy % ÚG!~5D T@р4+@2++@ d@:!gxd +`ybc_TBa`ybc@(`gna bT?@T)li@ @@aT@a  G!9@~ E@@B@TW @{Ĩ_{"BE 3sEC@R  @BT@"7 D!@~$@_<T!@B@ |bK~ aaT@ T G!`:@о@b@!!T @{èU@a@@THW @{è_{S@@!T@6~ aATƐRa !!D @1@T !!DRSA{¨_{@S?|@T@@6~` aT@!!E4j`R !!D @1@T !!DSA{¨_֡A@_T#cFb@B1 Tb!;!`;! <{ *"BFčB;{ E.`?@h`@`xaBe!"RB *ta\9A*a9 !? aT lF!<@1{_{S G@?T$R  F@T3`@T@6`@1T`  D!@=@  `R@@|RSA{¨_{S G@?T)R  F@T3`@T@6`@1T`  D!=@۽ R"@"|RSA{¨_{ GC@T5R V F?@T! @T@6 @1T  D!@>@@8@A8_|R{_{#@ |D T D!!@2@ F?TA; E.`?#RC9 h`@tA< 9_9R{_{ `"BES*@@aTng~R7. bW`g@ aT `RR7WL `Tng~R@R.7 b? `WDT@alT hTn aJT D!-@:?7@`Q7<qTd1kT(`81T`4|SR8ac8/Rg7ayB<Ab8a hT haTB6BB<_qTc7|q TR7@BS**B*B<4s!R@|S`9Rb!8 G!>@!!E@"@c@TyUSA@@{Ĩ_{S[a@9!Q?q(TB9BXaxa""@@ Қ@7!aY{@T*@`7@@7@9q TqTqTT"@?(TvyR@iT 9@7!a*{@T*@7@@ 6 Da!@@9 q T$q`TqTTv9iT@Tvv܄ @6!Ԅ @6̄ @6Ąq  m@7!az@T*@7@@7w-~ aaTW*@@7@@7@9qT@b`qaT`~!R@62|@`7*@`7@@7?`9m@!T@!7 D!@?@@?T@9`9\9`!*@7@@ 7cP dG!` @m3sD`@4`@!@?a G3sD@4`@!S`@4 D!@GSA[B@{Ĩ_"BF{#cEBLSd@' 54 4R `dTR@a5RliS hJT n aDT?@(`Q??qTU `T D!-@R?1TQ?a5 `T8a?,g?@a(hy_AkT?qlTR?@~@t4&|S$|S|**u9`j"8Rj"8ah"8*@b'# ` "T`g b TC_qaT4_qT4s"RB|@ha8c9saTR G!@J!!E'@"@c@TSSA@@{Ũ_"BF{#cEBL d@54 !R@9!a8$|@!@SS|SC*cSq!T D!,@~#hd8!hd8b *!* B4nQ(a[Q4@a_qaT4_qTa4ha8!C 9B?aT#@@" E@@B@TuS @{è_{ @T@ 7 D!!@޺ #@@@c1@T#A zR{_{ @T@ 7 D!@>@ź #@@ @c1@T#A zR{_{S@5ET4nD!Ta&@!0@@6`@1T`4(@A!@ ?`@_T_T$@0@@@6 D!`@`@6?5 DB @!@+`@7``y#cD @!`@@SA{è_ D{@!c{_ D{@!X{_@#cG_TCT@6T@6"RR"_#c4F_T@`_*TxbBe@T@6cT@7R D{@!,{_{ 4@T G!@ !!D!@8T'`Rc6 @{¨_{ D! @ F? T @T@ 7 D!@  @1T @@#RAC9xR{_{ D!@׹ F? T @T@ 7 D! @ȹ  @1T @@AxR{_{ ~5`@1T` @{¨_{SB; E.?#@Sh`cT@c6 T@@7$DB @^*`2@@`h@t@[~@7р`x@@7!Axt2@2@@`x`2@t2]xBL|SA{Ĩ_B;{ E.`?@h`@`AxaPfA!"RB *ex$Q9A*9 !? !T lF!@ @?{_{ @ D! @1`@1@T` @{¨_{!  |$`4`@ @{¨_{!  n$`4`@ @{¨_{! `$`4`@ @{¨_{S!Q$4RtSA{¨_{S!A$4RtSA{¨_{S!1$4RtSA{¨_{S D!@ĸ!$`5R SA{¨_ց@?T E{@!{_R#cF@9!!$ bhaB1`Tbh!__A@?T%EC D{a@!@{__{S@;X@7a@" *R6؈SA{¨_ց@?T E{@!]{_@R#cFha8!!" bhaB1`Tbh!__{#cES[a@O`TPF#Rup5'@/@03~q`)T Da! @*>R!!EO@"@c@TPSA[B@{ʨ_@a@  4'@ 4r`RLr`RLF!E@"@c@T$L @{è_{S@ 7`@L*u5EFSA{¨_{S_T@/*1T C ɠ5@/*1aT~Q*GFSA{¨_{S/*1Th`*L*/1T[FEq!FSA{¨_{ XJ @F{¨_{BESA@'!`4` @RD@5` @!RC*45lF!@@aF#@a!E'@"@c@T}KSA@{Ũ_{ sF`FEuE`JE!RC`JEpE`FE!RC`&E@&7!Ahq`>E`n> @{¨_{F{_{SF*J@4E!RC*EDELZE=E3`@SA@{è_BFBJ5"! ȯ{S*R[ck:##bR*!@@y*kTR*R6@*@**"ҙSA!#[B"cCkD{ŨSA[BcCkD{Ũ_{S!sE[c`@k+HTa@@RSA[BcCkD+@{ƨI`@_8!@ "H_8>@85 T`@! H`@R*! !H@9?qTaT!RR`@4Ҡ!!L%"B#RR!@"H`@bKYkv8*H?qTc@"!ґLa@@RITc@B#!҆L`@R!%Hj`8?qT aT!RR`@4Ҡ!!mL9&C#ҡR!@"oH`@*jw8*hH_qTc@"!ULa@@RFI"Tc@'B'!FLKq`@VT@8JHTa@@R,I? T"Ѡ`'!-LB'`@T@81Ha@@RI`@{I`@G[BSAcCkD+@{ƨ{@SB@sF@?!R`EkBRܣ`ESA{¨D_{S@[@`?ր֚F!REUPBTRRj6  !'+?BR^ 6EC@@@?EC[BSA@{Ĩ_{S*[@4 @`?A|@@?3F!REB~R. 6EC@@@?EC[BSA@{Ĩ_{[֚FS.L@`@c @SA[B{è!F.L R.L[BSA{è_{FS.L` @SA@{è!F.L"RҠ.L@SA{è_{[FS.yL``@c@`?@TE!RARE2C !F.L'.}L[BSA{è_{!R sF`ExA`EX`EV`Ea-?|C`EP`E @{¨L{ sF`J`4!F`.WL`. @{¨QL @{¨_{F{_{S*sF`J4`E!RBA*`EBR SA@{è_{ sF!E`E"@%`E!B`E!R!A`E@A`Ec!#`EB!E@@"@c@TH @{è_{ sF`J@4`E!R@aEa`E @{¨B @{¨_{F{_{S'c [*`l@@s !R`r@@`n@*!`(F`n@G`r@tBR֧4SA[B{è_{`@@S[c*#)s-:@"-9(5F~@}U *F*SA[BcC#@{ŨUSA[BcC#@{Ũ_{ 's `n@``r@!R@`n@H`r@#B`r@Tn @{¨_{R{_{ J )K` @0@ AK`AK @{¨_{SДF"3KEJ  !(> K(Kz A;E.@?!h`T@R R"x@RSAB"x{¨_{[еFS.K``@c@`?@@TE!R @REA!F.K**.K[BSA{è_{FS[*.J`@V4c @SA[B@{Ĩb@~SA[B@{Ĩ!F.J{***.J[BSA@{Ĩ_ R"R{[еFS*J@4Q*E!R?**EJA*3[B*SA@{Ĩ_{  ! A;E.@? h`T a !@7 ` @tA$T @{¨pT @{¨_{  ! YB;E. ?c @_h `` @tA$T @{¨NT @{¨_{A;E.@?{ h`{ J`7`@!RC?a @`@!a @R @{¨_{SеF!R@-?@s@@T@@ s@IlF!)@@SA{è_BE{C@CA!E 4@"@!T @{¨@"@@TF{¨_{B;[E.`?Bh`SеF!RS@@>s&@`F@`Ts@vB@@1@T@tBp@.m` @Ÿ R@h@RSA[B{è_{!RSsF`2C>ajG`2C?|qTU@b!!ajT4N@RSA{¨_{qS@sF[s!Rs`@>dBaBkcDZkTd$Rc`@(@kSA*[B@{Ĩ_ЄF#R@{|@BES!tsF@@ Ra `!Ru@V`E1@T"9EsE@s5_,qTB|@!#RE@@B@TESA@{Ĩ_{S*dE*t@tSA{¨_{S*QqHTДF3`ȁB5B`5*RSA@{è_@RBE{CRA@ҡS!@*@4@ 4D! @F!E@"@c@TE{¨_{S*@``@ `@4R` @4RA;E.@? h`@TJ}5R q0 ! !RSA{¨_R!R{!RS*sF`.@= qTT4RR+R R+R@R+qITQq T9!RR+!R*+*!R+R,`.#b"a @d@@ @`@ %Eeq!Tc`.#a`"d`@c@7cBcVcj @TT^`.@>*SA{Ǩ_{!RSДF[BE.@C@C=cb.db @@c@@9E5"4E5/E 4"*E5%E@4cb.Ced@c@҂ @`@$c@@`@%cE 5" E5E5D@5BD5D4BD`5ғDsqs s ss" Ҁ.@v>E@@B@TjD[BSA@{Ѩ_{ sF`.@ @{¨]!R<]`.@ @{¨W>{UF{_{BES[C@@?C)RS* Q1``QR+R+ R}+@a!@E?@@B@TDSA[B{Ȩ_{ES[#@78*K@4@`;.@#@`T 1a "R` b?|B`u @;Q~~E7@@B@TCSA[B@{Ǩ_E{@c*E@@B@TC{¨_{!ES# @7ҷ!@{3K@4`@3R!E7@"@c@TCSA{Ǩ_cE{e@c#)E@@B@TC{Ĩ_{ES[c@?Ҫ)[@4@`#z46a B1?|#RBc`b ~~E?@@B@TPCSA[B@{Ȩ_cE{a@$R#?|c7*E@@B@T2C{Ĩ_cE{e@c*E@@B@TC{Ĩ_BE{C@Ұ*E@@B@TC{¨_{!ES[c @7Ew7@@!TSA[BcC{Ǩ&tR)@xC1=P@;P@9P@7P@5P{0w0@@sq0sal0Rb~*`@` @`@``@ @ !*7@@@TBSA[BcC{Ǩ_{!ES& @/@4sR(`@O60Rb)`@  !*׵sR(`@OR)E/@@B@TwBSA@{ƨ_{!ES& @/@4sRx(`@O/Rb)`@  !*sRc(`@OR)E/@@B@T=BSA@{ƨ_{!ES&s @/@4R>(`@}O/Rbt)`@ @ !*cR*(`@iORd)E/@@B@TBSA@{ƨ_cF{BESt@[@@7T5(w&s`@?O+`4 &s`@5O+``@T.OR))E7@@B@TA[B*SA@{Ǩ_{BF!ES[ck@C"@?  ! +8|Ӏjx`9zEҠ@v|hvasCRs'iT&:s@oGa| O@BoG_`TB?9C`R?3oR(RE?@@B@TnA[B*SAcCkD{Ȩ_cF{BEcCD@ !@,c!E@"@c@TIA{Ĩ_{FS.@ @` @@` SA{è_!R9@` @` SA.@@{è.;{FS.@ `@` @@ SA{è_!Rz9`@` @ SA.@@{è;{SFJ4b@!REBT@_}S8NӂSs ^9EP@`ESA{¨:SA{¨_{A!@;  l@a@!1@TacF@/dF@bc@ (B@ @{¨_{!!@;  Ҩl a@!1@TacF@/dF@bc@ (B @{¨_{l` {_!F{  @@ `!`-Ryk`2@a2f @{¨_{C;ST@[}s:N@ӓE.?֡B vh`?Ts} 1R|PS3@RB3X[BSA{è_{A;E.@?{ h`$ T T(TlF!/@TD!`.@_{Sc`A[ks3T @8qT@@>7!A eF @{¨_{S@[ck TA?KT?TbS? TsbS?JTs˗AҕB@mTuK 7ГЕ˵ sxbex"BT6@aT%8@"Ѓ Ђs҅xbex"B_TTAaR.RSA[BcCkD{Ũ_{S_T#@0=4`@JnB4ka@7!aabdaTwY`5FSA@{è_{SJ 5B*a@7!aRah48R7>7@t::T&T1:Rbah58(:t":R]>˃Rcj;8RT>RM>_8qaTX5z4` @*!1@9`8=d 9EEG@@B@T;SA[BcCkDsE{ɨ_{cES[ckG'm3`@?ҁ@9@9zaa6qT@9z`79RRE, @` ~ j!TuD@ 4;@R@T`@9qAzT-, j@`!TtD@ 4;@T@8~n?q`@9!x!?(qTx(qT(A`s /@9qAzTq~n`n@9cxc(qT //a@9`@9zaa6s4qT`@9sz`7sT@@?@ mD!1@!E?@"@c@T;SA[BcCkD'Em3@{Ȩ_{S[ Rc#l<`#@cCSA[B{Ũ֠\SA[BcC#@{ŨR&@9f4|qTQ$q)TF8|qTQ$qHT @8|qT?ATa9?N^ K^D!2@[BSAcC#@{Ũ_{SD! 3@қ`RSA{¨_{S[ckD!3@ !D!4@/@*** paRS@X)HLSA[BcCkD{Ũ_{k+@ S**[**cOaRT)L )SA[BcCkD{Ũ_{S**[**c#2R T)L)SA[BcC#@{Ũ_{SD! 5@*`!RSA{¨_{ T@ +[`V Op` R @{¨_{!R[֚FS@E2@&@3@@`A9 qaTs@`@.4 @!R02@@3RSA[B{è_{S**qT^B3 A@AD*!5@%tA%R! R'hc8 cj@T*<!TkT"*C%hd8&Be B B*"h$8<T@SA!{¨RSA{¨_{S_T`@K*1T C 6D5's`@;*1Tr*`5D*!`6@*׸5khTrTR r3j TD!6@pav*`5FSA{¨_{B@"A=NN =Mq!F{ _{S[_ T`@*1T c75>ru@*1aTr@(E?TD!8@,)*5rTR r3jTD!6@svq)TD*!8@ @KTD>@!9@;qT^4@ D*!5@5V@$R R&h`8 j@Tc*(!TkT"*C hd8b&B` B B*"h$8(T@R@?aTR5FSA[B{è_{cES[k @s7@O!~N[sssB?5R?T@xw`@T@@ 6` @ T`@}rqT`|``$7`xq`TqAT`@}q 7`|@?# TD!:@ӟ\j 8R0` @T`@}q fqQJzIT`@}*q`@ҹ}|@q`@}|`q``@Ү}|@q`"@}|`q**ȏ 7~@?7mTjs85@xs`@T@7D!9@* 6QqT*q`TR[7@{7 0R[0!EO@"@c@T7SA[BcCkDsE{ʨ_{Sst@+`@ҟTc@cxbc@#x"BSA{¨_{S@SA{¨b@@@!@"}B ?Te@hbh" tSA{¨_{S@[*c8S?rT?r@q@siT=~XTD!`:@q@MTEqAT~?T%@9B@E!%_8E@%_8E%_8E~! aiThb8#x"B q!Tӄ}?T @/`<!aT$@x"D~]5U4z6SA[BcC{Ĩ_?A@KT{a3R `>{_#Ry{SqT_T@KX@~tc?T$@9B Dx!$_8Dx$_8Dx$_8Dxab! "~!BB b!}! Di TDhc8$x#xc*_TSA@{è@~X@ qTB}tb?T @/`<Ac!"}!CBb!|!_"TC$@x#D~tc?T$@9B@D!$_8D@$_8D$_8Dab! _#~!Bcs!|!cTcjb8#x"BSA@{è_{@S$@S[Sc#k T@9@TccPxSs TrTr@rT r!66@k`T**IZ9 qTs4 qTq TR RXe3Ts  RfҟkTY[BSAcC#@{Ũ_{S@[N7@K 7[BSA{ètSA[B{è_{S@[*17@.`7*@[BSA{Ĩw^SA [B@{Ĩ_{S0@qT R2)Su @@6`@7``[ @Ra@7!a7!aa[RSA@{è_ޫ{ aR`Ż@B@BT@B6 !R`{ {_{S[asFa@ _1@T so?TSA[B@{Ĩ@35~Q* *e` @Sq(T4ra`!a@|T@BC8@@_C8_C8_C8˂><_|DB~!IT@D@ 8RkHT4ra`!a@|T<(a@˂><_|DB}!T@D@ $x4ra``@C3[BSA@{Ĩ_@@@A@{S**5*s4FK!4@APa!1@TAP!*SA{¨w FSA{¨_q {S@T@7 $R``@u @r!TSqTqR!RRzd`@rTr@c@rTrba!a@cBb|2@SA{è_Q{?S[5_ckZ+ASA[BcCkD+@{ƨQ@"_T!_ TGa!;@@*?r!T!S?qT?qRaRRk@"!d`#@;S?rT?r@?T**0; T @**'; @RJ[BSAcCkD+@{ƨ_{S0dmRy@7!сaIZTsRz`' @TSA@{è4Q@SrTr!@*lqRBzTqaT 9qaT y *RrSA@{è_{cES[Rcd@'GE_T@c@`;C"Һ55x@6aTqmBтYT @G@LT@t5'@@!TSA[BcC{ŨP'@@TcCaSA[B{Ũ'@@@T3SA[BcC{Ũ_{cES[Rcd@'GE_T@rc@`;C"Y55x@6aTmBтYT @G@LT@5'@@!TSA[BcC{ŨhP'@@TcCbSA[B{Ũ'@@@TM3SA[BcC{Ũ_{cES[Rcd@'GE_T@c@`;C"5:.x@6aTl@BтYT @G@LT@5'@@TSA[BcC{ŨPb@a'@@!@@ !TSA[BBcC{Ũ/'@@@T2SA[BcC{Ũ_{S[vAcE#E@/T/@@ҁTSAR[BcC#@{ƨ_bu @˵ aҁ~CbB@ jwj7RaA9`A9j7v/@@@T2SA[BRcC#@{ƨ{cES[b@ETLT  `&#T5&@@4`A9@5D! @`A94D!@y7@@ҁT[BSA{Ĩ}@@@TW2SA[B{Ĩ_@aaM{"@SBT@B7BB-!@`;$R/1T 4c @ @SAb{¨SA{¨1OSA{¨_{BES!8C@n4@Rt @`@1@T`ٜE@@B@T1SA{è_{BE[@S7SC@'G?rT?r@@AU)TG!`<@Mc~St[*?G@^a @~u ?rT?r@!S?qT?qTB|b?T$@cd8!@$@_d8$_d8$_d8Ac>!<_"|!DB b!~! _T@D@ 8B|b?T <(a`Ac>!<"|!DBb!}!_T@D@ $x/ UE'@@B@Ti1[BSA@{Ũ_! :k!p1h@?r`T!R!@)`@AZN!>Z{  @T R@AT@6%`8S DaB @! <@XR @{¨_{  @TBFT R@AT@6`8S DaB @!<@4R @{¨_{BE !8C@l`5@`@sE?q!FsT`@1@T`E@@B@T0 @{è_{BES!8C@_l`5@@5K@sE  @q!TF" R?jssEPT`@1@T`E_@@B@T0SA{̨_{BES!8C@Wl`5@z@@5;@sE! F?@qssET`@1@T`EW@@B@Tw0SA{˨_{aBES!@=C@'el`5)#@D@@?B?T 2@4!E @1@T !E !F @1@T !FSSE'@@B@T20SA{Ũ_?qT?qRBRL{S[5R_M2j97V@4`@7``V@R2[BSA{è_{cES[b@ETlT#ҷ5<@`4`A9@5D! @P`A94D!@GaAˀ@mTb2@_q!TTa@a`7`Ab@@ҁT[BSAR{Ĩ@@!@T/SA[B{Ĩ_{A95D! @A94D!@ 0@?qaT{b{RA@B@d{_{S<@"RCdbF@b @bF@1T b!F$!6@7!сa]U4 @a@? TGa!`=@:b2@`@_qTaA?T?T`\U`5aAuTu>4 7bA_Tc @BRB~`1a Ad@R!@ @`6 рUUSA@{è_{S U*a@7!aT*SA{¨_{S`7@!ET @g!` ` T!_S@7 @S@ 77BтbS@a!`>"HS`7@S@@77BтbS` S@67BтS 7BтbSJ.!E7@"@c@T-SA@{Ǩ_#@B4FT{S ! [v @R1aT(T sb" azu*7TR1aT T !R1Z a!>R1aTeSA[B@{Ĩ_{[!ESC @ckY@s#@g7g?TF~{CFO7 @  @T!R*e7@# #7G@`@7!ASČ"6ySwSZG@@7!A S0"6?@fSdSG?@"6ZSC@XS;C@FT@T@@6 ! K4} `> ?@9SC@7SSR*a@7!aaR7? Ta!>b5R6I.-!Eg@"@c@T,SA[BcCkDsE{ͨ_{[ES@c@#@G.Cf @$Rc @B9BB?Ra@6 7!a! {R^7!aatRRs 7 " Ҡ @TTz@`~9h`D@a@!?w>BQ68.JeR"@77B"bARRs 7bxsQR"@67B"b-R7B"b&Rs!Rs7ZI,!EG@"@c@T ,SA[BcC#@{ɨ_{cES[cW`@?e R79xATazv*61Tc,"I`5!!TQ*1`T1ZQ*@7р`QE?@@B@T+[B*SAcC{Ȩ_$@LqT{SPqTHqTSA@{è7sF`@aBb!@@3aڋ!@@b 3@7!сaQQ*a@!7!aQ !@BuDa!@@*SA{è_{SAR@j !F$R!@#!@@Ia`!P1T`@ 7`` iQb@1Tb7BbDQ=7Bbb=Q@qT@)qTqTqTDa!@@$bAbA bAP1T !,"ҏP1T@"RX1 T@SAa{è!PSA@{è_{S @[QckshqȚT*A!:!X`x`! ր @qTuwRuеWRkT @<@?T ! OP1`T @@?T@ҁzx*1T T8P1AT@Q0qTA!;!H`8`! uRbwRCuRwR>uRwR9uRwR4uR7R/uR7R*uR>R%uR"R uRBRuRbwRu8RRDa!`@[uR"WRuеBRWRk T@ e1ATI ! O1aTAO1`T@RB O1AT3 @ qTTq Tq`TqTDa!@! ЗR UЗRBuЗR B%Rk TO1AT  ! O1aT @*1`Tk #T_qT@@  ! O1TA!4!@`@`A!4!hO1zT@@`@Ҡ@`@Ҡ@`@:_T|{#{C>jT@ Axa~1@vT@!Axas1tT4O1tT@ "Raxa1sTy?TT ! O1TO1T @@ R @@!@a 4 !`.O1ATo ! N1ATg @aR+1aT^@@Y@a7@?TҠ4@ Axa1@iT?mT ! N1T=@ xa:a!@>N1@fT"RG1T+@@AA!5N1cT @5 4a!@N1AT ! N1AT @1AT_qT @BR1_Ta!`N1^T@BR 1 ^Ta!~N1@]T@"R1\TqZTR ! mN1Ta!eN1 ZT @`@? TxVC֢5Ҁ@ xw"R1WTLN1WT @"R!xw1 VT?MT ! ;N1!T4N1TT @Ra!*N1RT@ @ T " ҃@ "Raxa1PT TN1T|a!N1`NT@"R1MT @1?Tga!M1LT@"Ru1@KT @1!TTa!M1IT@"Rb1HTA!5M1HT @"RU1@GT@1FTa!@a!a!M1!T!a!M1@CT@"R/1T_<q Ta!@M1AT  ! M1AT@R1`?T>qT_qT^Aw  ! M1T@@R1`<Tut9C"_T {zqT T qTTq`TqTqa`!@`!#$qT Tqa`!!(qTDa!`@Aa!  a!a!A!5M1 4TBR!xz1@3TZqT@R11T @`@ҁ@a5@ҿ AT@ @0q!T[BSAcCkDsE{ƨ ! M1aTn ! L1,T,T # ҃ @ "Raxau1@+T TL1TPTҡ ! L1(T@ xa@(a!@L1@'T@"RO1&TT !@F?TA! @A@SA[BcCkDsE{ƨKM1T@SAR[BcCkDsE{ƨ[BcCSAkDsE{ƨ@R1T@PqT@`BF@#@!!@?!!!@?wL1`T @L@R1`Ta!hL1T @R1A T !`.ZL1T@R1Z@! ,JL1T"R1T @@"R1!T,2L1T@"R1Z@SA[BcCkDsE{ƨLa!L1T@ @T " ҃@ "Raxa1T TL1Tm!! @`@!;SA[BcCkDsE{ƨK4 ! K1 T-T # ҃@ "Raxa_1TmTK1T:LTVTa!>K1T-5@RA1AT% ! K1aTa!K1T @R+1T֥4 !K1ZDa!@ҿT/L1Ta!@>K1TSA[BcCkDsE{ƨ_{BES[*@@7_A; R9E.@? h` @/bAk``&R`W& +*1TC!E7@"@c@T%SA[B{Ǩ_ց {Scxcky9:@[+*TBa!uxv@q!$K1T@R1 TA!K1@T@BR1T @@TK* BR?1`T @!xc1TRSA[BcCkD+@{ƨ_R_{S ! J1`T@"Rb1T @1T SA!{¨JSA{¨_{S!@fK1aT`@A!5J1Ta@"R81ZRSA{¨_{S[6G(a@*?kT`ATc@`@a@"S?rT?racc A1T!c@_qT_qT`#`҂Tja8x!x!`҂Tja8x!!a@R!aSA[B{è_ЄE{S[+7@oGCF@A_!1@TAOR` = `]A@7C7@C@?T#@9$7pqT7Bj`T@khTW@O*+l 6G@OB T$@9!7q@TTqTW@c@@Fc@kHTE*c Rc cRRT%@9lSQ)?%qTQ Q)?qT\Q Q)?qhTQ !q"RT7kT@k#TW@*c@@Dc*k6+47 c47cc7@c@(  C bc#B@ Kg]@4?@J;@JdA$?@J;@J!Eo@"@c@T${BSC[D+@_(E{S[ck;@ _?TTRPy@?q?ןj@T@yߟR_kTbST@yߟR_kTSTR_kTSAT;ass 8R,R_kT"RbSTs9Rs RTsRs 8RTF@A_!1@TA?qTs8Rs ss @!{OR! @ =w@vu" 7(@1Tb@?qg@ןs@EџqATc@*@r*@ Tb T@ T hd8hh8!!*) ?qTc?q TBThd8hh8 *D q T$$SB$*S@@sj &7IA?T_?q T? AT+P)`'pca8k8i8g8  T?aT!HT.?qTa8@T hd8hh8!!*) ?qT?qTa8CT_?q T?AT+P)`'pca8k8i8g8  T?aT!HcTRcSsq T**ccA?qTSsTSsSs@T hh8ha8$!* ?q)Td$xT'_?qLTTg` T  THӄxThh8ha8A *" _q(T!$$S*S@@sdcScAsV**bT@T T_?qT? T? T H!x!,<'|S$`!pl)d)c@Thh8hi8 * qiTaqTThi8 hh8 !* ?qT$S$*a@@dRAR!RaRcScBs?q T?qT?qT? qT S@_T_@IS@ S_@ c%IS@c_@ c`  S@_@ # cC c4 S@_@`K@HG@He?"K@HG@H!E@"@c@T"{BSC[DcEkF;@_E{S[c3@wW? T TRHu@q$CT@ߟR_kTbKT@ߟR_kTKaT_@1!TKTssB (_@1aT"RbK@Ts5Rs `TsRsB TF@A_!1@TAqTssB ss ˀ! sOR! =ox 3>1!T}kTk( T*i7K@K[@@r!TSqTqRRRH  lTK@$H TW@cc ):_@(k@@qlTK@@kTqTg qiTGK)TqTGKHTK@@cZkiTg q(T` kqhTK@cW@c  K@W@ Cc # R4 W@ˈC@G?@GU>!C@G?@G!Ew@"@c@T!{BSC[DcE3@_{C@ E@/`T@`7"!@B- D@ORS`` =K1TR!>!E/@*c@T @{ƨ_@i{ # @{¨_@^{S#t SA{¨_{@;S* [**c*` **w v"YG1T**RG`@7``FRSA[BcC{Ĩ_{"@@T@ 7DAB @!` @@7``a@!1@Tab @L @{¨_{CS?47b@c@a&@@5!Q`a@|{AҦ@`CCc@b@e"@a&8tCR{ASB@_{S!E[V&"@O}RA# z3'CqaT77G**CEO@@B@T[B*SA@{ʨ_{SE[v@@A T`*@ut@7`@@6D !@X="@5DA! @O4@i@9x?q@TqTDA!`@>#@b*@AR @_jTwWT@`[bR6EC  @}/`a@?`T;Cv@E@@B@TSA[B{Ĩ_{SE[6c@ck+@7` @9d*@"Ta&@?`TT1ҵ"@R!u@u @{@\GaTc@Bz# @`"@BtZ`@`*t@DGaT@!E7@"@c@T>SA[BcCkD+@{Ǩ_{S@cRXZ"@}sShas_h!Z6`@@7!AEBSA{¨_{S@` V Tka"@ x`SA{¨_{A;[E.@? h`"S@2@!R0 @Hȳ@`Ȁ @AJ@TN@xs@%!RDK@"R?J@?TN@vB֢}d_ J@RB}8!^ N@x3SA[B@{Ĩ_{S@raTR @SA{¨=T`@@T`@T" @_!TSA{¨O RSA{¨_{  @{¨] @{¨_{ s @{¨ @{¨_{ScSA{¨DSA{¨_{ Q @{¨" @N^ @{¨_{ A @{¨E @{¨_{[@Sڜ 0`@!T@7@7!AD  D!F!j 5@`.@`'D`@7``CSA[B{è_{ @SSA@@{è ҄ Uڜ@@!T@7@7!ACʜ ÜrD!F!sj5@ٿ@@@ӿ\D`@7``CSA@{è_{A; E.@? h`Ra@@>` @{¨_{A; E.@? h`"Ra@@>` @{¨_{SiSA{¨gGSA{¨_{S@`@a @T"@R!}K` `@!@! |oa@7!aSA{¨?CSA{¨_@!@?TAÚ"F 3_@@-G@+G@ @!@ @\@"BB }a@  @@@@ @#@@T!@!T@!H6A {L`{4sҀ{ {{@B@@!!@!F q@"@@b!<@i@!@@@ d@@@@ _@@!@B@ @ W @@TSD{A@!8{_@@emS@kS@dhSA;{E.@? h`{@(@XXF؊{X{k*1aT*V*{*mX{_{v|@{dX{l|@{^X{^|@{XX{]B RR@@! @{¨|@HX{MB@} A;{E.@? h`@@1aTU{`|@1X{_$@?1T{T7{|@$XF{_ |@XA;{E.@? h`{@AXA;{E.@? h`@1aTU{`|@X{_{s|@{W{S_T@*1T @Cp5(U@(E@?TDA!8@!*u5V@"RS eha8D !j@T*?(!TzUSA|@{¨WSA{¨_{ *1aTgU *O5C;E. ?$Rғ R`h`@tA hb8 Bj@T!*_<!TLU @ |@{¨W @{¨_@W(@7 @!@a7\WD{ @!{_ @@@!A`6nW|lW(@5{ @x7{|@aWF{_`7|@ZWF_UW@1`T|@PWF_{S_T`@@!T@A7" B-!1@@ @C@+p5 t@@!T@a7" @B-!<@.`)>|@W>>SA{¨_{ RqT{|@WF{_A;{E.@? h`{@ЃV{*1aTT B;E. ?֡!FBh` @A@?TlFA!`@u C#{|@V{_F)!`SlS!|@ V{@SRa@7!a@SA{¨_{cES[*BQd@_qT!FV4V*4 @ @?)@F?!TT?T ,7@5 @?!T3RU4 @ *;@7!@ qjTqsRjTsFsDsEE@@B@Ty[BSA{Ĩ_@{_ES@ҳsET@i@5;@C*o53@\4B`{$T@TGA!@ #|`@tcLT!,x\lB@!TS@@a@ATSA{Ĩ>@b@!!TSA{Ĩ/D@a@@T SA{Ĩ_{*1aTS{` tP{_{*1aTS{`,@P{_{ E'a@?aT`@ @{¨PBE{C@C!E4 @@L@31!T@"@T{¨U@"@cT{¨P@"@@T{¨_{BFS[ckaTR9!xG!@U`5P`,f*a@7!aa? `*@VW;@Tb*@E.`?j`B Z @q*b5"@A$@!A$ 6[B*SAcCkD{Ũ_{SZP R@f*a@7!aam?1TqSA{¨_֢BE{C@C[!E4 @@`@L31!T@"@!T{¨U@"@c!T{¨*!P@"@@T6{¨_{RE@@҄P@9"R@@C #9:1!E@"@c@T{è_@B!C?!#aT{R{R{_R{[c @SCҖ _T@@BX 1fRbTzvX 1fT+B@ ѡ7`>a@8 ѡ7``>`@7``>[BSAcC{Ĩ_!@#h@#{F@[paT:R{[R{_VR{ABE !`C@T 4@#DA!@x7:1!TDA@!@@1TlFA!@$R!E@"@c@Tg @{è_ @@RF_{ A95D ! @$@T@%7DA @!`@lA94D !@ 3@T @{¨Q` @{¨_{S[B_T@H@C"l5c!]@6aTQ` BѢ>TA95D ! @xHA9R@4D !@n>@*1T~QA94A94A9@4A9@5q)TD*A!@$`@z!TDA!@qd@TDA!@@?qaT@qAT@[B@SA{ĨlQSA[B@{Ĩ_{_SE[b@@еETLT @#fl56@@4`A9@5D ! @(`A94D !@~4DA! @`@*T77t@@aT[BSA{ĨQ@@@TYSA[B{Ĩ_{A95D ! @~ A94D !@~{ @P{_{@?q TD ! @~ @4D!%@~{ @P{_{ @5`@ @{¨P @{¨_O{BESA@G"R```=6`6 B !@` aR>p`5 B!@` @5A'@˿mT @@!!@!P#@`7EG@@B@T@SA{ɨ_{S[B_T@F@C"vk5R[@6aT-P@ Bт<-T@]*1TP`8R @N5@z!TDA!@)qT@TGA!`=@} qT@lTs 44D*A!@ @`SA[B{ĨPSA[B@{Ĩ_@P @@OF_{[@c@k@+ @S`BR$T@@c1@T7*@ ѡ7`)<7`@TlF!!`@}T{ASA[BcCkD+@{ƨOSA[BcCkD+@{ƨ_A;{E.@? h`{@OA;{E.@? h`@`l@?T@caTqO{O{_#@aT{dO{O{_O{|aTTO{uO{_@pO @@!@ hO@ @`S!064@@1@@D@5@@`%@@aB @@cB `d@@cB `A@rTA!T ATC@TA@!.O{SR4`?aTNSA{¨OSA{¨_@A@?T@ |A@ O{S[` @BRJTzs06qmT!TsSA[B@{ĨNSA[B@{Ĩ_@ @! @_aT@N(@7 @!@a7$@ND{ @!|{_{J@%@ b @{N{J{NA!@ПҰN{[cS @T@xu`T`@1@T`BR5b@*7Bbb:qmT!T[BSAcC{ĨNSA[BcC{Ĩ_ @@L@$Q vN$@L@$Q pN4@@TlNG{!@!(|{_ @@!@ YN @@!@ PPN @NN{[@ScC#ҁKK@@7р`:bs~`~Ӏbڰ װRSA[BcC#@{Ũ_{ _T`@ @{¨&@C"i5 @{¨_{ _T`@ @{¨O@C i5 @{¨_{ _T`@ @{¨@Ch5 @{¨_D RRR{ _T`@ @{¨@C h5 @{¨_{ _T`@ @{¨Ha@C@h5 @{¨_D"R`#R#{ _T`@ @{¨@Ch5 @{¨_DRR { _T`@ @{¨@Ch5 @{¨_DR R{ _T`@ @{¨@C {h5 @{¨_DR`Rո{ _T`@ @{¨@Cah5 @{¨_{ _T`@ @{¨@CLh5 @{¨_{RRS[Ǹ!DT@d@@4@v4@7!Ah9u&@` @[BSA{è6 @[BSA{è`@B@BSA[B{èDSA[B{è_{ _T`@ @{¨@Ch5 @{¨_{ _T`@ @{¨N@Cg5 @{¨_{!GO@4@!GO@4@{0{ _T`@ @{¨!%@C g5 @{¨_{ _T`@ @{¨t~@C@g5 @{¨_{ _T`@ @{¨o@C`g5 @{¨_{S@[!@@V@6` @ T!D@5@A!ƜR`@ aT*L`@XT#L4R8[B*SA@{Ĩ_C"Rc`g{ _T`@ @{¨@CCg5 @{¨_{ _T`@ @{¨@C.g5 @{¨_{ _T`@ @{¨@Cg5 @{¨_{ _T`@ @{¨ C@*g5 @{¨_{RS@[֚F"331T/*` @_q!T3a@*R2 "R2*`@R21A:Tq@zTa @a@ߙ@"3BR2*R88[B*SA{è_{ _T`@ @{¨@Cf5 @{¨_{S@T@{K` @` SA{¨lKSA{¨_{RS@F"32q!T`Ad`@3?@@7р`7 `@au @t @7!A7SA@{è_{ _T`@ @{¨`@C Ef5 @{¨_{R[FS"3P2q+TAT`@RI2qKTTt@"3a@9 ` @@7!aO7`@@@7Ѡ`B7`@at @u @7!A67@6Fр`,7SA[B{è_{RFS"311TqT@̅'`@1@T`"3R15@R11!T`@7``6qT`@7``6EA!@@\x a@7!aa6@SA{è_{SJa@7!aa6SA{¨_{ _T`@ @{¨ѱ Cwe5 @{¨_{ _T`@ @{¨@` Cbe5 @{¨_{ _T`@ @{¨ ^ C Me5 @{¨_W@!@?TAÚ"|F 3_{S!E@"@b @CACT?`Ta c@@Z`E!! @wW+TATc c @`@?kBTW @ @@AT*?Ta@ Tb@c@x@K` @@!@@?T g6@) "@T@`` @@@T@R` @@TM9@7!сa5s!E@"@c@TSA@{Ĩ_{@cEe@҃T@C6"@BT@6Cj@6 @D!E@"@c@T{¨_{SE[ @cks@G?\T` @\HT@1@T`@1$T`%a+] @ +7р*5S|UCd @Ҙ @ҚCCӜ @Cӟ_T Rf @@~"KCBT8C@7рt5C`@7``k555C@A)RRKK ! Ś Ț! %!T`  @$Tg @B ŚTc b@B Ț' R@T# cc ʚ   LTCl)  )57@7р`5C@@Cӈ6} @T@1T   F FG} `@T_KT`@1@T`}|  E FGbcb9cbbfTj`jj`DĐAt*tj !^^j `fVT~ &g?Thc$ti# t!^^h#c@1@T@1@T@7р`4`@7``444SS֦ڀ@7р`z4`@7``s4՚EG@@BaTSA[BcCkDsE{ɨ/J@7р`W4`@7``P444ҡ!EG@"@c@T;SA[BcCkDsE{ɨ_ƈ{S@Z*@5@lS`4`@7``$4G @@ 7!A4@@! @@@sxb`@1@T`SA{¨_{?S{|S_{S3@aB@T?aTs@,S4RSA@{è_{S)@ 6`@7``3SA{¨_{[@S$A T?lT! Ԛ?TSA[B{èP~S7`@_ TxbB#@C7$}}ӳ$`@1T`[BSA{è_{@BRR@RSSA{¨$a 1SA{¨_{BES!EC@/sI4@#`6@f#@!hT`g aTE/@@B TSA@@{ƨ!`Tng~E. a!T/@@B! T  /@@B!T  SA@{ƨ9U 7@ RksQRKs xG#Rf7ab@@8aCc8#9'9bxabCc8h!88a<T_96KR7bR!`7@T @!0 !,!E/@"@c@T SA@{ƨ_/>@!E_T@!1T@>_@`y>@@av>{BE!EC@'H4@#cz`6@!!E @H4@Ck`6 @@( `!TE!!!@t#@L#@@>!E'@"@c@T {Ũ_{BE!E C@'ҔH4@#9`6@-!E@H4@*`6@@!`!TE!!"@sA`#@}  ` T!`W `W?kT(h/g.=!E'@"@c@TF @{Ũ_{BE!EC@GH4@c`6@!E @8H4@Cݴ`6 @@ `!TE!!@"@s@ `=!E@"@c@T {Ĩ_{BE!EC@ H4@c`6@!E @G4@C`6 @Bm `=!E@"@c@T {Ĩ_{BE!EC@G4@c}`6@!E @G4@Cn`6 @Bm 8`Q=!E@"@c@T {Ĩ_{BE!EC@ҦG4@cK`6@!E @G4@C<`6 @Bm (`=!E@"@c@Tr {Ĩ_{cESb@҂BGcTT@9Cxcc6BG!?T#@9CxcC7@ TD!!"@i~ aaTD`E@@BaTSA{è<E@@B@T- SA{è_{cE@ d@/#c@#4; T;@?1!TG!!$@rb<!E/@"@c@T @{ƨ_{~c~"@b aaTD`{<{_{ck@SE[s3@G T@-6@@T@,6 @S @@C`@sC)E!!(@=r&ATT T@@_@k@TN `T@T aTA@_AkTT T4_+T)@@_@kT@_@kTBB/_T _ T :gc @ca{uc@(`A :gsZc @cs!b@{sca(aaw`w`w`w_jT @ R҅@@ڿ K!K|@!BB!_T_ T_BY?lTҜ˗ ֚`YA` ~R`? c?@B`{a ĚtCx!^!*T R`;֚9A`cc `9q!RRןjT{{{q~ @T@CsB@bRs~sT xs|bš x3iqG@7!сa/s|C@@@B@_7!A/ @R@ҁ!BCӵ*C$R E@ڿK|@s?!!Q jT`R Qj@T    : g@@cTc `xcc((h@7р`/ TA`*k Tn*e hT"N)k@T@aEG@@BT&N)/kҀE!g aG@@B!TSA[BcCkDsE3@{ɨ;G!!$@pD!EG@"@c@Th SA[BcCkDsE3@{ɨ_{ѱ~ aaTB`{:{_{cES*BQd@/_qTsDR!Gx4Tjx8`Tc=&ˀjД>G!EW@"@c@T[SA[BcCkD{˨_{S_TT@  '#Z5SA@{è_ց!FSA"R@{è{S_TT@ 6#Y5SA@{è_ց!FSAR@{èg{S_TT@ 7#Y5SA@{è_ց!FSABR@{èFO{BES[A@GR```=$5aR*^`5b С B!@;{ @u@>G'@@KTˀ*5#@`%EG@@B@T[BSA{ɨ_O{BES[A@GR```=O$5aR]`5b  B!@0 @u@>G'@@KT5sn#@`9%EG@@B@Ta[BSA{ɨ_@a@G D!!)@0j`@4ˁƘ`7F!E@"@c@TSA[B{Ĩ_{BESA@Z`5t @7@TG!!`*@i7` @``@ @ @1@T @@a c 48SA{¨_{S @,@#@1@T@t 1@Tu8@SA{è_{"c@<Sa [P>@,@ T@@?Ta @?!T-5C-@ @@` @`@1@T@ @t`7SA{¨_{eASBEA@Ң@!@-B@<4@@6@T^`@`@6 !! &`&E@@B@TSA{Ĩ_{"!@<S!/@=@@d@` @`@1@T@ @t`X7SA{¨_{eASBEA@Ң@!@-B@;4@@6@T%`@`@6 !!%`%E@@B@TSA{Ĩ_{S @1@Tcbt uR @R9t@SA{è_֡!@; ! !!@; A!!@; $!'!@; ! ! @ @@;$!'B @@;A !B @{!@7S ;@ RtCSA{¨_{ @bjaC@c1@TCh!! ?@T @{¨_{@;` |6 @{¨_B;{E. ?@h`ҁ@C@ha @4s_Q@h!a@aEo~* @{¨_{ `@1@T`  @{¨_ @@!E_aT @D{@!~@u88@`@7`` #a@ x6jv8QqT[BSA{è_!@!h@{SV*@Ta@_T @#@x"c1B@T#!@SA{¨_{ҁ!ES"@7+c / sFaJ 4FGcЁ!(Gc`XF}+``E!R'`EV`E##@`E!RuEY  !`/V4$`E''@`a!F`.#@a!V4`. '@!-V*`.42/@@/7!A"+@@#@@'@@/@a!E7@"@c@TpSA@{Ǩ_ւ{S@q7@SA{èn`@q6SA@{è_{S@tq7@SA{è`@iq6SA@{è_{a!ES @'Ҕ@T@7@ R3# @T@6 @3 !" +]@4#@@@1@T@`@h*J!`E'@@B@T@SA{Ũ_{SG@@?@`@7``!@!1@TLSA@{è_{!c@<Sa 9@D@ T@a@?T @?!T`0ׁ5 C`0P4ASA@{èSA@{è_{!c@<Sa e9@$@ T@a@?T @?!T05 C0QP4ASA@{èSA@{è_{ XG @{¨1 @{¨_{SGG@@?@`@7``X!@!1@TLSA@{è_{!c@<Sa 9@ @ T@a@?T @?!T0H5 C0O4ASA@{èSA@{è_{!c@<Sa 8@H@ T@a@?T @?!T15 C1O4ASA@{èSA@{è_{!c@<Sa 8@4@ T@@?Ta @?AT@15#@1O 4`@F@@? `@7`` |SA@{è_{!c@<Sa l8@@T@a@?@TF@SA{è01@5SA@{è_{!c@<Sa E8@@ T@@?Ta @?AT15.#10O 4`@FFq  `@7`X @@?`@7``K @`7рD P(SA@{è_{!c@@\@` @qT` @@?PqaT@a!E@`Ta!FTa!4bAh5@D !@IQ@F?T@D !`@=Q @{¨g @{¨_{ @E4`@1@T` @{¨_{CcE  T@`@_Ta @?T  o5 #[>4a@[h5@D !@P @{¨ @{¨_{@ES @""#=5"o5@A!E@"@c@TSSA{è_O{BBES#[A@OR=5aRB`5" a B!@;h/@uv @_'@BKTˠ5=a@@|F?T`@1T`=+@` @EO@@B@T[BSA@{ʨ_O{BBES#[A@OR=5aR3B`5" a B!@h/@vw @'@UKT65W=a@@|F?T`@1T`H=+@` @EO@@B@T[BSA@{ʨ_{SDЄE[vu @c*CcFk+@_ TL`57@?@q`T Tjt8$`4џ Tjw8B UTa@@|F?`T<<:?qaT A!GTj`8"xbb64CcGB_Tjb8dxdD7 UTb@@|F_T`@1T`BBE_@C@!TSA!cC[BkD+@{̨<@E_@@B@T"[BSAcCkD+@{̨_{S_TT@`  '#<5SA@{è_BBFSA!R@{èR{S_TT@ 6#Ҷ<5SA@{è_BBFSAR@{è1{S_TT@ 7#ҕ<5SA@{è_BBFSAAR@{è@A!|F_T@!1T@7<_{ a @/<b @a @ {¨_{ a @<b @a @{¨_{ a @ <b @aZ @ {¨_{ a @;b @a} @{¨_{ a @;b @a @{¨_{?S3_[ckYaSA[BcCkD{ŨMQzҁ @!!;T* @HT @*`SA[BcCkD{Ũ_BBF{SM$`@E ! @@Da@7!aa SA{¨_BBF#DЄF_T!!ӟTP@xa!xa5@F_@˄c T@D{ @!PN{_@@ % A?T@?!TD@@A c1T$D G;_{S@y5aATjTSA{¨SA{¨_{CcES[b@VETLT   /#V;5@v4@@ҁTSA[B@{Ĩ@@@ToSA[B{Ĩ_{CcES[b@VETLT `#;5@[v4@@ҁTSA[B@{Ĩ@@@T8SA[B{Ĩ_{ @@5  @{¨U @{¨_{CcES[b@VETLT  `&#:5@v`4` @@˜5 @@aT[BSA{Ĩ@@@TSA[B{Ĩ_{@ @?c:` ``@7``  @{¨q @{¨_{SM: b@a @!` @@t 7!A RSA{¨_{S[@@E !@M*b@` @a@c@b @*RB+a@R!a@-T6SA[B{è_{S[c_TT@   -#;:5TSsF @+@5b@@T@@6g*!T @F`T@D B @!@poaAւ @b9y*@1T!7!с0   ѡ7`) WT `@@7` [BSAcC{Ĩ_@ @9!@!Ӕ9 {BBES[cks3@@g@G !/@iL !@@F? T@D !@\L`@X0@q T@D !`@nTQ<q(T"VēB VT_T_T@D !@7L@D ! @n@D !@n@D ! @"LC>*@5@? T@D !@L`@*@"D@_k-TCcD* !`@n#D@/:@`x@w SZ7@~&B~R_@Tv@?kT?1Tࣀ*Aӡz zakjTk€!w@k Tw2kiTCcD* !`@rni`@@O'@1T@ 61|}l !р$: $w@_kkT!{ 3@TR!_j!"` ?R`=RCw@k T*R;g@qAT'**c@9d *;(?@&`8  T'!@9# *0qlTpq,Tq@ TTq@ TqTqAT`}~ &tQ?qTC@AXaxd! dqT TqTLq@Tsq!TcRI bC"#"& c;#;&zc ;#wK}}!k`?aTkZן;k n`}@ &h`} @ & '^bF"&[`} &TbC"&QC6Tb}[~6b}B~_B}B@[П=;kT{C`}@ &0cQRa c  *! |@c+Ú`@|@ &!cQc a+Ú!@! !!&*;*@6{C!qǀZ 4a}!@Q;;&*7@Scs )@ ?)T&$" ᗀ!{a?`T㟀c}"kc_T@KB|5q!BQB B!š_jT!C4?(TA ?T!}!:R!k#5@@7р )`@ B*@@!A<{`w@k- Tzfk T {f!jT!CCrT$ qTqTq`TkT!CBC1T_JT*R11TT TTTq(TqhTqT *BR   ;R ;R  ;RB ;R B;R975a@R"DBH@@D@ J_kT$x`cC4@lEq !-@ B` X@5a@RBBF$D@@H@k-T%xv1"x6ZcC4@@1ATCT;a@_JT#@@ qcQb|@T@E.?" j`D$@4@@@#@D" @$@#@C @*88@Eg@@B@T;SA*[BcCkDsE3@{ͨ_{ f @{¨CCcEO{$@S[T@ck+e@==6 @4 @F?TR5_@g@T@D ! @qIҌ@T@6 @ R57@?@y @l63 @T9#?$Tbj`8dj`8jb8j 8k!Aa@@|F?T`@1@T`@37Ѡ`3@F#@{ Tj`8A{ ToTj`8A{"dv%cT@8~@k`1T 8kB"Bb@@|F_T@7Ѡ`|`@1 T`?T!p3@@EB@B@Ta{@SA[BcCkD+@C_{Shcf@SA{è_{@@S[cSrTr@BTT@R_T*v-$q)Tq)Tq)Tk)TӐR!rkTGRrk嗟$ Ҁ T@G !!@~H cBc "**T=-*s [BSAcC{Ĩ_{@@S[SrTr@BSS@RI*T-qiT k!˄ T@G !!@/Hcb FG RR RR R+?,9 kiT9|SlX\T@LP{@SA[B _{DE @S_@#@9@FbQB@_ qT !B%QT6" !B KT 6`@7``@E@@B@T @{è_ BBE{S4@[6RcksC@W3d@B@G_ 0ZZGR@9.4qaT*8i@9@9A{aa6qTB@9@9C{c6!Q!|@@9?q$@zTBa_@aT?qT@9?q$[zT#RR@9?qT@9?q$[zT$RRK@@9BEK?q TT?qTT?q#T?qT?qT?q T?qT?qT7`.*} "qT`.}34a@?q T@G ! &@D K847`>*} "qT`>}34b@ !`Qh47`>*} "qT`>}34b@ !9*} "qT`>}34b@ !@')47`>*} "qT`>}34b@ !`'7`.*} "qT`.}34b@ !'C7`.*} "qT`.}44@! !`0*z g7`.*} "qT`.}44 @!'7a>*3} "qTa>3}44@Tҁjc84cT7`>*} "qT`>}44@! !A9`qTR9q TRyK*8 A5K*_!!EWA"@c@T]{@SA[BcCkDsE _{))E=C=#='=+=/=3=7="@/'+ )@@3!!E/@"@c@T-{Ҩ_{ @`4 a@` @?Tb@_T @{¨0@?T` @@!1T @TD6`Bek 6 @{¨_{@b@! G !/@mC?BbT!_T@bPna!b0 `IT? ! AdB!b@_T|@7k|R{_{S!!E[@"@GҌ`47`@5Rv7'@U`RA@?T7bA_mT` @BR- @a@mT?! 6 `A@`@tBTt\ EG@@B@TSA[B{ɨ_{`{.{_{[@S5`4(R'`'@ ѡ7``6`@ 7`X`@7``P@ FSA[B{è_{_S E[b@@6ETLT  #/5'@1k`4` @@5`@54 D !'@4e`@kT@@T[BSA{Ĩt@6@@@TSA[B{Ĩ_{$E O@7``='[t E7@@B@T @{Ǩ_{R!RS Rǝ@`R` SA{è_aA?T`@a9!5t@SA{è={#cES*@[*6Sd@'?rT?rs@@ E'@@BATSA[B@{Ũ /T E'@@B!TSA[B@{Ũ}.#`҆ J!(R RRRR_ T*&i4Q?qhTI`84u5?qT 5?qT4dK Ě@Aid8a8x!Q?dqTQ8qT!$ĚA6l8R R8<qT`R$x6Qe?qTI`84u5?qT5?qaT`9(aRa9aRa9 kITR !(@ @ (&@qTQ$Ě!@ha8a8$R *@@qTQ$Ě@@i`88)RB$4R!K ( !@ha8`8i4R`8aFi`7#@!!E'@"@c@TSA[B@{Ũ_{@S!!E#@AT@a70l0@ E@@B!TSA@{ĨG.@4S?rT?r@! T E@@BҁTSA@{ĨF~).`jR$GRrR_J T*%qTQ?xqTpq`T`8LR`$xI$qTR`$xD(qTˍR`$x?4qTKR`$x:!!G Rfy|S @c*@Fif8f8!@ h`8`8,| S ,H D @ kTgyc@ha8`8@hk8`8@hj8`8@hf8`8h \TLP! @@c(il8l8@i`8`8@ha8`8@hk8`8@hj8a8hf8`8Bah7@!!E@"@c@T'SA@{Ĩ_{@S!!E#@AT@a7|k1@4S?rT?rs@@qT E@@Ba TSA@{Ĩ-! T E@@B TSA@{Ĩ~t-`FR%GR rR_T*!%qhT`8,| S,HD @ kTiyc@ha8`8@hh8`8@hg8`8@hf8`8j \TLP! @@c(il8l8@i`8`8@ha8`8@hh8`8@hg8a8hf8`8Bah`7@!!E@"@c@TSA@{Ĩ_{S[*"@@B*!@?"T@ Rb!#5h"8v9a@!a!g`6RSA[B{è_{@B@B_AgqZ{_B;{ E.`?@h`@?lT{|{R'@@v:{ dCn`f@d`fC @{¨_{S[caO^`O F@@s!!F @1@T 4ДF !@) @*7!сa"v47 EJ !)*@7!сa17 DD@l@A!!F @1@T 4ДF !@*@*7!сa6.7 FD !**@7!сa+7 D B !+*@7!сa6)7 E? !+*@7!сa&7 ,F = !,*@7!сa6$7 Fl: !@,t*@7!сa!7 DFX 8 !,`*@7!сax67 @ED5 !,L*@7!сad7 D0 3 ! -8*@7!сaP67 D0 !`-$*@7!сa<7 F . !-*@7!сa(67 F+ !.*@7!сa7 G ) !@.*@7!сa67 G& !.*@7!сa 7 TF $ !@/*@7!сa6 7 F! !/*@7!сa7 F  !0*@7!сa67 E| !0*@7!сa7 !0v@7`@7``A; E.@? h`@2@R`@6A !W*@7!ao7.<`A ! D*@7!a\7 * A !2*@7!aJx7A ! *@7!a887 !1*@7!a&7` !`1*@7!a7  !1*@7!ax7 !2*@7!a87"A !` *@7!a7&` !@2*@7!сa66L``  !2@7`@7``B ! 7`@7` ^[SA[BcC{Ĩ_ !!E{@S[cks#@OAT@a6@wgH@6S?rT?r@o cҁ@RqaT@9 qaT@y@"RRR_T*!Q?kTkT| S|Ska8qaTk!8Za`8?qaTyj 89Bq<R_qR @zLT4^@q*}!*1@*6@697? TW@`7Ѡ !ѡ!a`@7`5cS@oS~@|@ /!!@4!@ @cBzf)xR`7kRg7@5RT*#!kT| S(Gaha8A "|@a8?qaTk"8kb8 u 8 EOA@B@T{@SA[BcCkDsE _!@!T@A6{ B-A !@2NT{_#cE{S[ck`@/Ҷ` 7F7Tzcz@T a @@77@c y @B3}8 +#3/c|@754T3@f@!T@!6*`@6!}!*!9ThTRj48j 8 D@;`@7``> E/B@B@T.{@SA[BcCkD_@!!G_AT,{4R  *Z{_{S[d@! D ! 4@;3a@@4 D ! @t;tb R` @ F/`Zba @ @!`bt `a @H @u@? SA[B@{Ĩ_{bB@;S*@ 8|`RB}Dt u@SA{è_{S`3sFaB@ g1@T 'ssJ@@@74W`t RB}SA{¨_{ @@f @e?JTxaC@c1@TCx!!a@ @{¨_{F@7'E@Sɠ4[ck@/  T&E/@@ҁTSA[BcCkD{ƨ ;**a TV$@ !z`:ZFBC@@g1@T@'@*H@AC@ S7 @H@7@ja@B1@T`j!! ?@T uz6AT@7!a @ 7Ѡ@  g  @@ A 6|@_kA TC+ `qTqTT@ @! _?*Tzab@B1@Tbx!!@!1@T`@!1@T RK+@z`T@1@T@ @@ @c*Tz`A@!1@TAbx v@1@@T@7!!@`@!R@B$+! @T**@7!a E/@@B@Tx[BSAcCkD{ƨ_{'RST$[@s fQ gc*X !!Ek&@?1*j`T&xSat zaz`<`Ta@!7!aF  @@6BR` 7qaTT@1@T  @1@@T@7!AS*1@T?kAT<@1@T`@1@T`@1@T@1@T1'Fw@@ g1@T '3@*H@m7@@@ S7 H@sҰ3@**Xa@7!aa2 @ 7 `@@7!At@@7!A R@'!X !1!& ?<qMT @U`;{FaC@ g1@T ' `**H@`z4xvBҠ@$6 @!@ @1@T z4BS*1T`H@/-#B*K@z4 T`H@7& 4xSdҟkITx`C@c1@TCx @1@T*@B1xz#@T!@vz!kT@ C@c1@TC! bz!@*` E?@@B@TSAcCkDsE{Ȩ_{#cESa@7R1@T*` @R b @_TA@7!AA`@1@T`@@7р`7@a@B4!!!E@"@c@TSA@{Ĩ_{C"BE A@ !#8%4B!!E@"@c@T @{Ĩ_{B;S E.`?[Vh`` @@@7cC<Ru@n`:@`@@1@T5{6JT@ @w@р``@7``@@1@T@@: _@7[BSAcCkD{Ũ_{SE[c^A#@/Җ+`@p@T?ր`  {5hD@?X`4MXu @@ 7!A`@7``C+@E/@@B@T[BSAcC#@{ƨ_{S@``Am%ga^Ba^ h(b2 @m`a^Ba^ h(b*@`@7```@SA{è_{S[c#y@y,@R@y*@?kMT"V9"@@@1@T@ @3 @@7рN{7`@7`@C`6`@7``5ӊ`@1@T`[BSAcC#@{Ũ_{{ҤF{_{R"@BT@_}B8Ncb! ˶{ҏF{_{S[v@w @*z@`@7`` R@al`@af@` @y@a*a@7!aa~SSA[B@{Ĩ_{S[c*kZs{`ҟT*E sus{<a@ ѡ7``Z@@9?kTD SA![BcCkDsE{ƨ@1z4SA[BcCkDsE{ƨ_ `6F@A@{S@PAkSA {¨6lF! !0@1SA{¨_ 6a@c @ 6@@E@@{SsF`J5SA {¨7RR`E!R`EtEsE6  7SA{¨ @7c7 B7!7 8{S@Fd T^t@Z@SA{ècF @8{A;{ E.@? h`9{!pG{BE!@ sEC@45M4$!E!@4*O`4!tD!@`5@OR`@b@ҁT @ @`8{è8@a@@T @{è_!pG{BE!@SC@'Ү4L 5L 5CR, @rTra``@񂢟R E'@@B! TG!E!@4N5E'@@BҡTSA @8@R{Ũ!tD!@i4L5L5CR @rTr#  @BTx#xcE'@@c!TSA @`8{Ũ`@OE'@@B@T!SA@{Ũ_o!pG{BE!@SC@'@4>L`5\L52L`C!?mT@R-TcW$qhTqhTqhTkhT ӐR"rkhT GR$r(k!Rj@`@7``]@r@TredRRIRhR.@&Wk$x$q Tq)TqIT kiTӐR!rkITGRrkHRBԐRr!r*!Q8?1!T`Be9T$R"DRB҄ Rb}RR `8a@A7!as`@PNE'@@B@T_@SA{Ũ_?{!EBES[!@C@'Z`4M5M5MCR~ @r`Trc!Ge RR@Thu8cd8b8 @D'@h`8`8 @hf8`8!pG*!@!4CK`5aK57K!tD!@40K5NK5`@MC!?mT@RTRVkiT*q2!~@Rm `@ 7` f@rTrG RR RR R.@'V9* k T9 |SGlXD\T@CLPA@!{6YkTlS@*G `@`6`w[BSAcC#@{Ũ_{  @`@@!1T` @` @{¨_{$@ @1T A*@1@Td @{¨_{ b 5aN@cR@R @! {¨ @{¨_{ N 5aN@cV@R @!@{¨ @{¨_{ : 5aN@cZ@ @!`{¨ @{¨_{[@ScEb`@!1@T{5Tzu@_TAT@7D B @!@>@J`@6 ً@`@`7`[BSAcC{Ĩ_O{BESc[ckA@WR=k5aR`5  B!@ ?L@H7@ @ED !@8@(`[ER !F l1@T , l"b1@T ,!@a1@Tu!@`!1@T!yA` `@7``b3@`%EW@@B@TM[BSAcCkD{˨_O{BESc[ckA@WR=5aR|`5  B!@`??H7@ @ED !@8@'`%R@1@T!F lu1@T , l"b1@T ,!a|!@`!1@T!yAr`s `@7``3@`EW@@B@Tο[BSAcCkD{˨_{S[c9 x @xv@>G @D !@8@('@`s`1%R7`җ`ғ`!@@`!1@Tt` `@7`@@7р`v[BSAcC{Ĩ_{S[cٻ x @xv@>G @D !@8@&@``1ER;`7`3`@,@`!1@Tt"` `@7`@ @7р`[BSAcC{Ĩ_{`BESC[#3A@O:qT<*<G@B'a q!,! ?O@@5!F @1@T sFt?~|zEO@@B@T[BSA@{ʨ_{GSa@[?AT`@T*aTsF_qTE_qs€E_qs`@1T`,aA`c@a A`c@@@7р`x*b@7!сaj@ 7ѠcsDSA[B{è_{Sa@`ia@7!aaFSA{¨_ !@V{Sa @?T  ?FD5 C?4@t@u@@?{0 5`@7``@SA{è_ @BK0D{ @!?s%{_{@ʲ{ 9m{S!E @$@ TD !@S% @!@!T@!7D !@G%/A@@G@ @1@T B;E. ?@h`@@` @1@T @u!K` `@ 7`"E@@B@T@SA{Ĩ_{SF[@4A;E.@?5h` ! @6!lF!@I@4Ҧ| ҟE^v `ER@3!RE`@3EOSA[B@{Ĩ_{C;SE. ?th` !ս`7f@a@!1@Taf @7!@!@ ?RSA{¨_{C;SE. ?th` !`7b@a@!1@Tab @7!@!@ ?RSA{¨_{C;SE.?`h`[ !`7` @tADM9a4`&@v&`.@K P!RD 9$R!R!0RR$` 54r-RRR@ 5!!1CRbRR@ 5!cR!P-*R @5!$R!-CR"RR@5!!8RBRR@5RbRR`5!R!P;*BR`5!R!'*R4@!1@Tu.Ka @"`A@i4@) tARR A @ "!7!XE@45`V@`@7V@@6D ! @D "(F`4V@ 6^`6y`V@H6`@1@T`aH7R @7р@SA[B{è_{  c` !  J7`"@@!1TF @{¨_{C  c !  /7`@@!1TF @{¨_{BFS?TA @T@7D ! @   A @ c` !`6R @`"@!1`T @ c` !``7R `"@t"RSA{¨_{  c`!  7`@@@!1T @{¨_{SsF`@5`E@  6 `@4D !@ RutSA@{è_{ !  7`&@@!1T @{¨_֡ ! ! !{S[_ T@*1T  c 5:m@*1aTf @*M8@5`'X 1&qTD !@@> `~@4RKBq-TD* ! @BA !?7sF**3,SA[B{è_{|Ā$%SM҄ @`E)`).Ra.@!Qa)@7!A@7 RSA@{è_{[,@Scks3v 5Y@* `A|@o 3@@ ;qT'qT*R!W@"@bXu8 <@9@;tAM9uA0?"4R;84?qTDӠ99G"3@J**q*`4kT'qmTDBB@t@B7 @! BxtBB RS F`Ai@ߴ)7!Ao@*`@@7` RSA*[BcCkDsE{Ȩ_{EC@dҿu!E@"@c@T{Ĩ_{*S**5 a@7!aa@!@ ?*SA{¨_#@cT@c`@94@ctAc$M9c4#RR_E{@C#.!E@"@c@T{Ĩ_{SB@[ЄEcB@7Ңu*@|@]`*dҿP*@7!сaw5`@ATv!E7@"@c@TbSA[BcC{Ǩ_{S0@0R4SA{¨`2@t2SA{¨ХE{@CE@@B@T1{Ĩ_{S4@s[V@c.@Ek@@G"A$Ao|$ 59 @|@1TF@$ 1TH*{{A*kT{R k{8\qAzT@`hz8vA@9M9Z*Z`~@ sss0<RSCo@*4_?qT@D`9Cқ#RZ; 0q4JT!@6`:9!!!!@7!!ajx8!EG@"@c@TSA[BcCkDsE{ɨ_{8!FS!5@^P@7!сae@!;@B9T@7р@!@ ?`@7`a@!@ ?!F @1@T sFab x8@7@!@ ?֠@7Ѡ@!@ ?ր@`7р@!@ ?;@@6@7@6@6@7@@!@ ?U@7Ѡ@!@ ?T@7р@!@ ?S`@7`a@!@ ?EW@@B@T [BSAcCkDsE{˨_{ `>S[ lF ! @i A Ѐ !x`6`@1@T`a@7!aa[BSA{è_{[ @cDk@S9Fp@? @`TT|@Z@`@7``|@@@7@`T`@7``[BSAcCkD{Ũ_{SA[?T@!p@ ?` @% `@7` ||@@7!ѡarTa@7!aaiv Ҁ[BSA{è_{[ @Sc@p@?@T @@`@7``DJ|@@7!ѡa9 Ҁ a@7!aa.[BSAcC{Ĩ_{S@@!FT`@1T```@7``BRSA@{è_{S@`@`T`@@BRa@qT6`B@7!ASA{¨_{@ AD` @@ 7!A @R{¨_{S@0@7рSA{¨SA{¨_{S@@9`3 ``N@`D@ ?ր@7рSA{¨SA{¨_{S@@AD@ ?ր@7рSA{¨tSA{¨_{ htA"Ta@AoDa@ @{¨!@ @{¨_{ _@A[DB;E. ?ҁ@h`@C@haq,Td_@h!ds @{¨_a@ @{¨!@{S@7@@7!A$g,Da@!@ ?ր@7рSA{¨SA{¨_{S@@@7!A`@fg Da@!@ ?ր@7рSA{¨SA{¨_{ ]0@AC`Ba@ @{¨!@{SK/a@!@?TB;E. ?Th`\`4`2@`6@`C! E!@ ?ִSA{¨{SA{¨_{BESC@!F!'@a@7!aa @ G!B @@;E@@B@TxSA{è_{BESC@!F!]'@Ta@7!aa ]@ G!B @@p;E@@B@TDSA{è_{BESC@!FԌ!)'@ a@7!aa )@ G!`B @@<;E@@B@TSA{è_{V!ES @@!F!7@-@7!Aa@7!aaE@@B@TڰSA@{Ĩ!{!ES[F"@ҡRI4R4R6R7@ `@7`!5@B|D?T* D" @ @! :@7Ѡ``@7`E@@B@T{[B*SA{Ĩ_{ ` A`@@@?T @a@!1@Ta@7!ad @{¨_{BBQS_q TE?Hb8bE%9`9?kW@y`@y?kR@`@?kM@ @ H@ @ `C!RG@`!RC!`:@9`@9?k5@`@?0`) @7рBR@*7!сa@7Ѡ`lF !@g@*SA@{è_{S[cB9ks_T @c G8@TA@@@a@!K*^qMT!@`@s@a@!_@c@ G@9  q-T!@`@IsJ@T RA@@<@Ba@! @a@!{BSC[DcEkFsG_A9 5{B;E.`?S#R#9Ch``d@@B1@T s`@`@1@T`a@7!aaMT@7р`ER RSA{¨_R_{ 5 @{¨ @{¨_{S5SA{¨SA{¨_{ 5 @{¨ @{¨_{S @T@@7B B-!@.R>!|FTa@7!aaSA{¨_{S!@!T@a7B B-!@t.:ETda@7!aa@SA{è_8EP{[c@S0@A@# @ 5` cbҳ Tz`" @A@!1@TAbx `@-T`b`@7``}`_`9 zt?aT}Ӏ"jb!j"Tax`!z ubJTzt @ @1@T ztz4@AB7O`@1T` R2[BSAcC#@{Ũ_{S[@c0@A@# @ 5 ? T@cbjTA@!1@TAbx @Tb  @7Ѡ _`9{uaTyb@ T{5@1@T {u6{5@Aт7A`@1T` R2[BSAcC#@{Ũ_B;{E. ?S%Bh`! .TLL !Fs@!1@Ta@ !1@TaSA{¨_{S a~azav@aan @a"j`& `@7``SA{¨_{@S[@ckWG`C `?`; `7`3 `"/`&+@+ `*3@'`.7@#@`@7``J`2/@"`6[BSAcCkD{Ũ_{(@7 @@6D !@"(6D !@!J!RX{_ց#R{Sd@ D !@~!A @!@3(@_ 5b@@?`@1@Tt a@7!aaSA{¨_{  @Da !$@Q `*@`B!R" 5E !@@D @ $R! %R((\ 8 @{¨_{S*#R[WqT"@4E ! @`@`6*4w*`5E ! @`@7``d @ #R@7!ѡa4 @Ʈl@ 6>y@&!2рg1&@@7!сaZ&@@ҁ}_kT@@hadh!zqaT "y؋ 6@7Ѡ`6`@7``,[BSA@{Ĩ_{S[*q#R8a@7!aa[BSA{è_{cES[a@ #!-a`4sG@a@|Tk`{@T`@ !!K*a?@6`@7` a@7!aaE@@B@T[BSA{Ĩ_{S! @[!@"@@!H@! !|@Q @ 7р+r ˣ `9 R`9@7р` v`&@<@@1@Tvu`&@@@@1@Tuu[BSA{è_lDlDҬ{E `A;E.@? h`@d5@@B*` `@7``4 @{¨_G{wy9{_{ES[@G@>@3?BB@J@D! !|@@6 R`Zy9u@1@ *@Tр`)@!1@T@ !1@T=RH@``q`@s"@!1TF @{¨_ց !@" !" !"{A<!F{_A;{E.@? h`@@A@`6{_{SD !#@"@95Fa@!1@TaD;E. ?ւ@cFh`$@,@?*a@*7!aa8t4SA{¨_{B;S[E.`?Th`&@F D !#@@B1@T&@.@@?*a@7!aa4SA[B{è_!@!F{"@SD@B@F@c1@TF`@7!сaa@7!aa@SA{è_!F!@{B;S[E.`?Th`"@F 6D !#@@B1@T"@*@@?*a@7!aa4SA[B{è_{!TG@S 5@GaT @@7@ ?`T"@c@`?`@7!сfFaT@e4SA{¨sFSA{¨_!F!@!F{B;SE.`?[Vh`&@ @*D !#@ *SA[B{è,sFSA[B{è_{B;SE.`?[Uh`&@sF- @ь|@ @sA͌|@AAkT@**kTD !#@c@94@*SA[B{ĨsB7s [BSA@{Ĩ_C;{E. ?Sa `h`!$[cf`6?еF!R@@x'@@@E@`@F@@  @7р`*@ ѡ7`76@`@7``Ҡ@[BSAcC{Ĩ_֪{S @` @T.@`2@aҠ_ 6`@A @ @1@T B@@@a1@T@.@ @b1@T 2@a@BFA@!1@TA@b!1@T``@1@T`@`b@ҭ`@7``;SA{¨_ @@@c`H@ҕ{cFBES[!Ew0@C@/'#4@+C#P`6'@l+@g`@ a TGa !$@v  `'TDa !%@mU G@RQ@e `TQ(`!Rk!TA4G  Ҷ G@q`Z|@.@qT@?֡@7!ѡa @?ց@7!сaw@! fdbE/@@B@T[BSA@{ƨ_{S@BF@B3a@7!aaSA{¨_@!tF%(F_@!G(F_@!D(F_!D({ShG[*6и`q!TBF@```@7``ECuq@@!1@T @a.@a@`!1@Tt4[BSA{è_@`RF_@`RF_@`RF_@`RF_@`aRF_@`ARF_ARaR{"@SE@/@T@ 7Da B @!` @1@79`&`@1@T`b @ bҜ#`4@Tw$@%vtE/@@B@TSA@{ƨ_{`!ES"@/$qT7@@?qДE!FT<$@<:E/@@B@TlSA@{ƨ_(@@ @4cF`Ҁ@@{S@t@@!p@ ?`@t ` @ @ 6-@`@@@7!"@!1@T@!p@ ?` @@ 7!A.`@@7!A%@7р`@Ҁa@u@7!сa @SA{è_{Sa@BR`6`@1aT5a@ @1@T `@aa@5 a@@J@7!сaSA{¨_@ @T` @&G@5{ES@WsF@Ra.ER`FEqT`FEa>Eb`RJD a6E`RJ arJa4 Rc``bJ 5`JEEW@@B@TSA{˨_{cE@S!F`TTDa !`&@  RT(+6 `@1T`RSA{¨_{ЄE[@CScks@GC? 7C@4Da !'@ ;RS;E. ?{w '`j`F4C@b@A$@!A$5@C7р`-bB`7C@FaT@C7р`;E. ?{`j`'5ub@A$@!A$5@C7р`*C7C@Da !@(@b E. ?{`j`'5Db@A$@!A$5@C7р`B7C@Da !)@; |E. ?{`j`'5Da@* $@ $5@C7р`B7C@FT@C7р`o@gE. ?|`j`'5D@A$@!A$5@C7р`Bd7C@FT@C7р`mk@cE. ?u`j`'f 5eD@A$@!A$ 5@C7р`QGL) M)@@EG@@B@T:SA*[BcCkDsE{ɨ_{cES@?TB|F? TDa !)@  R!FT)6 `@1T`RSA{¨_@TBF R?THE{a @!@*n R{__{S@GT!ET @`51 @F@?€`@T!EAT` @4s @Fa@?s€@1@T`@1@T`|@7!сaa@7!aaSA@{è_{S@GT!ET @`51 @F@?€`@T!EAT` @4s @Fa@?s€@1@T`@1@T`[@7!сasa@7!aalSA@{è_{S@GT!ET @I`51 @F@?€`@T!EAT` @74s @Fa@?s€@1@T`@1@T`D@7!сa*a@7!aa#SA@{è_{S@GT!ET @`51 @F@?€`@T!EAT` @4s @Fa@?s€@1@T`@1@T`*@7!сaa@7!aaSA@{è_{S@GT!ET @`51 @F@?€`@T!EAT` @4s @Fa@?s€@1@T`@1@T`#@7!сaa@7!aaSA@{è_{[@S֢GT!ET @m`5J @F@?€@T!EAT @[4 @F@?€3`@T!EAT` @J4s @Fa@?s€@1@T@1@T`@1@T`tq@7!ѡa7@7!сa0SA[B{è_{@S!F@_4`@1@T`!a@*7!a*SA{¨_{S@GT!ET @`51 @F@?€`@T!EAT` @4s @Fa@?s€@1@T`@1@T`u@7!сaa@7!aaSA@{è_{S@GT!ET @`51 @F@?€`@T!EAT` @4s @Fa@?s€@1@T`@1@T` @7!сaa@7!aa}SA@{è_{S@GT!ET @Z`51 @F@?€`@T!EAT` @H4s @Fa@?s€@1@T`@1@T`_B@7!сa;a@7!aa4SA@{è_{S@GT!ET @`51 @F@?€`@T!EAT` @4s @Fa@?s€@1@T`@1@T`@7!сaa@7!aaSA@{è_{S@GT!ET @`51 @F@?€`@T!EAT` @4s @Fa@?s€@1@T`@1@T`@7!сaa@7!aaSA@{è_{S@GT!ET @`51 @F@?€`@T!EAT` @m4s @Fa@?s€@1@T`@1@T`ql@7!сa`a@7!aaYSA@{è_{S@GT!ET @6`51 @F@?€`@T!EAT` @$4s @Fa@?s€@1@T`@1@T``@7!сaa@7!aaSA@{è_{S@GT!ET @`51 @F@?€`@T!EAT` @4s @Fa@?s€@1@T`@1@T`X@7!сaa@7!aaSA@{è_{S@GT!ET @`51 @F@?€`@T!EAT` @4s @Fa@?s€@1@T`@1@T`@7!сaa@7!aa~SA@{è_{[@S֢GT!ET @Z`5J @F@?€@T!EAT @H4 @F@?€3`@T!EAT` @74s @Fa@?s€@1@T@1@T`@1@T`$@7!ѡa$@7!сaSA[B{è_{S@GT!ET @`51 @F@?€`@T!EAT` @4s @Fa@?s€@1@T`@1@T`I @7!сaa@7!aaSA@{è_{S@GT!ET @`51 @F@?€`@T!EAT` @4s @Fa@?s€@1@T`@1@T`n@7!сaa@7!aaSA@{è_{S@GT!ET @f`51 @F@?€`@T!EAT` @T4s @Fa@?s€@1@T`@1@T`S@7!сaGa@7!aa@SA@{è_{S@GT!ET @`51 @F@?€`@T!EAT` @ 4s @Fa@?s€@1@T`@1@T`_@7!сaa@7!aaSA@{è_{S@GT!ET @`51 @F@?€`@T!EAT` @4s @Fa@?s€@1@T`@1@T`=@7!сaa@7!aaSA@{è_{S@GT!ET @`51 @F@?€`@T!EAT` @y4s @Fa@?s€@1@T`@1@T`@7!сala@7!aaeSA@{è_{S@GT!ET @B`51 @F@?€`@T!EAT` @04s @Fa@?s€@1@T`@1@T`W@7!сa#a@7!aaSA@{è_{S@GT!ET @`51 @F@?€`@T!EAT` @4s @Fa@?s€@1@T`@1@T`@7!сaa@7!aaSA@{è_{S@GT!ET @`51 @F@?€`@T!EAT` @4s @Fa@?s€@1@T`@1@T`҈@7!сaa@7!aaSA@{è_{SGa@?TE?AT` @i4s @Fa@?s€`@1@T`a@7!aaSA{¨_{S@GT!ET @=`51 @F@?€`@T!EAT` @+4s @Fa@?s€@1@T`@1@T`@7!сaa@7!aaSA@{è_{S@GT!ET @`51 @F@?€`@T!EAT` @4s @Fa@?s€@1@T`@1@T`@7!сaa@7!aaSA@{è_{SGa@?TE?AT` @4s @Fa@?s€`@1@T`a@7!aSA{¨_{S@4s @Fa@?s€`@1@T`ma@7!aSA{¨_{S@k@4s @Fa@?s€F`5b@a D!+B @@%`@1@T`a@7!aaVSA{¨_{S@[*֢GT!EAT` @34s @Fa@?s€@T!EAT @#4 @F@?€*[BSA{èSA[B{è_{S[cks3_TkDSAcC[BsE{Ǩ`@@"9#"b@@@x;{@Tt@`@!3@77@@`@6 `@[BSAcCkDsE{Ǩ_{S(@7`@@6D !@,%`2@3a^@`5D !@?qTa@R`@@a*@SA{èdGA !`.@SA@{è_ @{@@TA(@7@ @@6D !@FCHC@g|@ehdB{c@T@@ 7@`d{__{SG @"p@!(@!@ ?a@7!aaJ7!aaChE5Da !+@@7р`2SA{¨_{S[ca6@*@a{!#*8Tzx |`z8[BSAcC{Ĩ_{A;SE.@?[6h`@a7!F:!2@`@@@b !Dc @B,!@v-3@7!ѡaۿa@7!aaпT2@@`5!Db B -!@A@T@?}!8NSA[B{è_{@ 3@@?TTs @{¨' @{¨_֡!D{b !@B-{_֢BF{SA7SA{¨%!lFb B .!@SA{¨_d$@!D{" !@B3{_@$_B;{E.`?@h`"$@{@! @YB!Db B.!@{_{D;S[E.@?֔h`,T!Db B`/!@0`4a@b"214ݿ[BSA@{Ĩ_{C;SE. ?th`@@0@@@ҜT !Db B 0!@|2@@`R RbSA{¨_{cESB[cd@/_T@LT `4c"Ҝ5H@C4 TDS @ssR @#574 @R @ T@xs@1@TBR@*6qTTskT!E/@@BҡT[BSAcC{ƨ?DA ! 1@"E/@@B@T{SA[BcC{ƨ_0@a!@!D{B !@B1{__{!FS@T @ 1@T `@1`T`1 @@!p@ ?`) @@1@T @ @7р`4s`@1@T` @@ 7!A'@SA{è_@D@!F{S[F?`Tv@`@1@T`,w@BD@TSA[B@{Ĩ`@`? @`7Ѡ b @A@!1@TA@!1@TSA[B@{Ĩ_{H;)ES E.@?#=$@'=+=/=3=7=;=?="@?i`T8%x`C++@4c7 )qa@`@7!сaE?@@B@T~@SA{Ө_{ @pG !`@{`4`@@@7! @{¨] @{¨_֧E@  !XtDA @! 2N{I;JE==#=E.?C'=+=/=3=7=RE@/'C/ ) i`@U!E/@"@c@T{Ѩ_D F@@%@TЄFA !@2 A !`2 {)E=C= B*#='=+=/=3=7=R%@/'C+ )@!E/@"@c@TΖ{Ѩ_@Γ@̓{[@S֢GT!ET @`5J @F@?€@T!EAT @4 @F@?€3`@T!EAT` @4s @Fa@?s€@1@T@1@T`@1@T`@7!ѡa{@7!сat.SA[B{è_{S_Tc@ @T@`7" B`,!<@ 2@ C25 D;ՠE.@?ғh`t.@.Bt.SA{¨_A;{E.@? h`@=g5F{_{S@4SA{¨x)I @`@(@b@c(D@"`4" a@@ 2 @7!A { @A(@!A(JSA{¨N{A BES! 3C@'Bc^4@ @1@T #@sD`@K"4`@A !@3G@P@Ґ`@ T`7`@҆&G/@a`@ar`@uo@ҫ`_`@7``@DA !3@ @7р`@I@G@7р`!E'@"@c@TsSA@{Ũ_{@@[8@Sc@ T&@f`@1@T*@`@!*6)6@.@!6I&@ 6@7р`>`@7``7`@7``.[BSAcC{Ĩ_,@d4@d4{A;E.@?{ h`{C;@E.?`h`@?mThaa!DB @B4!@{_{j2{SY`@U@7!сa3xG@$a@7!aa׺SA{¨_A;{E.@? h`0@a!@!DB B1!@A{_B;{E. ?S!R@h`@vA2@u@ sB$V@_ws`@ţ`@`@@SA{è_{S@cDA !5`@SA{¨_{B;SE.`?[Vh``@ @~1~ @T```@`6,`^`?a@*7!aaQ5@ !DB B@6!@ @!DB B6!@RNSA*[B@{Ĩ_{Z{_<9{$@ES[@G`TbC @!P@!DA !6@{#@"R`?* 5@'@´EG@@B@T[B*SA{ɨ_{cES[@a@G`Tb R*`4@'@EG@@B@T[B*SA{ɨ_P{SGa@?TE?AT` @4s @Fa@?s€`@1@T`ePa@7!aSA{¨_{S@[T` /@aT@T`TT`T!?CTlGstL X;F`4|@@!1@T!F`!3J`@6@4@7!a6u @@7!ѡa*v @O``[BSA{è_{Sb @abSA{¨ `  5SA{¨_@/@A0@!@a֠D{A @!7B @ {_{SGa@?TE?AT` @4s @Fa@?s€`@1@T`a@7!aȸSA{¨_X{SGa@?TE?AT` @4s @Fa@?s€`@1@T`{Xa@7!aSA{¨_kX{SGa@?TE?AT` @v4s @Fa@?s€`@1@T`a@7!anSA{¨_;{SbT`@`+`T?!Г FSA{¨_{cES T`@b@_T @?T ` K5 ` # 4@SA{¨ SA{¨_{  @ @{¨Ta @ @!{¨  @{¨_{ _T`@ @{¨~@ C 85 @{¨_@"{@Sc4@c@SA@{è4R@7!ѡaѷD!T`@7``Ʒ@A РD!@8B @@@SA{è_$@AT{@ c4@d @ @{¨c@ @{¨j4g 4RR6BDT@7BBb@ D!B @@ @{¨_{ _T`@ @{¨@ C855 @{¨_@{@Sc4@d$@SA@{èc@SA@{è4 RR6@7!ѡa;D!T`@7``0@A РD!@8B @@D@SA{è_{!ES[ck"@/TTP5}0Cҿ Tx}`j!5`6 @`z5`P +@@7!сaBUv߂E/@@B@TȐ[BSAcCkD{ƨ_{S[ck+iT*`|ޱ` 3iT ~ұ`@6DP:* @!P@1T A6@|a@Bhz"h @a@B A@~T 7!ѡazR`@ @T`s5SA[BcCkD+@{ƨ_{ES[ckRs7Rw?!@@OңcG @8qTb5ZRBqQAz)T!"4 _8qTqT"4BQd`@T _8qTq`T _8ZqTK4@T@e@6FT@ @D *B B9 ߮:@TB *B9(@aCCGK_kT p|~)A !@:*G7@G@w@|K@EO@@!@TȏSA[BcCkDsE{ʨ_{#!c@ES@B c+B:`5@)` @@@1@T@@ @b 1@T aE@@B@TSA{è_{#!ФE c@c,@B B:^4@sF@? TB@5"@A D!:B @@ 6 6=7F?T&5"@A D!;B @@m)6ҡ!E@"@c@T< @{Ĩ_{E;E E.@?#!гh`c@@B c,B <`5@Ta2@a!@!@!D!@4+@@!1T!E@"@c@T @{Ĩ_֤E{#!Ђ@c@B c-cB`<4Aҡ!E@"@c@Tَ{è_{cESe@@b@@#!c@B c-B<`5 T@@b@@?֠@A@!1@TA@!E@"@c@TSA{Ĩ_{E -cE b@B B<s4b@@?@@2#R: 6`@7``~ҠE@@B@Tm @{Ĩ_֥E{@`@T@6%@T@6_d@T aR@bR@cR(!E@"@c@TD{Ĩ_֥E{@`@T@6%@T@6_d@T R@;R@cER!E@"@c@T{Ĩ_{S[`K#@54@u@@ ?s@[BSA{è 8@@ 3` SA[B{è_{ _ @T@ c =`5`@b @1@TF @{¨_{S[ck+`[{DY 9>RH*0!BDA !@=@""@3DA !=@`@7!A`@E*@7BbB@>  @7!сay7ZSA[BcCkD+@{ƨ_{ _@T@ C ?*`5`@1`TF @{¨_{S@@4s @Fa@?s€`@1@T`**`@7`0@*SA{è_{$@SaTO` {*a@7!aa*SA{¨_{S[`2 @68@ @` @`?*a@a7!a@ @?[B*SA{è_{S` @58@ @l` @`?*a@a7!a@ @*SA{è_{@ST@LT@ C"h5#@t!@7!сaaTaT SA@{è)SA@{è_N {S[c*#*@   TDA ! @@T@ 6"@qTDA !@Ҹ `6@9DA !@RYjTqwZ@MT*BRRRTSA[BcC#@{ŨK*U2s24ҡR@?rT?rB@qS5GTjc8B@% @!Dcha8A8@!he8A8*c ŚTkGL ?TGkTHia8o@ @D!ih88h@in88)Ji&8cG |BTjc8B@$ @!Dcha8A8@!hd8A8$эG| N ҟTH K kTji8 ѱ@P @JD)0jp8 9@ jj8 9ˌi'8cGBjc8B@$ @!DcѤhd8D9@ha8A9SA[BcC#@{Ũ_RR $RRR$R{S@e4s @Fa@?s€`@1@T`=a@7!a]SA{¨_{$@S[c#aT{*)D@4a@@ `.GR-BR*@7Bb'?qTT qTqTTGA ! @84GA !@ qaTs q!TDA ! @o3Ҁ@7р`[BSAcC#@{Ũ_BR{ _T`@T @ C5_ @{¨ @{¨_"Rv{ _T`@T @ C5? @{¨_ @{¨_u{ _T`@m*1T @ Cc5 F?qE!F @{¨_{S[L!tG5@^ ܶ *a@ ѡ7``k4dG@@5a@* !6 5B`N`OE@@5a@* !6V5B`3`4G@U@q*T`@7`` T`@`7` Q*a@7!aa v5@7р`[BSA@{Ĩ_{ES[cC#@/'@5* @'@Tc @+@ @T@7D !"@>&qLT!TD+@@ D s- ;A !@D@ C sc- c; !`#E/@@B@TSA[BcC{ƨ_шE{S[cks @ W[ R@ C`@T@7 R@}R2>4{@t*@z @ _#qY@-T |ӐW`I R @3 7@ @ 33Tb@D@ C B c- c; A Х!- %_q*& !U1e2@%TDb@@5 C B c- c; ! ? C B c- c;f.@a d !1k@2q F !Ơ- !%CG`@OKS{*_k TS@@9?qaTSS@@9?qaTST7@xy`{@@zT K`  @ c3@U@H@I;@@ cAK@|@;G@a.@{@?k Ta.@{@?kTDb@@kTkҁ%|@ C B c- c;g2@f d 1?k2?qF Ơ-! !SKt4@ C B c- c; !C@`4W@ R>;@C@@9~mTR :mT`8 @V`b@D@ C " c-  3@ c;E !n  :T`8 @c@N=!EA"@c@T3{@SA[BcCkDsE_ @!T@6*@!T@6@`҉{a$R @#R{_{E====#='=+=/= cR w@')!E@"@c@T{Ϩ_{E====#='=+=/= cDR w@')!E@"@c@TLJ{Ϩ_{ЄE@c@R`!E@"@c@T{Ĩ_{ЄE@c@DR`w!E@"@c@T{Ĩ_{E====#='=+=/=  c R@')!E@"@c@Tp{Ψ_{E====#='=+=/=  c FR@')!E@"@c@TG{Ψ_ЄED@{CS@ҍT?@AT$!@&R-*RҒ`a@@ @ @1@Tt~E@@B@T{ASB_фЄE{CS[cks@O҃t@T@A TC$!@/R&RRO@ tw@FC@@#@@@4;@@1@T? @7р G@*@7!ѡa@7р`6`@7``ҀEO@@B@T{ASB[CcDkEsF_фЄE{CS[cks;@҃s@S _T@BTc$!@ 0RFR%R`@T@=@_a@7!aaVaT#˕`XAtO@/bҿY TLO@G  TTK@A@ÚYKEHIA˄c Ś ŚJQ*@7!сa ;7@T{R9*@7!сa\6G@9O@O$*@7!сaܫ7֕ `@ 7`ѫҀE@@B@T{ASB[CcDkEsF;@_CхХE{CS[c+@҄@5 ?T_ C T$!@@1RfR%R x@T`@e@ !@7!!a~@T aT` @N`p@7!ѡagT@3@Ք;@"Rb3AӾEI<E@@B@T/{ASB[CcD+@C_#`ЄE_{C!@S$A@/ҍT?AT#$!@FR`2*Rr``L@@@?րL!E/@"@c@T{ASB@_ЄE{CS[#``@7a@T@4$џHTC!@3RFR%R* Bb @?Ts@S @@T@ T sF@sFF`@@? @`7FT`@1@T`Z@1@T!!@<! K@E7@@B@Tu{ASB[C#@_E{CS``[@/a@S@3#HT#!@4RFR%RҶ`(@`T@F@@?@|@1@Tu` `@7`@3!!@<! @`"E/@@B@T{ASB[C_#`E_{C!@S[$A@/ҍT?AT#!@FR5*R``.v@ѳ~a@7!aa`T TD! ! @R@@? `@ 7`ЩP!E/@"@c@T{ASB[C_E{CS `[#@7a@T@4?HTc!@6RFRR`t @FT@T3@@T6@@T@ 7D! B @!@ F "@94(qT@9@54qT@94(qaT @9 4D! ! @  "ҿ T@@T@7D! B @!@o  Ҕ"9v`B@@B7!A@`F@@F7!A7`>@@>7!A. R`y`B@99?qa9@9?4qT@!1@T`F`@ !@4!1aA9@55$aA9Ҁ@?qF!FBEB`>aF T(TҔC7 R`2jSM҈C 7ټAR Ra2`9!RRaytR!E7@"@c@T̂{ASB[C#@_џEa@{CS@T_`AT!@;R$>&RR TA !`&@@@if1T)E@@B@T{ASB_џEa@{CS@T_`AT!@;R$?&RR TA !@@@.f1TE@@B@TU{ASB_фE{CS@/҃s@S _T@B T#!@8RFR%RҖ` @T@6*`6R!E/@"@c@T{ASB@_џEd@{C@mT_`A T`A !@@rB@?D &RR*UE@@B@T{A@_џEa@{CS@T_`AT!@?R$&RR) TA ! /@@0@e1TAE@@B@T{ASB_џEa@{CS@T_`AT!@?R$&RR TA !@@@Fe1TE@@B@Tm{ASB_E{CS``@a@T@4?HT!@ 9R&RRҲa@O` TA !@@`@od1T/E/@@B@T{ASB@__E{CS `!@@$@T?AT!Є@&R@:*R` @S`a@!1@Ta !E@"@c@T`{ASB_ED@{C@T?@AT!Є@&R`;*Rҫ`(@ d*1TɹD@raT`*R` @Yc*1aT`qTqlT34TqTq@T`E&TqAT`Fq`CzT4T TTTqkT!T@!1T`DSA[B{è_{bBF#@STbB|DTBRTSA{¨a1T4 @b+@bBF@B3?T9a@7!aa `D !@@SA{¨_{%@dFTd|D!Tda1@T{|@f"R=`T{<{_%@dFTd|DTHa{bR${_{S @@!p@ ?`@a!4F_Ta@7!aa] @Spa@7!aaO@SA{è_#`dE_{C!@S[$Ac@7ҍT?ATc!@FR*R`Eu@ a@7!aaT^ )X`@`D ! @sT}#Rvuš@@?@T @P02va!E7@"@c@Tr{ASB[CcD_#`dE_{C!@S[$A#@7ҍT?ATc!@FR*R`Fu@5a@7!aaT *`@`D ! @T}ӯ`"2Tz!!š@@?T᧟P0*a!E7@"@c@T]r{ASB[C#@_{ `D !@``@aR @{¨_{C+F#GI;@'@G@*;**** * *R|{E_cc(E{CS[ck s @T@`@_T @ @Ta %5B C 4@U*1aT@U*1aT~@U*1aTv@U*1aTo@U*1aTg"@U*1aT_&@@@T@`7B  B@ ! l *@_@T@@7_@  B`,!@ ].@@T@@7  B`,! P2@c@T@@7c@  B`,! B6@ @T@@7  B-! 5:@@T@@7  B-!@ (>@@T@@7  B-! B@;U*1aTF@`@T@@7B  B@ ! J@g@T@@7g@B  B@ !  @@TN@a@!T@A7  B`,!@ |D TR@@T@7  B`,! mZ) V)@ !& &6Z@6`D !@ҁL@6`D !`@x@6`D ! @o6`D !@gc@@LܯD7[);_@S@g@_@Z)c*#5{ ~|zx{ESF[GcHkIsJ_{ @A;`E.@? h`0@a!@ccDa@R @a6! @{¨_`E{C@s@S@A T @!R&RRѶ`7@/T*1ATA;`E.@? h`B;`E. ?AR@h`B;`E.`?@h`?q Ta!D B!@ @sb@b5"RbTĩa!E@"@c@T'p{A@_`E{CS[@/s@'3 ' A TC @ "R&RRh`J3B;`E. ?'@a Vh`!  @}6@#5T MTa!D cRB !@n|5a!D B`!@Uҡ!a4 "Ba5bAT `@7` `E/@@B@To{ASB[C_{S_TlT #e5<@]S*1T`RA;`E.@?4h`@@`qT@Q `@ a!D B@!@Κ`@1@T`"  B!p 6`@@7``SA{¨_{S1Tܨ`'A;`E.@? h` A;*`E.@? h`q Ta!D B!@C)Kk Ta!TD B!@{*`F{_{S[ @7@^ RSA[B@{Ĩ_{CS`E[a*@c+xE@ҁ7`@@6`D !@``2@h`Z@u4`D ! @R`D !@J&@5`FT@T@@6 @@@aTa@`D !@1@0@@qT fGaTqT  @$ T`dG !`@fa!E!@4aT# a@R U#RB 7 l C#a@"@@@ @C{`6.s@g@@a*@|c7`@@6`D !@? 45@ -IN3@[@dsב *`#@@aT{AcD[CSB+@T4`dG ! @`D !@@@@T n{A*SB[CcD+@_`D{@{_`dG{@{_{ _T`@Q1T  C5o`DG@ @{¨_{`a!E ssE#@`4`hD@@a@T @a@T @BbQ@{Ĩְm @{Ĩ_{SR(q`5 `?-@`hD@SA{¨_{@S`hD@ A`  @!Ra9@ 7!ASA{¨_`dG{@d{_ړ{S[ 6@a!E`T4`D@ 4`D@*@7!сaLs6*5_^`FSA[B{è_{C;dES|@[c*#@?`E.?֤ @1;qvh`$@T 3~4+~{u} `@7`  a@ h9T @a ! c@4  ! !?7ccc  !!37ccc4c7`4/@  !!a!F!N @6`@7``Œ  !`"`@7``@E?@@B@TlSA[BcC#@{Ȩ_BBEB@_qg{ޑUFS @T@ 7ޑҡ @]a@ 47!aa7!aa}@SA{è_{A;S`E.@?[6h`6[BSA@%{è(R]i`A!F @1@T TF !BپԾ C7`@7``6@7р [BSA{è,SA[B{è:SA[B{è_{A;`E.@?{ h`p{A;S`E.@?[5h`V֚F @!T@7 }`# @b@47Bbb7Bbb!`44SA[B{èSA[B{è_B;{`E.`?@h` @@%{¨n'N``@7` @{¨ @{¨_{S3R[ARhs`~@|@RARhk !B" `@@7`b@@@64C;`E. ?A!F`h`!@E4  !@#  !"`@ 7`[BSA{è^SA[B{è_{S@BB EAt2@@2TBBF_ w 6A!,E!@`4WSA{¨V{ 4L @{¨i @{¨_{S@`@T@F T`@1@T``@`*`@i``@7``SA@F{¨_{T@SA@6@D @!#@A!F!*!Yi*6@,E@O`4@Ga !@Is5*SA{¨_{SKSA{¨SA{¨_{S`A4l,|@1@Tt } !2 6`@7``@SA{è_ `CcE_{C!@Sd@$@T?AT Є@&R@#*Rڰ@@T@`7 a B-!<$a@7!aa\@E@@B@TLj{ASB_0@cc@$0@#H@!X@"aK @_kTA!0FB B.!@A!0G B$!@_{A!ES @TEV,B `7@a@b@@ҡTSA {è`&@@aTSA {è&@@@TiSA{è_{CcES[ck`@?  @Bc@_7/@aT @T@A!D4@*   !- !&FR @;T;@B @*@7!ѡa7;@!8;47@m1`T7@qATT @jT@ @D!'B @@7@Fѥ*6/@D@E?@@B@Tvi[B*SAcCkD{Ȩ_{S[  @)k T@TD! ! @>@@qTA  *@*C1T`@7``J @@Fs`@1@T`C1T`@7`4Ҡ@Q ҡ@!QTFSA[B@{Ĩ_{S[ @)k T@TD! ! @zFB`}@@Fs`@1@T`BC91 T`@7``@@Fs`@1@T`bB#1 T`@7``Վ`A*C7`@7``ÎB7`@7``B7`@7``rB7`@7``@Q @!QFDTДFSA[B@{Ĩ_{S[c @)k T@TD! ! @^B`Ҝ@3< nC1T`@7``O@3<VB1T`@7``; @f@ Cv1 T`@7``(@3_< Cb1 T`@7``@xC J< CM1T`@7``@*C:1 T`@7``@C #<@B&1T`@7``؍@Q ҡ@!QfVFSA[BcC{Ĩ_{S[  @)k T@TD! ! @!BX`\@7` C1T`@7``@7BУ1`T`@7`` @cc@ ;`B1T`@7``m<@B1T`@7``\@Q ҁ@!Q UеFSA[B@{Ĩ_{S[ @)k T@TD! ! @Cܶ`z@@Fs`@1@T`NBd1 T`@7``@7`RCO1 T`@7``Т*C>7`@7``B.7`@7``B7`@7``ьB7`@7``@Q @!QtrTДFSA[B@{Ĩ_{S[" @)k T@TD! ! @ @@qT q@TqaTB;@@Fs`@1@T`BCŢ1T`@7``w @c6@ zBAaB @@Fs`@1@T`BC1 T`@7`P`*C7`@7``> `B{7`@7``."`Bk7`@7``&`B[7`@7``@Q@!QTДFSA[B@{Ĩ_{S[c* @)k T@TD! ! @UG@@q` THT q@TqTqTqTqT qTqTbAw$@5ZAl #@@Fs`@1@T`CVA]  NAX @cc@ 9B1 T`@7`` @c-9@jCΡ1T`@7``@@Fs`@1@T`rCJA@]5B1@T`@7``^ @-9`jC1T`@7``I@cP39C1T`@7``4@-k9@C6^Aմ@@FAϴ@'bC\1@T`@7`` @@Fs`@1@T`BCRA@ @c-59 jC81 T`@7``*`*C'7`@7``ڊ.`B7`@7``ʊ2`B7`@7``6`B7`@7``@Q@!Q[YTFSA[BcC{Ĩ_{S[  @)k T@TD! ! @2C(`K@~@bC1T`@7``e@Q4B1@T`@7``R @c08@rB1T`@7``=@Q ҁ@!QUFSA[B@{Ĩ_{S["  @)k T@TD! ! @C`6@3BH1T`@7``@3@ZC51T`@7``@Q ҁ@!QUFSA[B@{Ĩ_{S[b @)k T@TD! ! @0RBg`Ґ@@Fs`@1@T`NB1T`@7``@3`hJBڟ1@ T`@7`` @@Fs`@1@T`Cğ1 T`@7``vE*C7`@7``f5B7`@7``V"%B7`@7``F&B7`@7``6@Q @!QrTFSA[B@{Ĩ_{S[c @)k T@TD! ! @@@QlqxT !?!X`x`! ֠@.@`@@Fs`@1@T`BC21}T`@7`` @b |VB1`{T`@7``ш@c07yrB 1xT`@7``@cc@ 6vB1 vT`@7``@2tvC1sT`@7``@@Fs`@1@T`C̞1qT`@7``~@oj@& o@@Fs`@1@T`BC1mT`@7``b @xC 6knB1jT`@7``M@c6iC1@hT`@7``8@c0n6`frBq1eT`@7``#@C Z6cB]1 cT`@7``@c"E6@aCA@S@_@cc@ 26^C&@]@cc@ $6 ]C'1`\T`@7``ه @1ZCKA{Y@1@YBC1XT`@7`` @c"5VC:@ZU@1 UC1`TT`@7``@RJC՝1 RT`@7``@@/@P@m1OC1OT`@7``n @Z1`MJB1LT`@7``[@G1KC1@JT`@7``H"H~C@>*@@G@%1FCt1FT`@7``& @1`DBa1CT`@7``@3I5ArBL1AT`@7``@355@?^C81>T`@7``@oB@<@0;C1:T`@7``̆ @358rB1 8T`@7``@34`6^CN"BX2@S4@c 44Bޜ1@3T`@7`` @c04`1rBɜ10T`@7``{@@Fs`@1@T`CfA-@X0 -C1`,T`@7``Y @c 4*~BA)@70)B1@(T`@7``8 @$0&BAگ,Aկ%@3]4@$rB`1#T`@7`` @cH4!BK1 T`@7``@344 ^C71`T`@7``@3 4B"@@/ C1`T`@7``Ʌ @/>Ca@k@c;3 @^ @@Fs`@1@T`:C1T`@7`` @c;3FCӛ1T`@7``T&C@){A$@cP33 FC @ @T/ C1 T`@7`UAPb@Kv@`FB`*C7`@7``4F`Bq7`@7``$J`Ba7`@7``N`BQ7`@7``@Q@!QTFSA[BcC{Ĩ_{S[ @)k T@TD! ! @K@@qT@@.C 1@T`@7`` @@Fs`@1@T`BC1 T`@7``@c02 rB1 T`@7`"`@*CΚ7`@7``&P@B7`@7``q*@@B7`@7``a.0@B7`@7``Q@Q @!QTFSA[B@{Ĩ_{S@%4s @@Fa@?s€`@1@T`ha@*7!a@*SA{è_{ `CcFHaL6@G@r5@D@m 5`@`7`s @{¨_{@ n? @{¨{ @Z @{¨{SA!E[@#@AT@!7@D B @!`(@ V֚F;S`6:@ n ;6`@ 7`@!T@7@7!A@D !(@@΢a@67!aa6@F!aa|A!E@"@c@Tk]SA[B{Ĩ_{@CT@ C7@D B @!)@}Z* @{¨_{CcEBBFS[ca@/#T@F6`@T@6#C@D !@*@&+@ @1@T '@C@c1@TCo*'@@6+@@6X725!a!!A!E/@"@c@T]SA[BcC{ƨ_{ = @{¨ @{¨_{I;JJES@ E.`?#=$@'=+=/=3=7=;=?=B@?5i`TW c7$R)@`a@7!aa E?@@B@T\@SA{Ө_{I;*JES@ E.`?#=$@'=+=/=3=7=;=?=B@?5i`T ~c7R)@`oa@7!aad E?@@B@TS\@SA{Ө_ !@ h{{D;@E.?S[h` +cks`@94! !0F]53sFd s*ERZ  TZjiEiw@7!сa !!LD!@5{!@7!!a!!G!@p@5AiO@7!сa lE B`+@*&i6[BSAcCkD{Ũ_"BE{A@cB ,!!E@"@c@T[{è_$EDA{C@/ҍT?@BT Є@FR`$*R  @ b `,+!!E/@"@c@T~[{A@_$EDA{C@/ҍT?@BT Є@FR%*Rǡ  @ b ,+Q!!E/@"@c@TM[{A@_C$ED@{C@'ҍT?@AT Є@&R&*RҖ@ B`-!!!E'@"@c@T[{A@C_C$ED@{C@'ҍT?@AT Є@&R'*Rf@ B-!!E'@"@c@TZ{A@C_C E{CS3`!@[c+@GҢT@4 ?T5 Є@&R(*R,v@@T@`7 A B-!<._҅w@ TA7F` @`*@7TqRR9R`@*7ATqqq@zT R`@*7q?qjT D ! )@4*T4 D !)@7FRRRRRRRR.ˀq^`A8lk@1@T@v 1@Ttx9u9y9Vma !ֈ 6`@7``A@7`7 EG@@B@T'Z{ASB[CcD+@C_{!!pG"BES[cks!@C@4@`4ҹ\`529%3 `@;@5 R !R`^@*#R R@?44\|@  TZ7@,T kTqRR0@RR7c@r`Trs5G9  R@'{9$@*#R R@? 4iR`xt[[Rsj 8T;RkT R`9~SnXӧ@^TӃNPӂ>LӁ.H`"hf8f 9@he8e9@hd8d9@hc8c9@bhb8b9@Aha8a9qTR`9~ S.Hӣ@`bhb8b 9@Aha8a9` Ra9@D@Aha8a&8@!ht89 `8ۉ@A7![`@8 E@@B@TGY[BSAcCkDsE{ب_{%E @Ot@#@9 FbQB@_ qT !B%U6" !B O 6`@7`` E@@B@T Y @{è_{I;*JES@ E.`?#=$@'=+=/=3=7=;=?=B@?5i`Tp wc7R)@`a@7!aa~ E?@@B@TX@SA{Ө_D;{ E. ?ւ h`B{ @!@.A {S4ДF[T@1@T@1@TJh!!xG!@44`@1 T` Ҟ`A -@7!ѡ@!@ ?@1Ts4 B!. @A@!1@TA@A@!1@TA@7!@!@ ?R @1@T`@1@T`SA[B@{Ĩ_{S[_TlT %#5M@@@!@?T@7!A~SA[B{èda@7!aa ~5"BF3sF`"87(@7!ѡa}`G7```"8}T@7!сa}a@a@7!aa}[BSA{è_$@#c4FT{S@[17@@T`T`*Tzuba@ ѡ7``}V[BSA@{Ĩ_{c@S[!T@SA[BcC{Ĩ! @Ux`{4 T@! ! @`@`6`~}[BSAcC{Ĩ_{Sa @?T  45  #4*4a@SA{¨SA{¨_{Sa@?T  485  #4 4@SA@{èSA@{è_{Sa @?!T .?5 #. 4 @`@ATa@7!aa}SA{¨_{   @`7`@@6`@7``| `@6 F``| @{¨_{ @@6`@7``| `@6 F``| @{¨_{S]`@i`@f`@cd@ .'a@7!aa|@SA{è_{A95 Da ! @ A9!4 Da !@ <@{=!!F!' F{_{@?q T Da ! @@4 D !%@۽{@!!F!{_ @!!FB! lF{ @!/{_@?q T{@ D@4a !  a ! @!!F!ڷ{_@?q T{@ D@4a !  a ! @!!F!{_{ S/ 0pSa@7!aa{SA{¨_{[ ES@@/u !`0p` @|#BI D@D@4@ T@@6 E?TK  %Y`4 |F?T?TB+]I@7!сa{sb@@T lF B @!0@`@7``{ E/@@B@TU[BSA@{ƨ_{S[ 1 !1gp@ңv&|~ }` !1|t`v` `w@R7`@|||[BSA@{Ĩ_#cE{S[*BQcksd@_qT+@7@!@6 Bz`T@!!F_T(@7 @!@6 BzTq@ҡT #Rt6}l*5~F@ў` R9@˞` R9B9?|qTB9|q`T?kTA@ R9Y*M@@P*EB'@@@B9"5*i*6H'CCZ#@_qT@ TA@@b@!@!*' J*qTH'I@!@93R 9 B|@*6 1ATTWU3sD8TNL/qBzTq Cz`T@T@>3sE!`T313sF3sD3sE3sFu s`@1@T` E@@B@T9T{BSC[DcEkFsG_! !{CS*@ @7[*ck* o@"BF_q!!E!** ! 2^a@7!aa z{ASB[CcDkE_{Sb_a@7!aaySA{¨_{ !@2S 1[n> tҘ1z/z-z[BSA{è_{R@S#?kAT/`b@4a@!Qt@aRgt1`a@!QaSA{¨_{R@S#?kAT `b@4a@!Qt@" ab@t5R?@ta@!QaSA{¨_{R!!E@S[c$@/A_kAT`b@ 5v@`b@v4 aR F+a@!Q)!R @C#)Du@@FR@5@ R`b `f@!RB)C)r"va@!Q"BEa/@"@c@TSSA[BcC{ƨ_{R@S#?kAT`b@4a@!Qt@tR@ Fa@!QaSA{¨_{R@S#?kATf`b@4a@!Qt@PRt` Fa@!QaSA{¨_{R@S#?kATA`b@`5t@R}`tk`@Q`SA{¨_{[Sck+y@?rT@ 7!A X !2 1m{ @  9C20z@66}q4 @6?jT:J@`@`6@6-!qx`kxрexUq 5Yx`@7``Qx@7р`JxSA[BcCkD+@{ƨ_{S[4`2@~4@@!!D @!@B2^@!!G!@4,SA[B@{Ĩ_{S@5GT!!ET @`51 @ F@?€`@T!!EAT` @ݭ4s @ Fa@?s€@1@T`@1@T`}@7!сawa@7!aawSA@{è_{ @ST@6sBs)a@s"!p`4@SA@{èQSA@{è*T{q[6֚FSB@@!T@7 Da !>@`@7``w&@1T`dz{ 4@7Ѡmw`@7``dw[BSA{è_{@S @@T@7 D !3@"!!F~! @@@T@@7 D !`4@w@ >ca@7!aa+w@@!1@TSA@{è_@ҿ@!!F!@!!F!{ !!Eb@#@ D !@3@p @!T@!7 D !`5@f !5zN 4@b@9` @dA!!Fb3b9 T!!F B6!@"!!E@"@c@TP @{Ĩ_{_r$F#@Sҁ" B@!T@7@7!Av DA ! @$@ @_ T D !`1@`@7`v@N`@7``vSA@{è6SA@{è_O{"BESA@G"R```=$p`6 ! B !@ 6 aR`5 ! B!@6"R#@`q EG@@B@T>P@SA{ɨ_O{"BESA@G"R```=o`6 ! B !@` ` aRg`5 ! ` B!@`RB#@`p EG@@B@TO@SA{ɨ_!!F\ $R!B7R={#cES[cksb@?7TLT ` `&#ҡ5@@47F"7@E 7ҿg;@ 39 9:Z?Gvҩ~ҿT"h`8_(q`T!T@ 6@Q@4>wH 45` @Tj@@T@`7 D B @!6@@`6o @T~@T"h`8_(qaT<рou<@AT@a7 D B @!7@~@@6F@@7!Wu+| @!f 6@7р`Ju0` @``@ @TM@7р`9ua @a`@_8(qT` @lTa @a`@ @/w*ҡ|K*6 ,E@r4 G! !@l@7рr@*SA{è_{STҟ-7SA@{èeKSA@{è_{SDA ! @6 fG@ƨ a@7!aar@SA{è_{ES @F!ET@7!ArEҁ` @SA{¨SA{¨_{<S @F`w` @<ҁ@7!Amr<ҁ` @SA@{ès `@7`@Yr@SA{è_ @ȝ!F!}@Ś!F!v @!F!o @cFϝah@cFٚaa@cFҚaZ@cFaS@cF"aL@cFaE{S_TmT@  9#ˠ5!FD@SA{¨_{cE d@qq TqT@@!1 T,E@!E@"@c@TK @{è_{SPG[@?TD !@@1 a@D? TD !:@%Lu*@54lF !:@v@ TD ! ;@La @? TD !;@a@ R`*AL @| T@7!A|qE@b@A@`7!A!mqSA[B{èzSA*[B{è_{cD$@ TD !<@p`4F{_{BESA@@5@qTT,E@=@@!1@T!E@"@c@TKSA{è_{cESb@ҟTmT@  #ϟ5b@PG_TD !@@j 17@E@!E@"@c@TJSA@{Ĩ_pG{BES@[C@/؆ 4@5#5@_DD換h!8!-T _q T`@@ 6@ 7р pYѠp ={@7!ѡap@7р@p?!E!@45#5DCc4|@MTGh8Dha86 x!x!?T4|@@7!A]p5`@eC@R0  `8z`@+E/@@B@T9J[BSA@{ƨ_{pGBES[c@C@/34#U5Cs`5I@ގ`@7``p@7 ph@*7!ao1TGD B_mT++@A|t@FTP ?qT@@7`op q TT4qTZq`TqT Dxy,F `2B`2 888$xZ?Dxy =&z@7!aoa@!7!ao!E!@@4#5C 5H@L `@7``o@7Ѡ`xosh@*7!ѡalo1T@s`@7```o` @'@Gc@*T7cc@]` q T T4q!ThwxZ>q Tq!Thwhw8qaTA@9 qT@@9_qaTS!S  hwxhw ZC7cc"oo qT*\E/@@caTSA[B cC`8{ƨy@E/@@B@TH[BSAcC{ƨ_{@T@b6D !@=@Y{_{ ^`@ @{¨ @{¨_ cE{CS[cks*b@wKqT7 8 <;C = BC@ @SrTr@?@?+llRG?@@ܔkTsTয়5K@, *qTTq Tq TOC@K@`_@_ T#R| $o[@ oW@oҏ?@@kT8Tz qTq`Tq!TC@cjbRJk@kJgWk@kfJ?@@eᏛ ?q(T8Tk@_᧟k@@T@6C @Bf!qT@#@qT@@r!TC@O@@@rTrB@BB@C @f|@@_@7@ mp[@nW@nf!EwA"@c@TG{ASB[CcDkEsF _{$@  @{¨_{Sg`@?r!T! !?Qa@7!aam @ґZ@7!сamSA{¨_{S8@TATlF !>@R%y*V`6@5!R?HR?*qT* B`> `!@?; RSA@{è_@cT@c6 @cqT@rTrA@@@A@ƛ Rj{{_{$@  @{¨{S*#RSA{¨N|{S@[_ITs9s~S3R@VIT9@74RFlE !@l$ RFG4RFҠ@m@hZRFajSA*[B@{Ĩ_C E{CS[cksE;@'cAT'AA@6T{ASB[CcDkEsF;@C RR24[A4Q?qh1T@$06ODOR@{@ TD !@ +A*qTD ! @T/AqTD !@խ@~@` baT  b@`aT@3A7A?qvS@4255( `Tng"`.@ `!Tq R@RR:Rq R@R9RRqTqRRRqRRR R @`*** `A`*** _HS[HWS@`W@[ʒ*qTRG Gҿ*qTRK KG@sS@jK@W@j[A RKA?q@#1TI#@@*G@{@_@c[G$ T_@z5`Rs_O@K@W@*_@@@2$`T@${S_q/A$!_qT_xqT끠4_qT_xqATEҜŚ @+Ak `@@kT`A? T`@S`@+A\`@a@g'g@@ !Ob1O@aTF`@a@!`@b4S@R@i`@`4K@_@RҞ%*1T%G@[@RҐ%1Tb@C RS@@ib@Bb4#Ri`@``@` *hhkk@k@k@h@*! @5c@'AA@@TD{A*SB[CcDkEsF;@C _{!@ E@/ T@@7 ! B-!@ ~d@ 1TKE b!E/@"@c@TD @{ƨ_CRO{CS!E[t2@cx@k3$@{@MTD !@bA)_qvSA42~52RTR qT hT RRR hT~~qT gq9Ra R87 RX7q@T*R R RRR*R R***`@F4Rj58`@RqAz T`@T`2@q`T`"@ 5i*gVg*qTR8#h`2@q`T`"@ RCD"1TG@@*"aT@@k#TATf@\$*`1TjK@jO@jW@gE@@B@TC{A*SB[CcDkE3@C_{ES[@7ET7@@ҡT[BSA{ǨRR4c@q(TqT 4qT Q@!$š6a@! @7@@!@TCSA[B{Ǩ_{!@ E@/ T@@7b ! B-!@ *v}d@ҝ1TC`!E/@"@c@TgC @{ƨ_BE{C@ S!X 4@clC4D@{ Am@4@a^Ba^ c(bt!E@"@c@T=C{è_BE{C@ S!@/ 4@c@4D@R Am@4@a^Ba^ c(bt!E@"@c@TC{è_{BES@@/`Rs@53@#XG ``R`C4D@ Dm@4@a^!a^b(a` |!E/@"@c@TBSA@{ƨ_BE{C@C!E 7@"@!T @{¨C@"@@TB{¨_BE{C@C!E 7@"@!T @{¨f@"@@TB{¨_{BES[@@@R?5@XG `@R`B4D@sFm@4@a^!a^b(a` |gRL?*#53A Bb!XGA @am` 7 7@'@Kg?TF!A@TaT#G B !`@b3Sbn@XG b`am@'@AsϠ+@@Asɠ`R3@AXG @`amATlF !@H@AsE@@B@TB[B*SA{Ш_BE{C@CW!E 7@"@!T @{¨B@"@@TA{¨_BE{C@C9!E 7@"@!T @{¨@"@@TA{¨_{ BE !@C@'}@4/@?4D@`7@B!E'@"@c@TA @{Ũ_{ BE ! C@}4@B* 4A!D @/S}!E@"@c@TrA @{Ĩ_BE{C@ !Sb} 4@c7@<1T@B4D@}F!E@"@c@TEA{Ĩ_BE{C@ !S6}@4@cRo7@1T@yB4D@PF!E@"@c@TA{Ĩ_CџEa@{CS[@'ҋT_`A TA!@?R$&RR_`ImT@sF@6D! !@^R@9`7AB A B#!@@.F!TR"Rҟ`@1@T`?Tz L@*_ A*4D@`@7`@fE'@@B@T@{ASB[CC_{S#@@k!D @Ҡ kuRSA@{è_{BESA@'D$*1aTz*s@B4` @t!E'@"@c@T\@SA{Ũ_{cESB[d@?_T`@$*1T  cB5y`@ mTs @@#q7m 7c*@4 @Ot!E?@"@c@T@SA[B{Ȩ_{S[_T@#*1T  C ;ϔ5UyA;E.@?֔@6h`@ @5 5!D B!@p`Qq)T!D B !@e@5@ 5@5!D B !@Qе/55*ʝTD@Fs~|sbs`ȁ@!1@Tt!FSA[B{è_{S*[*`?*54!?@qT`4 FDSA[B{è@SA[B{è_ED@{C@T?@AT @&R**Rυ` @P`4!XD/@!E@"@c@TS?{A_ED@{C@T?@AT @&R +*Rҟ` @ `4!0E/@!E@"@c@T#?{A_CED@{C@'T?@AT @&R@,*Rn`@`4?@ ! @ *`7!F*O!E'@"@c@T>{A@C_BE{S[+A@oҥ"*1aTdx *e>*+4T>@qT8@4D@IFGHW@[@ _@.!Eo@"@c@T>{BSC[D+@_{!ES'm/m# @? >c?;TD@0FEm@)a^a@a^Fm @)ha A`pa^`hp`a^`hp`@a^`hpb`h p@`@7``dd`E?@@B@TQ>'BmSA/Cm#@{Ȩ_ED@{CS[#@oҍT?@ATC @&R`-*Rҕ@!*1aTw c*=*|4=@qT@4 D@:g!Eo@"@c@T>{ASB[C#@_{S[R5D ! @f\`F@@ TD ! @W~ _T`@ BT@7D !` @@`@7``b@57BbbcCѢ7ccc=6D@>a;aFSA[B@{Ĩ_{BES[A@G>6D@o`3*?<5`@6)TO@5Tv``@6R:BѢ"kcD R! @~<@XqTD@}C !` f;lE!@u4va@@7!aA?c`@9c R!EG@"@c@T'=SA[B@{ɨ_{cES[c#d@_T`@t@5B C@ב5:s@;C"R97+@D !@k&+c+@̛7 ;*A1Ti<@qT,qTD@F55a+!F@ @!E@"@c@T4D@`RE_R @{¨_!Rx{ *1Tu`**1TuF?qE!F{_{S_@T C`5@*1aTu@*1aTu **ҵx7FSA{¨_Rp {! 2 C>`7c`.*c@RRc 6*>* @{¨_{S**;*N4D@@*SA{è_џEa@{CS[@/#T_`ATC!!@?R$&RR)lT@#@6D! !@-@`5R@9@7AB A B!@@3|/)'`'@}T;@a@7!aaa.qT FT#`6'@@@'7!{a'@!E/@"@c@Ti;{ASB[C_{S*CRR*;*6D@}*SA{¨_{*1aTt`**1aTt{`|@w{_{RaRZ;6D@Yu{_{&RE  c@@Wc. B@' 4A;E.@?3h`` @O@5!D B!@#@1@T 5#@qT#@ T!D B!@G!F D) E#"|@v!EW@"@c@T: @{˨_{*1Tat`**1TXtF?qE!F{_cE{?qe@S!;6D@R!E@"@c@T:{¨_{S_@T C@a`5@Y*1aTt@g*7* 7FSA{¨_{BES*RQA@/ҿk)TD !@^H`6:sF`J5R`E"bEt @?``@cB+a",R+HR!5cp3B 8a+ R H R!a,@RH@R! R` R!E/@"@c@T :SA@{ƨ_{S_IT 2#ߎ`5-T@*1Ts`#R* 7FSA{¨_O{BESC[#A@G !@ ='u`5>'@`@R7X5s@1Ts c=4`5qmT Rs#@Ҧ9x~Z`^&:aTD@]=]:]EG@@B@T9[BSA@{ɨ_{ BE !`C@7`5@`X@5!E7@"@c@Tu9 @{Ǩ_{#BESA@7 !ݍ`5@@!66X5g  c4:5!E7@"@c@TA9SA{Ǩ_{c98@a5RD@[R{¨_{cES!F'md@7?TD !@k!E u4@3#`6'@!E#@u4@/c`6#@/@(!`Tnj3@!h T !iTn!` hj `g ` a Tn3@!aT @`j}@!amT 8!`ןP!aן?k`T/tjq!`T`78!`nLT a jgjd a/ Tg.\`78!`Tn/ b aVjSE !@#K!`Tn!`Tn!Ae !a@T@a>n@B@aBnF@aF|n `@7`@X`J~@pn[BSA*@ @{ĨkSA[B@@{Ĩ_{z16D{@F{_{A*1aTl*16D{@{|@=n{_E{CS[c+@?҃u@U _T@CMT @4RfRERҥx`O`@*1aTk`@*1aTk `T` @7_*qKTTc."E@4*R*/*v"E61T1@q"c.#E4 55R**l0*^6D@$ u5*Rn6* 4~k`~@m!E?@"@c@T1{ASB[CcD+@_{_ ES[@ET@*1T  c50Mk@*1aTFk @@4@ !**8s7**a1*6@@TDSA@[B{ĨF@@!@T1SA[B{Ĩ_{_ ES[@ET`@B*1T  c ;5+j `@4` @.*1aTj@>**.s@@aT[BSA{Ĩ mD@o!Tj@@@T91SA[B{Ĩ_{_ES[@ET`@*1T  C59j`@`j0va@7!aaW`T0R@@TDSA@[B{Ĩ ~a*rAT`@7``V`T:@@@!@T0SA[B{Ĩ_{ES@ҨRh1*S4G0@q!T-*353@RHm77@RCm63@27@2 D@ F) i!E@"@c@T0SA@{Ĩ_BE{A@O*1aTj*C"14D@ B) ti!E@"@c@Tf0{¨_{_ESE@T`@Cz@5+ C@5#`@B B@4B`=97`4/F)1`T@@aT@SA{Ĩl@4D@Ui@@@T!0SA@{Ĩ_{_ ES@ET`@`5 cԄ5`@`4` @4E)7@-6@@TDSA@{ĨF@@!@T/SA{Ĩ_{_ ES@ET`@`5 c5`@`4` @4E)7@!/6@@TDSA@{ĨF@@!@T/SA{Ĩ_ED@{CS@T?@ATd @&R5*Ru`@O*1aTi`*1*6D@F!E@"@c@Tf/{ASB_E{Fd @@C6S4B)@6/6D@r|@k!E@"@c@T9/{¨_E{CS@/҃t@T _T@BMT#d @7RFR%R}u`"`@m`4 T`@*1Th`RG@**-*Y1TD@`~@j!E/@"@c@T.{ASB@_CED@{CS@'T?@ATd @&R9*R0u`@x`47@*B.*1TD@@X!E'@"@c@T.{ASBC_EDA{CS@/ҍT?@B-T#d @FR :*Rt``@ox`4`@#4#@?@[*/*1TD@F!E/@"@c@T_.{ASB_E{CS@/҃t@T _T@BMT#d @@;RFR%Rҡt`!`@!x`4 T`@*1Tg`RG@**O+*}4D@CF!E/@"@c@T .{ASB@_ED@{CS@T?@ATd @&R`<*RUt`@*1aTsg*>-*<4D@F!E@"@c@T-{ASB_BE{C@C%r!E 7@"@!T @{¨.@"@@T-{¨_{bRcESd@/ 5@3D !@ $8`7#@#`k7k!R*-*4qT-!D @~`4F!E/@"@c@Tg-SA@{ƨ_BE{C@Ca.!E 7@"@!T @{¨r@"@@TH-{¨_BE{C@CB.!E 7@"@!T @{¨?.@"@@T)-{¨_{?1$@S*Z !n 71Ta@*R.*`@)*ht4D@a&@SA{è@TFSA@{è_BD@@T{*1aTyfA!@!` @!@ _kaT**` -{kD !@J{_{*1aTVf*.D !`@5{ ! ?K{_{Sq@|@h@` |@|hawh` arhamh ahh@R`"! |@_h@`& |@Yh"a*Th@a. ! ?@`@7``sR@a2?h`6SA{¨_{BESA@7 !`5 +@? 5`@@!E7@"@c@T;,SA{Ǩ_{BESA@7 !@w`5 @K@5`@@k!E7@"@c@T,SA{Ǩ_{ * @"R{¨S{BES[cA@'qD*qT#@@`b@XbҨR(q*R36V@6v@@`6#QR4@ҿ*T@xu*`7@7р`QE'@@B@T+[B*SAcC{Ũ_{BES[ cksC@GҢގ4@@T@`7D C @!@b@ @ҧ}EbD b@!@ S@5@`T%yf@@T@7D C @!`@b@@TATD ! @ʒoT`@`4@x@1w@@T`V@`6@@t1@TvM< *@6 @ 9-7F@7Ѡ`'Q`@Tb\ @R? T@{tJPqД,;d@@qR@7`Q@ 7 PS@;7@xzcBbG@TZ:;@BT@C@!c1@TCa@A@7!P@7Ѡ`P`@T`V@`6@@xw7р`P@7P)@7`P@7PEG@@B@T*SA*[BcCkDsE{ɨ_{cES[@|@*a@/XfF#B@!F_TD !@$* J7 G;`@1@T f=@7р`VP`@`6R`MPQQ`@7``AP!E/@"@c@T0*SA[B@{ƨ_cE{d@CFcBb @7!APR!E@"@c@T*{è_!E{F4"@C" l!E@"@c@T){¨_BE{FA@BcQ!E@"@c@T){è_BE{FA@#Bc6!E@"@c@T){è_BE{FA@xBc!E@"@c@T){è_BE{FA@Bc!E@"@c@T|){è_BE{FA@Bc!E@"@c@Ta){è_BE{FA@Bcʭ!E@"@c@TF){è_BE{FA@*Bc!E@"@c@T+){è_BE{FA@~Bc!E@"@c@T){è_BE{FA@8Bcy!E@"@c@T({è_BE{FA@1Bc^!E@"@c@T({è_BE{FA@FBcC!E@"@c@T({è_BE{FA@Bc(!E@"@c@T({è_BE{FA@Bc !E@"@c@T({è_!E{F"@C" !E@"@c@To({¨_!E{Fq"@C" ٬!E@"@c@TU({¨_!E{FM"@C" !E@"@c@T;({¨_!E{F"@C" !E@"@c@T!({¨_!E{Fk"@C" !E@"@c@T({¨_!E{F"@C" q!E@"@c@T'{¨_{cESa@'ғa`%SFjBM,b#F@7р`M`@`6R`M!E'@"@c@T'SA@{Ũ_{S[s`* 5`@1@T`&a,E@`@7`@M'"@} hu `@@7`M$ҪH@`@7``zM@\a "@.@!.@h5 R%}kSA*[B@{Ĩ_{S_T@SA{èSA@{è_BVЄE{CS@/҃t@T _T@B T#d @=RFR%Rm`E@T`@ @T*7`@T4`@@TF1 `,E@T4`@T(>`@`d`.@d`.`@T>`@|`d `.@d`.!E/@"@c@T&{ASB@_{S@[" "@!x`x7SA[B{è4``@1 T`,E@[BSA{è_CЄE{CS@'҃t@T@A Td @>R&RRl`2`@a@@wS7a@,E ! @֍@54@@1@T#@Ґ @һ\@7!сaKLa@7!aaDLE'@@B@T4&{ASB@C_ЄE{CS@/҃s@S _T@B T#d @?RFR%Rtl`@`T@]T8!E/@"@c@T%{ASB@_{S@ @[`ҟa@Ab@,@TlFA !*@O@c@@TlF !!@D`U_,Ea@@Ӂ`@@@!6A@t@!!@ @1@T aT`@ 6`@y5_,E@@7р`K@@1@T`@ 7@` 7р KEu@@T@1@T@@7!AK@@7!A{K_8@4F@7р`kK@@7dK`@@7!AWK`@@@7!NKb[BSA{è_{ *3s@a@!1@Ta@7!a3K @{¨_{S*[@@b@ !`&@E>@8F>@8FTaT e@ی`6ҡbA9* 7fA9*7֚FA7@@7!AFRٌ6}FTTF@AT&@`@1@T`@1@TFeBe@ ! C5`5@6@@!6&@@&A6K7Fb9f9@FT !E?4 2`@1@T`FTs@7`:F`@7``3F@7р,F&F!!F!F!EO@"@c@T {ASB[CcDkE_{!E@#@_qT@D@4 ! j ! f @!FEA C!E@"@c@T{¨_{ Ea@@?qTDa@@4 ! < ! 8 FA` @7!AEtG` @ `!E@"@c@T @{è_џEa@{CS@/ҋT_`A T!@?R$&RRe`hmT@F`@qTDa@@4 !  ! ݆`@`"@5`.@4` @@ 7?b5`*@Ta"@TDa !'@`&@5AA !@@`6@R4,`:5@6d @1FB#' !#E]AT`6@:E/@@B@T {ASB@_{S_TlT`  (#s5w@NzX `@qlT c@7!сaDATDa@@4 ! J ! F`@`"@5`.@4` @@ 7a5`*@Ta"@TDa !@(@*`6@R4+`:a&@5 5`#@7!AD`"@4a*@?@T`"@!?Tb@@s`*߮TAT`@" s`6@:}@SA{è_{c@S[#?qTDa@@4 ! څ$ ! օ @X`"@`5,@4@@ 78a5`*@Ta"@Tt*@T Da !(@Ҁ`"@`5c"@˟mT @a@@!_TH @a"@[B!cC#@a"SA{ŨW<`"@`"`6@R~4d+`:a&@!4 5[`M@7!A D @R9"`*MTa>@?JT@!d`.!*A4CTcCЖ@a`"@`" TBTB`T T!F @1@T F x4uW`6@:[BSAcC#@{Ũ_O{BESA@G"R```=]=`6' B !@` 6A aRv`5 ` B!@64"R#@`O>EG@@B@Tw@SA{ɨ_O{BESA@G"R```==`6 B !@ ` aRv`5 B!@`R#@` >EG@@B@T4@SA{ɨ_{!EF "@A!,T`@7``CE@@B@T @{è_{cESb@TlT #ҽq5_@LuV F̚A߾Naa@7!aaB TT4!FҚ!ء!FT@7р@'!D!@MLb@7BbbBaT5V @7рB @`@ `/Z 7@"=`@`=`2?T@2@?R"RRba.!E/@"@c@T{ASB[C_{S@[6 B4a1cY@a@@@T@!@?T @  T u` )͡5M` c)Bup 4bA@T@~K+U`@7BѢbAaT`@B4!1SYBF@nYBF"@u еB)%` &@%aRa` @`@ 7!gASA[BcC{Ĩ_{[ES@@ҡF?T3 eQFlA=`g @7р`5A`@7``.A@F=Q@7!ѡaA@7!сaAa@7!aaAE@@B@TSA[B{Ĩ_{[ESc@@'ҴF!TB;E. ?֡!F@@h`!blFa !`)@N FTlFa !)@CW@T@`6*1TOT`6Da !@*@/BFA#@!T@7@!7!@`@wT7!ѡ!@7!ѡa@lFa !*@A#@7!}@E'@@B@Tj[B*SAcC{Ũ_{(RESc[C c@cc@3b CB+S )/. 4W@4B`I*7sF`NE <`N`,W@RwNE~ jt`5`7O@W@?4D@M`7/@ @1@T `@a@ @b^I)u)Fc!Rj4!E@"@c@TSA[BcC{Ш_{&RcESc[Sc#b@C b c@B+W/ȩ4*`7ۯ/@ @1@T sF`Ea@`*J @t: W@b> a"4F#6Rv* N73 sBxBv0wT`JE`&E@&7!A ?<lFa !@.@>qF!Eg@"@c@TSA[BcC{ͨ_{&RE C @c@b c@B./4*7ɮ/@4*~ lF@7*~-j`5F!E@"@c@T @{Ĩ_֢BE{@@aBҠFϝc`@a6R!>!E@"@c@T{è_{SaD`a@*7!aau>*SA{¨_E;{E.?֤ЄESh`[cw2@@/2Ե@!}`'*4`t@qTt "/4!/`2@w2>E/B@B@T${@SA[BcC_{)E=C=#='=+=/=3=7=JD @/'/ )A@@LҠFE/@@B@T{Ҩ_{)E=C=#='=+=/=3=7=JE @/'/ )A@@@ҠF\E/@@B@T{Ҩ_ր @:{S [ u ";/Ra@4?qT` `/ QxqT` /?qT` /?kTsSA";[B@{Ĩ{D;E.?Sh`[c2@2`@ 9`4s.\`b`@7``_=cC2@2SA[B{ƨ={)E=C=#='=+=/=3=7=JD @/'/ )A@@LҠFE/@@B@T {Ҩ_{)E=C=#='=+=/=3=7=JE @/'/ )A@@@ҠFsE/@@B@T{Ҩ_{SEa@@ҠG?TE?AT` @r4s @Fa@?s€`@1@T`FAȸa@7!a<ҠE@@B@TSA{è_{SEa@@ҠG?TE?AT` @r4s @Fa@?s€`@1@T`FAa@7!a<ҠE@@B@TtSA{è_{#ҢBE A@a !-j4@F@? TDa !/@}) @F$TDa !`0@}(@6Da !1@}F A4@7!1<!E@"@c@T  @{Ĩ_{SE[c@/Ҷ"GNAa@7@T3@`@1T`  0(@2`*F#Bl@7!A;@T A#@7!A;a@7!aa;AE/@@B@TSA[BcC{ƨ_{Se@@$ A_BT#xbaTMT`!1xbBe@T@6cP@c@cATT &O`SA{¨SA{¨SA{¨_{[@S @T@BP@B@@?֠"@T@P@ @1?TO` @@ 7!Aj;`@`@7!SA[B{è^;SA[B{è_{BESA@(~ҠFB@@`@7``<;@7!A4;E@@B@T$SA{Ĩ_{BES*A@` AR1 !FqlTA  *! B)L~@ @!T@?e T@!T@?eT@7!A:Da ! 2@]|@T 6S`@T@6a @`@7``:Da !2@G|`B_8_(q!Tb@!_T" Mia@7!aa:@`@T@`6a @`@7``:Da !2@|!(qTm`@7``:@E@@B@TSA{è_֤E{@A@ҡ!F Cw!E@"@c@Tk{¨_֤E{@A@ҡ!F C\!E@"@c@TP{¨_֤E{@A@ҡ!F CA!E@"@c@T5{¨_{@ScEEg@(@c @C@@!TSA{Ĩ֠FATp@LE?T ? FvB`e&qZ R@@!@TSA{Ĩ_{E"@@$@F"5(CA  c b c-B 3#} @7!A9R!E@"@c@T{¨_{!ES@[cks#@g [_q TD ! @!{ @!4D !%@{Һ`@@B<@_TT@a @7`vA95`b@a !@3@{A@@*@a6qTTD !@z!с|9!F`~A95Da !3@z7F c AO\@@7!AY9d@ М AOM@a@a,aN@!,X@S7!сaB9L``N@a C!4`4K@S@!@uB@SCd@ i AO!baR@K@ 8a#a i:;x ?`@m T`!7 F`@;@P|L` 7`@| @7``8d@kT?@AO@!T@A7D !/@Zz@@6a 3!4m4O@"@@T@7D B @!`0@@@ 7@8@@;@7@`8[S@@S :ҦZӣ 7K@ ! 83@ti{7;`@ TF${?}L7?@ @<@7 `8@e@;@ZAO@!T@A7D !/@y@6ta 3!44O@"@@T@7D B @!`0@@ 7р ^8[@!@7р?T8?@?@U,TS@⯀@S)mT`@!TF8c c- B {L`7@ @Z7р`,8 R9_ TDa !@5@yd@B @7!a8S`@7``8:=d@B V@7!a7Q8FEg@@B@T[BSAcCkDsE{ͨ_{[V;ՠ E. ?#='=+=/=3=7=;=?=!ESj`"@?0@0 )c7@@ 3<*a@7!aa7U7E. ?j` 0@407UE?@@B@TSA[B{Ԩ_{S[LxA ` ! 5)@T@6` @TDa !`6@xv@@1@T@7р`Z7@7Ѡ`S7`@7`L7 887SA[B{è_{Sa ! 7R @SA{èSA@{è_{SR9 @SA{èSA@{è_{S[ L a ` !`75)@T@6` @TDa !7@\xv@@1@T@7р`6@7Ѡ`6`@7`6 77҃7SA[B{è_{SA !`8"Rp @SA{èSA@{è_{Sȋ@U@ @)P@M!F @1@T F`@P@?!F @1@T F`@:@@a}@aP@'!F @1@T F`@O@!F @1@T F`"@O@ !F @1@T F`& `@7``H6SA{¨_{SL!UuU`5@ ѡ6|`6`@6 ``6`6@SA{è_{BES[ckA@Os5G@n`5Q,EA !8@ϮRAT]3R3_@ 43qTTsR3R$3@A4d_@9`,EA ! 9@ԙ`@@7`5EO@@B@T[BSAcCkD{ʨ_ R{S[*OcF 2 Р *!#Q7`**֮6@qT`@4`@ 6 D@``f5c`.c@*"RR6*p `@7`@S5[B*SA@{Ĩ_#R*9{S?H?Ta@7!aa65@T4Da SA! "{¨@Gҭc`a @1!T`@7`5SA{¨_#RR{S[!@N@%^5[BSA{è_C{C[$@S#v *&@KTD@ן*R, @T Р !?)`R8F*!E c A !9@7!a4!F!Upa@7!aa46rEr 5lT R V@A7!4{ASB[C#@C_{ES[*c@_&4:N3 s `b `AbOcF"R#c  </7sO[ic 54444E_@@B@T-[BSAcC{̨_{S*1aTG` RTDSA@{è@<GSA@{è*A*t4Z @!DSA{è @$ML@SA{è_{!E "@ґ D@mM!E@"@c@T @{Ĩ_{SU @@D@a4A !92uKMSA@{è_ c,ˢBE{S*[@@҅1T@*@k D&@@z5 &@j38@T@6UB b!EH"@c@Tv {@ SA[Bc,_CѣcE{S[*Rc#c`@'/kT}R/ظ`?kT/@TQ9(q!*qT/@ ITA !@:bҥ 5//@ c @E'B@B@T( {@SA[BcC#@C_{S!R< @SA{èSA@{è_{S[B@ck?Dq T@C** ,/jE @" !1AT@jE1! !  @!?Tb@7Bbb2jE"  DB***@ `:EE@h`@7``2%3 RBSA@R[BcCkD{Ǩ_{)E=C=#='=+=/=3=7=*%@/'C+ )@!E/@"@c@T {Ѩ_{)E=C=**#= !'=+=/=3=7=%@/'+ )@Z!E/@"@c@TZ {Ш_{B B:cES*D@e@'Bp@rqMT&qLT387s*QR!E'@"@c@T0 SA@{Ũ_{S7|RSA{¨_q D c -xS! {?B C B;c:S`;"R>*a@7!a1*SA{¨_{ES@[cFk+@7^`FT@1@T`[Tt T"R7 5u7R6@ `X5ގ9X5"R@67BтB/7Bтbc1 @?  6%@7р`V1@!T@712@21 6 "Ry@ 67!сa9127!сa11  6 T 5`7"RW62@21@ @=6A3 @7!A1R`@7`0RE7@@B@T [B*SAcCkD+@{Ǩ_{B;E.`?֣@$!! @h`T!DB B=!@XrAB@`6F{_{cEBFS[a@'T 7ZFO611]@@7!A0Č7@@7!02~u6#@00;#@h60@0.@FT@T@@6a ! a)4F[  >#@0@0r0*a@7!aN0E'@@B@T< [B*SA{Ũ_{S!E[@cksZ@#@O!D@95 @]6V "!`./6P7 "Ғ/ 7_T{D " @  @@T @"/7ҟT@!xy479TBo/6% !"h/7_TB`/66@T !"S/@7'  !;BJ/@6G ҁ!EO@"@c@T SA[BcCkDsE{ʨ_ @@?T @Z@ -6Z$@a#@BET @1T _,@$@0@(@DBF?@ >!ƫF?@ ?!(@@ ? @"@_aT @4{S(@SA@ {¨-5`6@NZ``Eb2@@?T#T*q)TR@ ?kB B@B @?b.@ B@ `/SA{¨_{S(@SA@ @-{è5`6@Z`&@ Z@` Ec2@@_TA?aT@ @@9Oc@ Gy/w/@SA{è_{S(@SA@ @-{èd5`6@Y)`&@Y@`Ec2@@? T"_T*q)TR@ _kC c`C `c.@  c@ 4/2/@SA{è_{SE*@@s`@T@6`@SrTra`!a@d @ҟT*Bqc#ks` .@a@.@!1Ta@/-.@ &@BF!E@"@c!TSA@{Ĩ\Y@!F_T&@BFҔN@ @!F&@_T&@!F@ ` aBFM@ .E@@B@T;@SA{Ĩ_@Y{@ST@LT@  C"\5@"@BT@b7 B-!<@ SA{¨WSA{¨_փcE{BES`@[EA@/r5E@m`5D@h5E@c`4#Cq`'@X`ЄF@  RW8@A>a@7!aa-E@c+@..#@../@@ҁT[BSA@{ƨt./@@@TSA[B@{ƨ_{ Yq!F @ {¨_{S]*1aTA n*+*4DSA{¨@X`4FSA{¨_рE{S@_T@3*1T @ C ,\5@`@4i**4!D @mX`4S!EA"@c@T.{@SA_{S_T`@@!T@A7 B6!1@ @ †@ C@ [5 `@*1T@`A @ ! *H7*1*4!D @cX 5FSA{¨_EDA{CS[@/ҍT?@B-T#$ Є@FR*R5M`/`@*1aTR@`@*1aTK@ A @ ! **BH7*** 43@qTX@4FD@!E/@"@c@T{ASB[C_EDB{CS[#@?ҍT?@C-T$ Є@fR*RL`3`@6*1aT?`@s4` @c4[K)A @ !` ***G74*** *4@qTW 4FD@e!E?@"@c@T1{ASB[C#@_рE{CS[c+@O҃t@T _T@E T$ Є@RReRoL`@*1aT?`@*1aT?` @5?)J@7!a+`TT`@Tv@DA ! @OmFFsFT5+T`5Ҟ*R*b9@qTW4Z? D@u!EO@"@c@T{ASB[CcD+@_рE{CS[ck@Wt@gT gY _T@F T$ Є@RReRK `@,*1aT>@ `@%*1aT>`` @15><TJ@7!aK+ATYDA ! @l(yz@TZFt@?TДF`@5ДFДFg@sF_T[5&ҟTQ`5***Z@qTgV4>D@!EW@"@c@T{ASB[CcDkE_{ES@7**36S@qT7V`4 `~@@7@@ ` =D@!E@"@c@TSA@{Ĩ_{ES[@/_T`@f*1T @ C _Y5K> s@\5DA ! @k.Z#@C#$Rs`7X'@**ṇ3@qTU*4R+@*@)?S5D@=E/@@BT[BSA@{ƨ=E/@@B@T;SA[B@{ƨ_{ES[c#@7_ T@*1T @ c@ X5Y= @3=  Ia@7!aa*@T @cJ4/@!ER7@"@TDSA@[BcC#@{ǨuX3Ǣ*;d@qATHU4 @T-D@`@7``)3@!E7@"@c@TSA[BcC#@{Ǩ_{ESB [c#@7_T`@k*1T @ ` bdX5]!=` x@C֢ 4-T`@U*1T=`MR+@R5DA ! @j0P"c$Rr7N/@***:3@qTT*4R3@*@>S5D@s<E7@@BT[BSAcC#@{Ǩ<E7@@B@T.SA[BcC#@{Ǩ_{ES[@/_T`@*1T @ C W5@<t@5DA !@@yj#!C#R5r7ס'@**mKt@q!TXT4+@*=Tl<E/@@BҁT[BSA@{ƨ<E/@@BTD@SA[B@{ƨ_O{ES#[@O```=_ T@r*1T @ ckW5(<@@RO"5aR[`5@b @ B!<0# @ʡ`4#@b'@/@*֡@qTS4D@aT;<+@`.#EO@@B@TV[BSA@{ʨ_{ESB [c#@7_T`@ *1T @ bW5^; v@Cv 4-T`@*1T;`NR+@5DA ! @i1 cRLq7/@***`4@qATmS*43@*<R3@5D@*@s&@~A6x@!R.@s@SA[B@{Ĩ_{F?TF{_C;{E.@?`h`@6{@ `x{_{B;SFE.`?Bh`[@!RS@U @s&@@6x@!R@s@zSA[B@{Ĩ_{F?TF{_{kA@S[!T@cs7!DB B@!@ qlTD`U`@7р@@!@ ? !Ib@4F_T!DD @B !@B@ !G!@44YV@6 T% $ҥ- d @T % -D@B @B |;B6wE`b3T3@cx{{e@@T!D @B !@Bp ^` 7B7@"@@6 7B"" "@A@ ?LC7#!@!@ ?S`@7`a@!@ ?[cC @*Tc{xmAa@67!aa&"!7ba@!@ ? @7!ѡ@!@ ?ց@7!сa@!@ ?S`@7`a@!@ ?ր@7р@!@ ?֠@@7Ѡ@!@ ?[BSAcCkDsE{Ǩ_{S*A1T 5A1T4AR !R~@1T4aRR `D! !`@R RSA@{è_{S@1 T 5A1 T4AR !RzA1 T4aRRYBA1` T`4R@1` T`4RnA1`T`4RA1`T`4RA1`T`4RA1`T`4!RR@}1`T`4ARZ@u1`T`4aRJ@m1`T`4R@e1`T`4R`D! ! @Յ RSA@{è_{S@J1 T 5AD1 T4AR !R:A:1T4aRRA2A01`T`4R@(1`T`4R@ 1`T`4R A1`T`4RA1`T`4R@1`T`4!RA1`T`4AR`D! !@p RSA@{è_{dES[cxFks@o_aT_a*C7_@`D! !@b+T;ՀE. ?֜; aCj`#S`5"@A$@!A$`5@@_7@`!aB`7_@`D! !@rbE. ?֜j`aCR5@A$@!A$5@@_7@` aB7_@z_T@_7` @E. ?֜j`aCR5Κ@A$@!A$5@@_7@` aB7_@z_T@_7` @E. ?֘j`aCR@5@A$@!A$@5@@_7@` a^@*1@T`4aJCk7_@`D! !@a{E. ?֚j`8 #tR5a@ 1T5aA1 T 5`D! !@xA@ $@ $A@ $@ $A@ Rk $@ $ A@@Rk $@ $A@ $@ $`@_7``7 aC7_@_@`@T@7a!D3@u! !`?0 _y @]#;C?BC*T`@xx@@1@T@E. ?֜j`;@R5?@@*A@@$@@$7!Aa\5` @?T`lF! !@ @UaC@k@ x8`@_7``k@U) V)WkraAj1@T 4aC7_@`D! ! !@+a E. ?֛j`: A!Q5C\b@A$@!A$@5@_7`aC@7_@`D! !"@a E. ?֘j`A!Q`5#3*@ $@ $5@_7Ѡ`sLU) V)RaB@1T4a"CI@7_@`D! !@#@`Y E. ?֛j`: A$RQ@5Cb@A$@!A$5@_7`;aJC7_@`D! !$@`/ E. ?֛j`A$)Q 5b@A$@!A$5@_7`azC7_@`D! ! %@w` E. ?֘j`A$Q 5#*@ $@ $Բ5@_7Ѡ`LU)V)@  aB}1T4aJC7_@`D! !%@>` `E. ?֚j`; a&P5a@_1@T@5aAY1 T@5aBS1TA@ $@ $Q 5aBH1TA@ $@ $F 5`D! !@'@A@ $@ $9 A@ $@ $4 A@zR $@ $A@R $@ $A@:R $@ $ A@ZR $@ $A@ $@ $ @_7`jaNCN7_@`D! !(@_^ `E. ?֘j`a&XP5C*@ $@ $5@_7Ѡ`@k@U)* V)N aA1T 4aVB7_@`D! !(@_% `E. ?֛j`: A)P5Cfb@A$@!A$5@_7`arB7_@`D! !*@k_ `E. ?֘j`A)O5#*@ $@ $T5@_7Ѡ`LU) V)z a@r1@zT 4aCy7_@`D! !*@3_ `E. ?֚j`9 !+O5CdB@A$@!A$@5@_7`arB t7_@`D! !,@_ X;`E. ?!+k`O 5#9b@A$@!A$5@_7р`za^C^n7_@`D! !,@^n `E. ?k`!+hO5@* $@ $5@_7Ѡ`PLk@U)V)~ a@1hT 4aB%g7_@_@`@T@7a!D3@! !-I :_) y @gx8 C.;@;7C?_JT`@xz@1@T`E. ?7@< h`;@ Ou5?@@*@@$@@$7!a\s5` @?T`lF! !.@]^ Bk@x:Z`@_7``aC`[7_@_@`@T@7a!D3@! !/n _ y @`l8 C.;@;7C?_JT`@xz@1@T`E. ?7@< h`;@N i5?@Q@*@@$@@$7!af5` @?T`lF! !`0@]- Bk@x:Z`@_7``{U) V)IucR aA1MT@ 4aBOM7_@_@@T@7a!D3@! !@1s d_S  @^8 Z;27C;*T@x{@1@T`E. ?\@k`7@8N[5;@@*@@$@@$7!a"X5 @?T`lF! !2@] Bk@x;{@_7р` U)V) aA1?T 4aB?7_@`D! !@3@_] Y;`E. ?48 4 k`MP5#@* $@ $O5@@_7@`aB97_@_@`@T@7a!D3@ ! !4_ _ z @7J4;C?7@@C*T`@xx@1@T`E. ?< k`;@M`G5?@}@*@@$@@$7!ѡa@\[Y;`E. ?48 > k`K5#@* $@ $45@@_7@`aB 7_@_@`@T@7a!D3@ ! !`?}\_z @7 >;C?7@@C*T`@xx@1@T`E. ?< k`;@K5?@z @*@@$@@$7!ѡa5` @_T`lF! !`@ZC@k@ x8`@_7``j7@g@U) V)Xt@a>@*1T4aC>7_@`D! !`@ZNB;`E. ?T! ! @h`FK5C@* $@ $t5@_7Ѡ`.k@U)V)1a*B1`T`4aC7_@`FaT@_7Ѡ` kB;`E. ?X! !@h`K5C@A$@!A$`5@_7Ѡ`k@U)V)Ia&B1`T4aC7_@`D! ! @DZB;`E. ?T! !@h`J5Ct@* $@ $45@_7Ѡ`k@U)V)7Qan@I1 T 4a"C? 7_@`D! !@ZX;`E. ?: ACk`J5#8@* $@ $5 @_7 `x?@aVC\7_@_@`@T@7a!D3@! !|q_`` @;V7@CGCK7@@O;@?T`@xy@1@T`E. ?k`CG@BJ@5K@*C@&@@$@$7!с+@5` @;@?T`lF! !@YO@@ x99`@_7``?@aB7_@_@@T@7a!D3@O! !| _ @7;@C?CC;@@G_*T@xz @1@T `E. ?k`?@I5C@@*!@@$@@$7!!a|5 @T`lF! !@.YaG@k@ x:Z@_7Ѡ`Fg@U)V)IXKaf@C1`T@ 4aB?`7_@`D! ! @YX;`E. ?: AC k`I@5#2@* $@ $5 @_7 `r?@aVBV7_@_@`@T@7a!D3@! ! z{k_Z` @;7@C GCK7@@O;@?T`@xy@1@T`E. ?k`CG@a"A 1(T@4aB7&'7_@_@@@T@7a!D3@! !Jw;_*Y @h84 ?@;;CCJT@@x{@1@T`E. ?;@< h`?@ E55C@@*@@$@@$7!сa|35@ @?T`lF! !@^TCk@x;{@@_7@`7@aB7_@`D! !@CTB;`E. ?T! !@h`D`-5Ce@* $@ $4,5@_7Ѡ`U) V)@FZ*PaAH *1T@4aB77_@_@@@T@7A!D3@! !` v2қ_Y @$4 "!?@;;CCJT@@x{@1@T`E. ?;@< h`?@mD!5C@@*@@$@@$7!сaW|5@ @?T@lF! !!@SCk@x;{@@_7@`?7@aB#7_@@D! !"@S3B;`E. ?T! ! !@h`+D`5C@* $@ $45@_7Ѡ`U) V)@qaA 1T`4a.C`64R_@@FaT@_7`kB;`E. ?Z! ! #@h`C5CB@A$@!A$5@_7`aC7_@@FaT@_7`gB;`E. ?Z! ! #@h`C 5#]B@A$@!A$` 5@_7`aC`7_@@FaT@_7Ѡ`cB;`E. ?X! ! #@h`C`5+@A$@!A$ 5@_7Ѡ`lLk@U)V)a@D! !#@xu_@[@Eo@@B@TI[B*SAcCkDsE{Ψ_{DE[LBScks@GC7C@@FaT`@C7``$? B;`E. ?U! !@$@h`C4C@zE@A$@!A$5`@C7``C 7C@5@D! !$@gR8RS;`E. ?x; aC$`j`B`5@A$@!A$ 5@C7Ѡ`*C7C@@D! !%@;R`E. ?x`j`aC$B@5Ċ@A$@!A$@5@C7Ѡ`B7C@@D! !`&@R`E. ?x`j`aC$B`5@* $@ $X5@C7Ѡ`Bl7C@@FT@C7Ѡ`uo@g`E. ?|`j`aC$nB`5m@A$@!A$`5@C7Ѡ`YB=7C@@FT@C7р`Fk@c`E. ?u`j`aC$?B5>@A$@!A$5@C7р`*GL) M)Mx@@EG@@B@TSA*[BcCkDsE{ɨ_{DE[LBSckCs@OK 7K@6@D! !@'@eQ;R4S;`E. ?{7 '`j`A4K@#JDb@A$@!A$5@K7`JB`7K@@FaT@K7`C`E. ?{`j`'A5bb@A$@!A$5@K7`C`7K@@FaT@K7`?`E. ?{`j`'A5HEb@A$@!A$5@K7`t*CX7K@@D! !`(@Ps`E. ?{`j`'bA5ab@A$@!A$5@K7`MB17K@@D! ! )@PL`E. ?{`j`';A5:a@* $@ $5@K7`%B 7K@@FT@K7`w@o`E. ?|`j`' A5 @A$@!A$5@K7`B7K@@FT@K7р`s@k`E. ?u`j`'@ 5ۈ@A$@!A$ 5@K7р`GG@M)N)uF  @EO@@B@TSA*[BcCkDsE{ʨ_{DЄE[lCScks;@g_N7_@_@@T@7A!D3@ۇ !)rbҖ__ @J@; 7*?CJT@xw @1@T @E. ?7@; h`?@h@G5C@Lb@*!@@$@@$7!!aR{E5 @T@lF !+@O!@Cc@x7@_7р`:aVB B7_@_@@T@7A!D3@x !,Br3_ @7`> *C@;?G7@jT@xx@1@T@E. ??@; h`C@@ ;5G@b@*@@$@@$7!a 85 @7@?T@lF !`-@TO Cc@x8@_7р` aC57_@@FaT@_7` [B;@E. ?X !*@h`?15@A$@!A$05@_7` aC@/7_@_@`@T@7A!D3@ !@.qhҜ_e` @7+ *C@;?G7@T`@xw@1@T@E. ?K?@< h`C@l? (5HP@*K@@$@@@$7!ѡaU %5` @7@?T@lF !@/@N#Cc@x7`@_7``< aC `"7_@_@@T@7A!D3@z !@0Dq5_ @7b *G@;?K7@JT@x{@1@T@E. ?O?@!C?@ h`G@?5IC@*O@#@@`$@`$7!ѡ @B5 @7@?T@lF !@1@ONBc@x;{@_7р` aC7_@@FaT@_7` WB;@E. ?[ !*@h`>@5b@A$@!A$5@_7` aB7_@_@`@T@7A!D3@܅ !@2pcҗ_`` @7 *C@;?G7@T`@xv@1@T@E. ?K?@< h`C@g>5H@*K@@$@@@$7!ѡaP <5` @7@?T@lF ! 3@MBc@x6`@_7``7 J3 ;@:dR4`7L5A;@_@  RA!Eg@"@c@TSA[BcCkDsE{ͨ_{DЄE[CScks;@_W 7W@7@D ! 4@gM3RT;@E. ?֚ 5j`=5B@A$@!A$5@W7` aB7W@@D !5@;M@E. ?֚j`5=5cmB@A$@!A$5@W7` aB7W@W@`@T@7A!D3@ !6oҧW` @735?C3@@G7@JT`@xw@@1@T@@E. ?֜j`?@y=` 5C@!@*A@@$@@$7!Aac < 5` @7@?T@lF !`7@L>G@[@ x7`@W7``J aB.7W@@D !@8@LG@E. ?֓j`58=@57a@* $@ $35@W7`" I3@@e;@ W@ "@E_@@B@T[B*SAcCkDsE{̨_{DЄEkBS[c+@?; 7;@3@D ! 9@YL5RWX;@E. ? A:k`<4;@ @* $@ $u5b@;7Bbb ZC 7;@@FaT`@;7`` 3@E. ?k`A:<5T"@A$@!A$`5`@;7`` Fcv@E?@@B@TSA*[BcCkD+@{Ȩ_EE{CDFS[cks@ocaT_a*CK 7c@@D !:@KHX;@E. ? Ac;k`S<@5Rb@A$@!A$@5@c7`> aB"7c@@D !<@K@E. ?k`Ac;,<`5+b@A$@!A$`5@c7` aB 7c@@D !<@{K@E. ?k`Ac;<5b@A$@!A$5@c7` aB@{7c@@D !=@TK@E. ?k`Ac;;5݃b@A$@!A$5@c7` abAf1`vT4aCu7c@@D !>@'K@E. ?k` !`?;5CX@* $@ $5@c7Ѡ` k@V)W)taZA-1@oT`4aCnn7c@@D !@Jk@E. ?k` !w;5i6@ $@ $M@`@A$@1@T``@!A$c7``Y V)W)LR7aVA*1 gT@ 4ajC-`f7c@c@@T@7A!D3@ !QmBc @o Z;;C?*T@x{@1@T@E. ?\@k`;@;~5?@@*@@$@@$7!a ||5 @?T@lF ! @gJBk@x;{@c7Ѡ`V)W)OaNA}1@YT@!4aBX7c@c@`@T@7A!D3@ ! lcz @;s C@;?CGjT`@xx @1@T @E. ??@< h`C@:p5G@M@*!@@$@@$7!!a\n5` @_T@lF !@Ih;@k@@x8`@c7``vajC?XK7c@c@`@T@7A!D3@ !|lCmcIz @g K@;CCOT`@x|@1@T@E. ?C@!GC@ h`K@=:c5O@*G@#@@`$@`$7!%@`5` @_T@lF !@I Ck@x<`@c7`` ?@arC>7c@@FaT`@c7``kB;@E. ?U !@h`9Z5CR<@A$@!A$X5`@c7``;@k@V)W) WaJAn*1@7T-4aB67c@@D !@.I@E. ?k` AC 9R5#_@* $@ $vQ5 @c7 `ajCC07c@c@@T@7A!D3@ۀ ! klҖcr @; L@C K@;?CO;@@ST@x{@1@T@E. ??@!G?@ h`K@d9`H5O@*G@#@@`$@`$7!сL@E5 @?T@lF ! @H$S@k@ x;{@c7`3C@aC#7c@c@`@T@7A!D3@q ! ;k,c| @Y?>@C O@;GCS?@@WT`@xx @1@T @E. ?G@!KG@ h`O@8 ;5S@[;*K@&@!@$@$7!!@85` @T@lF ! @IHW@k@ x8`@c7``C@aC7c@c@@T@7A!D3@ ! jc @C1@C GCKC@Y;@O_*T@xz@1@T@E. ?< k`G@8.5K@ @*@@$@@$7!a\,5 @T@lF !@GXO@k@ x:Z@c7Ѡ`g GC@g@V)W)(Aa^A*1T4aBC:7c@@FaT`@c7``CkB;@E. ?U !@h`;8@#5C:@A$@!A$ "5`@c7``%k@cW)SV) RT)L)aFA1aT6R4abC 7c@@FaT@c7`kB;@E. ?Z !@h`7@5CjB@A$@!A$5@c7`aBC`7c@@FaT`@c7``gB;@E. ?U !@h`75#":@A$@!A$5`@c7``L[W)SV)RT)L)8R*aRA71T 4ajCx7c@c@@T@7A!D3@~ ! icҍci @  Z;;C?*T@x{@1@T@E. ?\@k`;@a75?@@*@@$@@$7!aK5 @?T@lF !@F$Bk@x;{@c7Ѡ`3SV)cW).RT)L)@D !@9ic@ @Eo@@B@T {A*SB[CcDkEsF_{DES[ckZZFs@G;TR_*C37;@@D !@@TFT;@E. ?֜ aj`615~@A$@!A$05`@;7``B.7;@@D !@+Fl@E. ?֜j`a6 ,5~@A$@!A$ +5`@;7``B)7;@@D !@FE@E. ?֜j`a6@'5~@A$@!A$@&5`@;7``yB]$7;@@D !`@E@E. ?֜j`ag6`"5f~@A$@!A$`!5`@;7``RB1 T 4BC0@7;@@D !@@E@E. ?֓j` a9658a@* $@ $s5@;7р`"zB7;@uaT@@;7@`?@E. ?֙j`a 65"@A$@!A$5@;7Ѡ`G[L)kM)4@D ! @[E !RA}1T4BC7;@@D !@>E@E. ?֓j` !`5`5(8a@* $@ $3 5@;7Ѡ`C@[L)kM)4@D !@EUҡARBB;1 T@4BC|7;@@D !@D=@E. ?֓j` !5 57a@* $@ $5@;7Ѡ`nC@[L)kM)4@D !@D_`aRd)T) @D !`@lg;@ 3R@EG@@B@T=[B*SAcCkDsE{ɨ_{DES[cXFks@_O?TR_c*C17O@@D ! @DS;@E. ?| a`j`5.5S}@A$@!A$-5@O7Ѡ`B`,7O@@D !@_DZ@E. ?u`j`a4)5C|@* $@ $(5@O7р`B`'7O@|T@O7`@@E. ?a`j`3a4$53|3@#@a$@!a$"5@O7р`B!7O@|T@O7`@@E. ?a`j`3a4 5#|3@#@a$@!a$5@O7р`u@1T`4CS7O@{aT@O7`^W@E. ?|`j` !W45@A$@!A$`5`@O7``@BC$7O@{aT@O7`/S@E. ?x`j` !(456@A$@!A$5`@O7``rB@7O@O@`@T@7!!D3@P{ ! fh Oe` @38  7;C?3@_JT`@xz @1@T @E. ?|`j`7@3`5;@Q@*!@@$@@$7!!a<5` @3@?T lF !!@-C&?@[@ x:Z`@O7``oJSQ)gR) !R X)L)  D !"@eO@P5R E_@@B@TSA*[BcCkDsE{̨_C$E{S[c8Fks@oaT_ca*CN 7o@ D !"@BpY;@E. ?< a# k`V3`5SU{@A$@!A$`5@o7`AaB% 7o@ D !$@BG@E. ?< k`a#/35C.{@A$@!A$5@o7`aB 7o@vT@o7` @@E. ?< k`a#3 53{@A$@!A$ 5@o7`aB7o@vT@o7`@@E. ?< k`a#2@5#z@A$@!A$@5@o7`a@]1T ?4aBC 7o@ D !$@B@E. ?; k` %255b@A$@!A$`5@o7`aVBu7o@ D ! &@A@E. ?6 k`%25@* $@ $65`@o7``garBK7o@o@ @T@7!!D3@y !&od`oa @GC %O@;KSC@@WG@jT @x{@@1@T@@E. ?K@< h`O@/25S@@*A@@$@@$7!Aa\5 @G@?T lF !'@AwW@@ x;{ @o7 `aBc7o@o@ @T@7!!D3@=y !(dTo @K%G %W@;O[G@@_K@_ T @xz@1@T@E. ?O@!SO@ h`W@1@5[@m*S@#@@`$@`$7!с@5 @K@?T lF !)@A _@@ x:Z @o7 `avCw@7o@ FaT@o7р`wB;@E. ?Y%@h`y15!"@A$@!A$5@o7р`baCF 7o@ FaT@o7р`OsB;@E. ?Y%@h`H155"@A$@!A$5@o7р`2aC 7o@o@`@T@7!!D3@px !*:c+o,x @XK Z;%OSJT`@xu @1@T @E. ?\@k`O@05S@@*!@@$@@$7!!a\5` @T lF !+@P@HK@@@x5`@o7``HNOK@'Y) Z)FT,a.@_1 T ?4aBC`7o@ D !,@ @ E. ?; k` -05 3b@A$@!A$5@o7`aVBw@7o@ D !`.@? E. ?6 k`-05@* $@ $v5`@o7``iarBM7o@o@ @T@7!!D3@w !@/qbboc @GC`-O@;KSC@@WG@jT @x{@@1@T@ E. ?K@< h`O@105S@@*A@@$@@$7!Aa5 @G@?T lF !@0@?yW@@ x;{ @o7 `aBc7o@o@ @T@7!!D3@?w !@1 bVo @K'G`-W@;O[G@@_K@_ T @xz@1@T E. ?O@!SO@ h`W@/5[@o*S@#@@`$@`$7!с@5 @K@?T lF !`2@? _@@ x:Z @o7 `avCy7o@ FaT@o7р`wB; E. ?Y-@h`{/5#"@A$@!A$5@o7р`daCH`7o@ FaT@o7р`QsB; E. ?Y-@h`J/53"@A$@!A$5@o7р`4aC`7o@o@`@T@7!!D3@rv !3JK@@@x5`@o7``HNOK@'Y) Z)@.aj@a*1@zTH4aBCy7o@ D !5@!> E. ?6 k` 6.5 1@* $@ $5@o7`anBw@t7o@o@@T@7!!D3@u ! 7`Ҍo @GC{6KOC@@SG@_T@xz@1@T E. ?; k`WK@].@x5O@W@b@*W@@$@@@$7!ѡaEu5 @G@?T lF !8@=S@@ x:Z@o7`,aCc@g7o@o@@T@7!!D3@iu !83`$o% @KQGn6W@;O[G@@_K@? T@xy@@1@T@ E. ?O@!SO@ h`W@-j5[@*S@#@A@`$@`$7!A@"h5 @K@?T lF !9@>=6_@@ x99@o7`arBY7o@o@@T@7!!D3@t !:_Ҹo @OK a6W[K@\;@_O@?T@xy@@1@T@ E. ?ցk`SW@-]5[@*S@#@A@`$@`$7!Ap@[5 @O@?T lF !;@<_@@ x99@o7`VaB:L7o@o@@T@7!!D3@t !`<^_OoP @|OT 6[@;S_? T@xy@@1@T@ E. ?S@!WS@ h`[@-P5_@*W@#@A@`$@`$7!A@M5 @T lF !`=@m<eO@@@x99@o7`aC?7o@o@@T@7!!D3@+t !`>^Bo @SF Z;6W[JT@xu @1@T  E. ?X@k`W@,C5[@@*!@`$@`$7!!aA5 @T lF !`?@ <S@@@x5@o7р`H IY)C@ @Z)UP=aA11T4aC\07o@uaT@o7Ѡ`g E. ?8 k` !``,85@A$@!A$`75@o7Ѡ`I@Y)Z)9H5a@1*T 4aC@)7o@o@`@T@7!!D3@ys !C^4o5x @a0 CGBK_*T`@xz@1@T E. ?< k`C@,-5G@@*@@$@@$7!a\+5` @T lF !@@X;PK@@ x:Z`@o7``Y)Z) p'R=a&@m1T 4aC 7o@o@`@T@7!!D3@s ! ]oy @" G@;CK_JT`@xz@1@T E. ?C@< h`G@+@5K@=@*@@$@@$7!a5` @?T lF !@:C@x:Z`@o7``gaCcJ7o@ D !`@:lZ; E. ?V a@k`R+5@* $@ $5 @o7 `:aC 7o@ FaT`@o7``' E. ?U@k`a!+5.@A$@!A$5`@o7`` OY)Z)>+laA1 T4aBC`7o@ D ! @`: E. ?: k` * 5B@A$@!A$5@o7`aCcG7o@o@@@T@7!!D3@r !\%oY @C@O@;KSC@@WJT@@x{@1@T E. ?K@< h`O@*5S@@*@@$@@$7!a5@ @?T lF !@9W@@ x;{@@o7@`kG@aCO@7o@ D ! @9qB; E. ?Y@h`X*5*!@ $@ $V5@o7Ѡ`@OC@Y)Z)a:@1T4aC7o@ D !@ @97 E. ?: k`  *`5B@A$@!A$ 5@o7`aJCc7o@ D ! @j9 Y; E. ?; k`)5b@A$@!A$5@o7`aC7o@ D !` @A9 E. ?6 k` )5s@* $@ $5@o7Ѡ`OY)Z)@ba@G1 T4aCc@7o@ D ! @9X; E. ? ! k`)57b@A$@!A$@5@o7`xaJB\7o@ D !@8~ E. ?k`! f)`5b@A$@!A$ 5@o7`OaC37o@ FaT@o7`<{ E. ?k`! 6)`5b@A$@!A$ 5@o7`a~C7o@ D !`@8% E. ?k`! )@5 q*@ $@ $65`@o7``O@Y)Z)@z`Wa@1T,4aCc7o@ D ! @J8 X; E. ? ak`(5z"@A$@!A$5@o7`aB@7o@ D !`@8  E. ?k`a(5Q@* $@ $v5 @o7 `arBu7o@o@ @T@7!!D3@o !Z Ҋo  @GC``OSC@@WG@_*T @xz@1@T E. ?k`KO@[Z(5S@[@*K@[@#@@`$@`$7!ѡ@@5 @G@?T lF !@7 W@@ x:Z @o7 `&a^C 7o@o@ @T@7!!D3@do !.Z{ o  @KLG`SWG@@[K@_*T @xz@1@T E. ?k`OS@_'5W@_@b*O@_@#@@`$@`$7!ѡ@5 @K@?T lF !@@:72 [@@ x:Z @o7 `aC@7o@ FaT`@o7`` E. ?k`a'5`+@A$@!A$5`@o7``HO@Y)Z)Q a*@1T,4aCc^ 7o@ D ! @6 X; E. ? ak`f'`5"@A$@!A$ 5@o7`OaB37o@ D !@6U  E. ?k`a='@5@* $@ $5 @o7 `%arB 7o@o@ @T@7!!D3@cn !@-Yz o  @GKC`OSC@@WG@_*T @xz@1@T E. ?k`KO@[&`5S@[@a*K@[@#@@`$@`$7!ѡ@5 @G@?T lF ! @961 W@@ x:Z @o7 `a^C y7o@o@ @T@7!!D3@m !X ҳo  @KG`SWG@@[K@_*T @xz@1@T E. ?k`OS@_&}5W@_@*O@_@#@@`$@`$7!ѡi@"z5 @K@?T lF !@5 [@@ x:Z @o7 `OaC3k7o@ FaT`@o7``< E. ?k`a6&`s5)@A$@!A$@r5`@o7`` HO@Y)Z)`p aB1dT@ 4aCcKc7o@ D !@q5 X; E. ? Ak`%k5@* $@ $vj5 @o7 `K@arB^7o@o@`@T@7!!D3@m !W6 o ` @GC`e@SWC@@[G@?T`@xy@1@T E. ?k`OS@%b5W@*O@#@@`$@`$7!с@b_5` @G@?T lF !@4 [@@ x99`@o7``yK@a^C]Q7o@o@@T@7!!D3@l !W ros  @G`X@KOG@@S_*T@xz @1@T  E. ?k`K@E%@U5O@@*!@@$@@$7!!a/S5 @T lF !@4 S@@ x:Z@o7Ѡ` H@Y)Z))YOx a@*1CT@ 4aCcKB7o@ D !`@i4 X; E. ? A k`$J5@* $@ $vI5 @o7 `K@arB=7o@o@`@T@7!D3@l ! V. o ` @GC`D@ SWC@@[G@?T`@xy@1@T E. ?k`OS@$A5W@*O@#@@`$@`$7!с@b>5` @G@?TlF !@!@3 [@@ x99`@o7``qK@a^CU07o@o@@T@7!D3@k !"yV jok  @G`7@ KOG@@S_*T@xz @1@T  E. ?k`K@=$@45O@@*!@@$@@$7!!a'25 @TlF !"@3 S@@ x:Z@o7Ѡ` H@Y)Z)A.p a"B*1"T!4aBcG`68Ro@o@@@T@7!D3@9k !#VP oY @!C( @$O@;KSjT@@x{@1@T E. ?K@< h`O@#`%5S@@*@@$@@$7!a<#5@ @?TlF !$@3 C@@@x;{@@o7@`G@arB{`7o@o@@T@7!D3@j !%UҐo @  @$S@;KW_T@xz@1@T E. ?K@!OK@ h`S@`#5W@*O@#@@`$@`$7!H@5 @TlF !`&@2 C@x:Z@o7р`/G@aC`7o@FaT`@o7``B; E. ?U !@$@h`# 5&@A$@!A$5`@o7``C@@Y)Z)a *`a2@1@T@!4aBcG@7o@o@@@T@7!D3@)j ! 'T@oY @C (O@;KSjT@@x{@1@T E. ?K@< h`O@"`5S@@*@@$@@$7!a<5@ @?TlF !(@2C@@@x;{@@o7@`G@arBk7o@o@@T@7!D3@i !)TҀo @ (S@;KW_T@xz@1@T E. ?K@!OK@ h`S@P"5W@*O@#@@`$@`$7!8@5 @TlF !`*@1 C@x:Z@o7р`G@aC7o@FaT`@o7`` B; E. ?U !(@h`" 5%@A$@!A$5`@o7``C@@Y)Z)@NafA*1@T 4aCc`7o@D !@+@@1Y; E. ?6 , k`!5p@* $@ $V5@@o7@`a~B7o@o@`@T@7!D3@h !,Sҩoz @֪C@,GKC@@O*T`@xx@1@T E. ?< k`G@|! 5K@@*@@$@@$7!ѡaf5` @_TlF !`-@0O@@ x8`@o7``NC@@Y) Z)`aA1T 4aBc"7o@FaT@o7`+B; E. ?Z !@.@h`#!5B@A$@!A$5@o7` aB`7o@FaT@o7Ѡ`B; E. ?X !@.@h` 5@A$@!A$5@o7Ѡ`OY) Z)-Z<aAo1 T34arBc@7o@o@@T@7!D3@ h !.R o @C /K@;GOjT@x{@1@TE. ?G@< h`K@ `5O@ @*@@$@@$7!a<5 @?TlF !0@/C@@@x;{@o7`gaBK7o@o@@T@7!D3@g !0oR`oa @G /O@;KSjT@x{@1@TE. ?K@< h`O@2 5S@@*@@$@@$7!a5 @?TlF !1@/{G@@@x;{@o7`a^C@7o@o@@T@7!D3@Ag !2 RXo @) /S@;KWT@xv@1@TE. ?K@!OK@ h`S@ 5W@@*O@#@@`$@`$7!@5 @TlF !@3@/ C@x6@o7р`aB@7o@o@`@T@7!D3@f ! 4QҔoz @K X;/OSJT`@xu@1@TE. ?k`O@h5S@@*@@$@@$7!aR|5` @_TlF !5@.K@@@x5`@o7``9HK@Y)Z) BkaA1T34arBc 7o@o@@T@7!D3@ff !50Q}!o" @NC@ 6K@;GOjT@x{@1@TE. ?G@< h`K@5O@g@*@@$@@$7!a܈5 @?TlF !`7@D.<C@@@x;{@o7`aB`z7o@o@@T@7!D3@f !@8Pҽo @G 6O@;KSjT@x{@1@TE. ?K@< h`O@~5S@I@*@@$@@$7!ay\|5 @?TlF ! 9@-G@@@x;{@o7``a^CDm7o@o@@T@7!D3@e !:hPYoZ @@u 6S@;KWT@xv@1@TE. ?K@!OK@ h`S@)q5W@*O@#@@`$@`$7!@"o5 @TlF !:@w-o C@x6@o7р`aBܻ`7o@o@`@T@7!D3@6e !;PMoz @K@h X;6OSJT`@xu@1@TE. ?k`O@@e5S@9@*@@$@@$7!ac5` @_TlF !<@-K@@@x5`@o7``HK@Y)Z)07a"@)1`ST 4aCciR7o@D !=@,Y;E. ?6 AC> k`qZ5@* $@ $vY5@o7`Ya>C=M7o@FaT@o7Ѡ`FE. ?8 k`AC>@T5@A$@!A$`S5@o7Ѡ`)OY) Z)GQa@*1ET@ 4aFCc E7o@o@@T@7!D3@Xd !>"Ooo @@L Z;?CG*T@x{@1@TE. ?\@k`C@I5G@q@*@@$@@$7!a\G5 @?TlF ! @8,0B@x;{@o7Ѡ`Y)Z) a@N18T@4a:CcG77o@FaT@o7`B;E. ?Z !@h``>5B@A$@!A$@=5@o7`xG@aFC\07o@o@`@T@7!D3@c !Nqorz @C@8 O@;KS?jT`@xy@1@TE. ?K@< h`O@C55S@@*@@$@@$7!a-25` @_TlF !@+C@@@x99`@o7``G@a&C`$7o@FaT`@o7``B;E. ?U !@h`+5c@A$@!A$*5`@o7``C@@Y)Z)Ay')Da@w1 T 4aFCc`7o@o@`@T@7!D3@c !`M)oy @# Z;CC T`@x{@1@TE. ?\@k` 5C@@*@@$@@$7!ѡa5` @?TlF !@*B@x;{`@o7``uY)Z)HfaA 1T 4aFCcK7o@o@`@T@7!D3@b !oM`oay @  Z;C T`@x{@1@TE. ?\@k`5@5C@@*@@$@@$7!ѡa <5` @?TlF ! @*B@x;{`@o7``Y)Z)Mja@1T4aCc޸ 7o@5D !@^*6RXB;E. ?V !@h`@ 5@* $@ $5@o7Ѡ`@Y)Z)A`/aAb1T4 Y)Z)="ab@U1T4 Y)Z)P`av@H1@T4 Y)Z)PD !@ @Lo@QE@@B@T{B*SC[DcEkFsGC_{Ek`CS[csc@WOU 7O@XD ! @) RgU;E. ?ֶ ! j`[ 5Cg@ $@ $g@5@O7`BaB&@7O@FaT@O7`/GE. ?ּj`! )5#@A$@!A$5@O7`arB@7O@O@`@T@7!D3@Pa !` L` Oz @8 7;C??*T`@xy@1@TE. ?ּj`7@5;@S@*@@$@@$7!a|5` @_TlF !@ @0)!?@S@ x99`@O7``H3D ! @) ҤTO@X8EW@@B@TSA[BcCkDsEg@{˨_{ @7!A RMR{_A ! b@*@@$@@$7!сaF5 @TlF !@- C[@x:Z@S7`3@aCC7S@SCS@@T@a7!D3@U !@ @3ė@@ @Z;CDG3@T@x{@1@TE. ?A@k`7C@h*<5?@W TaA1@ T 4a*C;:@ 7W@D !@Y7@ !`@G 5sFV7@#@a$@!a$`5@W7р`1;@aC7W@D !@4E. ?W@k` !`7@57@*@ $@ $57@W@7р`[@@{G@ !@@W@<R<RE. ?Bk`@A$@!A$7Ѡ`|,5 @3@?TlF !@FXCx;{[@S7`|)!RGa@]1 (T 4arB`'7S@S&S@@T@a7!D3@T !?& @$ Z;c3?-T@x{@1@TE. ?\@k`  !53@@*@@$@@$7!at5 @?TlF !@B[@x;{@S7Ѡ`\Y|ARa@1T 4arB27S@D !@B;E. ?V !@h`:  5@A$@!A$5@S7Ѡ`#[@0a@1T4aZB37S@S@`@T@7!D3@TT !@ ?Sx @<@ Z;B!7;-T`@xy@1@TE. ?\@k`7@ @ 5;@@*@@$@@$7!a 5` @TlF !!@4FB[@x99`@S7``3@avC7S@D !"@-B;E. ?W !@!@h` 5I@A$@!A$5@S7Ѡ`[@yD !#@>S@7!Ew@"@c@TjSA[BcCkDsE{Ϩ_{cESb@'D7#@@=@6`@7``M!@U`@7``B4RbR @*7!ѡa4`@7`-RE'@@B@T@*SA{Ũ_{B;SE[a@@'҅@E.`?Uh` 0@`T0@bBDV@p ?!T5C@Bp AT`!F!@@Tx`56R֚FsqTTt!DaT @7 `R!F!_!DTa@@@T@7!AV5E'@@c@TSA[B{Ũ_{B;SE[a@@'҅@E.`?Uh` 0@`T0@bBDV@P?!T5C@BPAT`!F!@@T`56R֚FqTT!DaT @7 `JR!F\!!DTa@@@T@7!A2V5E'@@c@TSA[B{Ũ_{B;SE[a@@'҅@E.`?Uh` 0@`T0@bBDV@0?!T5C@B0AT`!Fڏ!@@T|`56R֚FڏwqTTڏx!DaT @7 `R!F!c!DTa@@@T@7!AV5E'@@c@TSA[B{Ũ_{B;SE[a@@'҅@E.`?Uh` 0@`T0@bBDV@#?!T5C@B#AT`!F̏!@@T`56R֚F̏qTT̏!DaT @7 `NR!F!!DTa@@@T@7!A6V5E'@@c@T#SA[B{Ũ_{B;SE[a@@'҅@E.`?Uh` 0@`T0@bBDV @*?!T5C @B*AT`!Fӏ!@ @T`56R֚Fӏ{qTTӏ|!DaT @7 `R!F!g!DTa@@@T@7!AV5E'@@c@TSA[B{Ũ_{B;SE[a@@'҅@E.`?Uh` 0@`T0@bBDV@2?!T5C@B2AT`!F!@@T`56R֚FqTT!DaT @7 `RR!F!!DTa@@@T@7!A:V5E'@@c@T'SA[B{Ũ_{SE[a@@'F#0@a T@B;E.?Uh``T0@ a@:?a T5@:_Tc!F!OT`@T`56R֚F}qTTO~!DT @7 `R!Fq!Si!DATc@@T@7!AV5#a@:?TFqbS#5BDE'@@c@TSA[B{Ũ_{B;SE[a@@'҅@E.`?Uh` 0@`T0@bBDV,@?!T5C,@BAT`!Fŏ!@,@T`56R֚FŏqTTŏ!DaT @7 `@R!Fю!!DTa@@@T@7!A(V5E'@@c@TSA[B{Ũ_{B;SE[a@@'҅@E.`?Uh` 0@`T0@bBDV0@ ?!T5C0@B AT`!F!@0@Tr`56R֚FmqTTn!DaT @7 `R!F!Y!DTa@@@T@7!AV5E'@@c@TSA[B{Ũ_{B;SE[a@@'҅@E.`?Uh` 0@`T0@bBDV8@?!T5C8@BAT`!F! @8@T`56R֚FqTT!DaT @7 `DR!F!!DTa@@@T@7!A,V5E'@@c@TSA[B{Ũ_{B;SE[a@@'҅@E.`?Uh` 0@`T0@bBDVt@?!T5Ct@BAT`!F!@t@Tv`56R֚FqqTTr!DaT @7 `R!F!]!DTa@@@T@7!AV5E'@@c@TSA[B{Ũ_{  P`@7`@7`` F @{¨_{S@a@7!aaqSA{¨_{S+Tbh8ahs8$b7s" !qaTs _qaTs ?qaTs D !`$@SA{¨_{  @{¨:& @{¨_{_ESE@'T`@@!T@A7B B-!1 $-  C$5`6U@!T`@!FT@!T@6E#@@TD !=@a B`7!< $-Z`'@@!ҡTSA@{ŨcoF'@@!@TǭSA@{Ũ_{ESBF@E?T!@!T@6@@TD !=@ B`7!@ %D-D@n @@!ATSA{èo@@@TSA{è_{_ ES[@ET@!FAT c`%35H@!T@A68 @T  B`7!1 `%,3Ҁ@@!T@A7B B-!< `%,% @TD !=@ @*1aT*l@@!aTSA[B{Ĩn@@@TSA[B{Ĩ_{_ESE@T@!FAT C%5A@!T@A6@?@T  B`7!1 %,,Ҁ@@!T@A7B B-!< %{,@@TD !=@;R@@!aTSA@{ĨGn@@@TSA@{Ĩ_{@S!EE#@AT@A7B B-!@ %<,k @TD !=@Rƭ@@!ATSA{è n@@@ToSA{è_{cES[Eb@'҂_T@$*1T  &C"5FT@!FT@!T@a6#@TD !=@+*V'@ !@&  B`7!< &+* B'@ !& '@@!ҁTSA[B@{Ũm'@@@TSA[B@{Ũ_CџEd@{C@'T_`ATB@?D&RR*E@@@!T@A7B B-!1 y+@@TD !=@:`A !@@3E'@@B@T{A@C_O{ESB@G```=_T@@!T@A7  'C"_5g`D@@R$RR95aR@5@ B!1 '+ T@!F`T@!T@6?@@ TD !=@ B`7!< '*@'@'@ @4I#@`EG@@B@T8@SA{ɨ_O{ES#[B@O```=_T@R@4 'c"5 aR^`5@ Р B!1'*4T@FT@!T@6 H#@@TD !=@d B`7!< '* T @_B'@/@/@ @4+@EO@@B@T[BSA@{ʨ_{ES[c@'ҀET@@T@@7B B-!1 'G*C 'c"f5;T@FT@!T@6d٬#@@TD !=@" B`7!< '*ҟ T @?! @'@@!TSA [B@4cC{Ũ^'@@TPSA[BcC{Ũ_O{ESB@G```=_T@R@4 (C"5 aRv`5@ Р B!1()/-T@!FT@!T@6 `@@TD !=@| B`7!< ()@'@'@ @4#@`EG@@B@T@SA{ɨ_{ES[@`ET@@T@@7B B-!1 @(j)= @(C"҉55-T@!FT@!T@6@@TD !=@ B`7!< @(@)A  @@@ҁTSA [B@4{Ĩ@@@T}SA[B{Ĩ_O{ESB@G```=_T@R@4 (C")5 aR`5@ Р B!1((, T@!F`T@!T@6@@ TD !=@ B`7!< ((@'@F'@ @4##@`EG@@B@T@SA{ɨ_{ES[@`ET@@T@@7B B-!1 ((= (C"Һ55-T@!FT@!T@6-@@TD !=@I B`7!< (q(wa @@@ҁTSA [B@4{Ĩ@@@TSA[B{Ĩ_O{ES[B@GҀ=_T`@@!T@A7 )c"[5c`\a@@R$RR55aR@5c@ B!1 )(T'@@2`@!FT@!T@65`@@TD !=@ B`7!< )' T'@@ ` @JqkT@'@cP@ @4-#@`EG@@B@T[BSA{ɨ_{ES[@`ET@@T@@7B B-!1 )': )C"52 T@!F`T@!T@68@ TD !=@T B`7!< )|' @@@ҁTSA [B@4{Ĩ@@@TSA[B{Ĩ_O{ES[B@GҀ=_T`@@!T@A7 *c"h5p`\a@@R$R&RB5aR@5c@ B!1 *#'T'@@2`@!FT@!T@6B`@@TD !=@ B`7!< *& T'@@ ` @WqkT@'@cN@ @4:#@`EG@@B@T)[BSA{ɨ_{ES[@`ET@@T@@7B B-!1 `*&: `*C"52 T@!F`T@!T@6E@ TD !=@a B`7!< `*& @@@ҁTSA [B@4{Ĩ@@@TȦSA[B{Ĩ_O{ESc[B@WҀ=_ T`@Rg@4 *"s5 aR`5c@ B!1*?&X T7@C/@O+C`@!FT@!T@6C\@Ѩ+@@TD !=@  B`7!< *&ҿ T7@C/@O+` @,*1aTT7@C/@O+ `@aqKT/@C7@O+3?+@O@ +A3@`EW@@B@T0[BSA@{˨_O{ES#[B@OҀ=_T@R@4 @+c"5 aRV`5@ B!1@+%K,T/@"R'@?#6@!FT@!T@6 8#@@TD !=@T  B`7!< @+|% T/@"R'@?#  @qT'@/@"R?##@ @4+@`}EO@@B@T[BSA{ʨ_O{ES#[B@OҀ=_T@RE@4 +c"Q5 aR`5@ B!1+%K,T/@'@?#6@!FT@!T@69 #@@TD !=@  B`7!< +$ T/@'@?#  @LqT'@/@?#)#@ @4,+@`EO@@B@TSA{ʨ_O{ES#[B@OҀ=_T@R@4 ,c"5 aRB`5@ B!1,$H T/@'@?#4@!FT@!T@6@%#@@TD !=@A  B`7!< ,i$ T/@'@?#  @q+T'@/@?##@ @4+@`lEO@@B@T[BSA{ʨ_O{ESc[B@WҀ=_ T`@R3@4 @,"?5 aR`5c@ B!1@, $X T7@C/@O+C`@!FT@!T@6C(@+@@TD !=@  B`7!< @,#ҿ T7@C/@O+` @*1aTT7@C/@O+ `@-qKT/@C7@O+3 +@O@ + 3@`EW@@B@T[BSA@{˨_O{ES#[B@OҀ=_T@R@4 ,c"ҧ5 aR"`5@ B!1,s#K,T/@"R'@?#6@!FT@!T@6 #@@TD !=@  B`7!< ,H# T/@"R'@?#  @qT'@/@"R?#~#@ @4+@`IEO@@B@Tq[BSA{ʨ_O{ES#[B@OҀ=_T@R@4 -c"5 aR`5@ B!1-"K,T/@'@?#6@!FT@!T@6 z#@@TD !=@  B`7!< -" T/@'@?#  @qT'@/@?#~#@ @4+@`EO@@B@T[BSA{ʨ_O{ES#[B@OҀ=_T@R@4 `-c"ғ5 aR`5@ B!1`-_"H T/@'@?#4@!FT@!T@6|@#@@TD !=@  B`7!< `-5" T/@'@?#  @q+T'@/@?#m~#@ @4q+@`8EO@@B@T`[BSA{ʨ_{ES[@`ET@@T@@7" B-!1 -!? -C"57-T@!FT@!T@6 {@@TD !=@  B`7!< -!RRj @@@ҁTSA [B@4{Ĩ@@@TSA[B{Ĩ_O{ESB@G```=_T@@!T@A7  *C"ҧ5`I@@R$ReR5aR@5@ B!1 *b!-T@!FT@!T@6 @@TD !=@  B`7!< *@!@'@V'@` @4#@`SEG@@B@T{@SA{ɨ_{ESB@_T@`@T@@7 B@ !1 *! *C"%5{ T@!F`T@!T@6# @ TD !=@c B`7!< * Zt @ TG !-@O~ұ@ s҅ RRTdjb8qEzTe$8$9"$qaT&$x(qTˍR#$x4qTKR#$xQcxqTcG R'yDӄ @!h@ig8'8c@chd8#8$8B?9!J0 5@E@@cT@SA {Ĩ@4E@@B@TѠSA@{Ĩ_E{CS[@7҃u@U _T@C TCd@ RfR%R`@T@S`@T@@7" B-!* (A #o'@aT aT% @@!T@a7" B-! +(' #U`ʢ'@TD !=@ s' s'B!E7@"@c@TY{ASB[C_E{CS[@7҃u@U _T@C TCd@ RfR%RҚ`@T@S`@T@@7" B-!* (#l'@aT aT% @@!T@a7" B-! +(#`R'@TD !=@n s' s'͎!E7@"@c@T{ASB[C_{@S!EE#@AT@A7" B-!@ `.p@TD !=@0 @@ATSA{è@@@TSA{è_{ES[@/_T@@!T@A7" B-!1 .4O C.S5GC[`С+@TD !=@8@#C4K@32OO@7|~ O@*ޠ1TO@kT?kT^!!xSORd a@ x6O@k*Tu~@H`@6 `@<E/@@B@T)[BSA@{ƨ_{cES[k @s@G_ T(;EG@@BaTSA[BcCkDsE{ɨ^G&  ۚІT@ן?q~@_5T@Yxa57@oR7d@1@TEG@@B@TSA[BcCkDsE{ɨ_{cESa@'@TCss(˿?^ Cj&E'@@B@T@SA{Ũ_{@S!E#@AT@A7" B-!@ .F`@ TD !=@% !@/l5sF4ЁB4`C!E?@T`C@TB4=E``= R7F D !`/@](!E@"@c@T0SA{è_cE{CS[cd@?6@bU@d@'R `**y@*7 T` @@!T@a7" B-!*/Nc`H/@ TD !=@d҂@@? `;L` `@`a&$ 2`b$2@ARa 1@Txz u4s@ R`v @ 7Ѡ E?@@B@T{ASB[CcD_{cES*`@5Ao<!Ҡ 0<1`@Ta<b@ ! 0<#6T)BSD`@7`@!\`@@7`]Z4D@v^!E@"@c@T?SA@{Ĩ_{S[@t4RQD@)@4D@f`Fӓ`@7``F T`@T@6*"B;E. ?@@h`:)TFT"R6 E"R@S@I@ 4R a@7!aa RSA[B@{Ĩ_E{CS@/҃t@T@ATCD@ R&RR"T@!FT@!T@!6#`'@`TD !=@H Ё B`7!0 0A`*@7`@@6D !@ !24 !@4 ! uR4D !1@uRR5Ra&@t @*]3 6`@7``aE/@@B@TP{ASB@_{@S!EE#@AT@A7" B-!@ 1R  @TD !=@C !145FLA ! %+5FLD !1@*qTqT5@@ҡTSA {è-h@@aTSA {è2^@@!TSA {è 3TlF !3@[@@@TܛSA{è_{BES[ck+/A@?` 7@G@9@9{``6;@?%TqT6RqTRR@9qT@9x`qAT a@9 Q@qTA ! ! h87s?qTy @9Q@qTA ! ! h8`79:;T#T!-TD ! 4@ @9x@q!T!@9" cR ?q$CzBA@9!Q!?$q( TY!@9!Q!?$qhT9BRrBEџMTџCˡ!!@9!Q!@?qTC c cah8a5AT,TC?{c[c@9d cQc@qT@ h8CR4 kTTsTC /c EcfA?Dˠa@9Q@qhT`h8b!@(`*ŘysˀsF g@c@ D/s%RHѥ fa?-T?G@9Q@qhTh8b!@(`3A_@Ё@9!Q!@?qT@ h8RK  b)`jT`R Qj!T Te*T3@A@9!Q!@?q(T@ ha87aFa?E@9Q@qTE h8`5!@R b)`TRU hTA``  PR/ @9{``69?TV4@a!ET a@7!aAqG !4@D !5@E?@@B@TQ[BSAcCkD+@/@{Ȩ_{@S!EO#@GAT@=6 -6 @'!8E7@4 @a@  8C"$56-T@!FT@!T@6"@@TD !=@ B`7!< 8 @@@ҁTSA [B@4{Ĩ!@@@TSA[B{Ĩ_{ES[@`ѶET@@T@@7" B-!1 8> 8C"ҿ56-T@!FT@!T@62@@TD !=@N B`7!< 8v"R( @@@ҁTSA [B@4{Ĩ@@@TSA[B{Ĩ_C{CS?a@[Ecks@g T@`7'+`@*SrTrv`v@u @_qT RTD@kTBqjTUA!!!_`8q[ǟwaT @y[%_qT Д8$_qTq@ T w@RR[@ T_ q Te~&%qT?T'@y"@y) @yJ*@yBJ)JKJB B B<_qhT y! "_xx"_xx"_xx%$@xkTBEx@(Tfk(T,)@y'@y"@y+J* @yJBJ JJ)ZB B B<_qT y! "_xBZx"_xBZx"_xBZx?T%$@xZkTBGx@T:k(Tcc4 R%RqTT"D@_kT_kTR_k TF$)B  xx$x&D@xZ"__k)T_k)TR_kTF$)B  BZZxxT$xccf[ T?@  c'   @'HIT@67@@ @r!T K@KcT@Gҥ[@ ǚlT T.! # 7 H_@[@T@6[@CC@CC Ú[@rTr@w@@ 7рT W@ S@ _@K@!?`T#W@S@_@!Eg@"@c@T-{ASB[CcDkEsFC_Rv{cESd@'_T@@!T@A7 B-!1 9* C95"O@TD !=@ka@9#@5@ !@9`!F@T<`5#@7&j#@D@T_UE'@@B@T@SA{Ũ_{BESC@ *4@ @sش3RRFS@7р`E@@B@T@*SA{Ĩ_{[!@S!c?T }R S'@B4@B @@?a@@4@6@~@_7T 7Bтbf az"[BSAcC{Ĩ_ѠE{CS@/ңs@#S #_T@BMT#D@`RFR%Rҏ`#@{`4T@*1aT@#@1**l21TD@1T`~@#@kE/@@B@T{ASB@_{BE C@@`5@a !9j7`Ò4D@SsF@9E@@B@TĒ @{è_{ES@'_T`@ `5 C :x5(`@#@@4R@D !@:@ a !:7"R#4D@SsF#@@E'@@B@Tr@SA{Ũ_CED@{CS@'T?@ATD@&R*RҺ` @`4@$a ! ;6 1|@1T @E'@@B@T%{ASBC_{S*!E[c@#"@oCk4+@cB@1T0cRB@c\S$*^1 04**Q1{@@7!a34D@@Ϲv!Eo@"@c@TґSA[BcC#@{Ψ_{ !@eMR``@@!1@T @{¨_{S5SA{¨@@`@9@4(qATEM"R`R1aT 5``@@!1@TSA{¨_CѥE{CS@'҄@3_ @lT"RD@RRR` @p*@7!E'@"@c@TR{ASB@C_CѥE{CS@'҄@3_ @lT"RD@RRRҒ`@4*@7=*1T F?qE!F!E'@"@c@T{ASB@C_{D@D !`;@mA@94?(qTER1TuF@4{_{E @_T`@)`5 C;5`@4@@4/@@1TD@QsF@E@@B@T @{Ĩ_{[!@kEScs@W T@`7 С B-!@  <2WY` d51Ta/RAT;/;@ 7@ 4;qT Ts/;@,E !`<@p/;@O@7р`:EW@@B@T)[BSAcCkDsE{˨_ѤE`.{CS[C@_ҁ ) ATBMTD@FR*Rc`.`@K`4`@B@43B`=`4u@O@1TjC@jT@@4XqTD@PO@b[E_@@B@T{ASB[C_ѥE`.{S[+` Ҁ@ @TAMTD@&R*R`)`@`4k.@#1T*O@)*.4D[@@dOLMN@@ @VE@@B@TZ{BSC[D+@_ѤE`.{CS[C@_ҁ [ ATBMTD@FR *Rҕ`+`@}`4`@#j.4@'@1TۍO@A ` !@)7-C@g*i.6DO@@sFE_@@B@T{ASB[C_{c`.ES[a @O T`@/@5X C<5PA;ՠE.@?t@ h`@`C7lF !=@6?@T@gTD !=@+4 TD !`>@(`@@@9`5D !>@G@A F !?7;@D@OٸpEO@@B@TtSA[B{ʨ_ѤE`.{CS[#@Wҁ w @TAMTD@&R@*Rұ``@`4#-?@H*-6DK@@#sF!EW@@B@T%{ASB[C_ѤE`.{CS[#@Wҁ ' @TAMTD@&R`*Ra`#`@I`4K@a @ !@ z7,@1T*?@?*=-4DK@@ƵsFĵEW@@B@Tȍ{ASB[C_CѠE{CS[c+@gcw@!`.!@ ċ @TAMTD@R&RR`{w7R`@`@*6ܲ@4T@ *?X 5W@a ТBF !b7K@x C?3 s st@W@o``M@,@74Ҏ,Ռ@qTs"۰W@K`'T`T@9A5t*@7!a,94`@@7`$Eg@@B@T {ASB[CcD+@C_ѠE{CS[c+@cx@!`. 9 !  ATBMTCD@FR*R:`;`@"`4`@4 T` @ѹ*`63R@ *@5W@a @ !?7+@K@7|@w@4|@ȉ|@+D@@sFE@@B@T{ASB[CcD+@_CрE{CS[c+@cy@#b. ҡb!" |O B=TD T$@RReRұ``@4`@`4` @R*5aR`5c @b B!  B9?T`@ o*1aT?T`@,*`63RCA * 53@ ;@ @!`@*`7*CA3@7;@*s@|@ ;@*s@@41|@:|@P+@^sF۳ٳ7@`E@@B@Tً{ASB[CcD+@C_рE{CS[ck@cv@#b. "$҉% Ή ATB T$@FR*R`@4`@4 T` @*`67RA *7c5_@a @ !75 @@^97 Q*AS@7 @4Ս*@qAT@7р`V"@U^@`7рKT7@.,E@@B@T0{ASB[CcDkE_рE{CS[c@ocu@!`.!& +/` W @эTCMT$@ RfR%R``>`@H`4X`@@n*1aTw@ aT0R` @`@Sn 5c14T0R/@W@)1TK@**-*K@*w*!*4J@qT.4sFEo@@BTD@K{ASB[CcD_CрE{CS[#@gcw@c!`.!@( Ң` W @TBMT$@ !RFR%R`4`@`4@T`@@0n*1aT aT6R` @S`56RW@6)1TG@**c*G@**)4͉@qT@4sF+Eg@@BT/D@WK{ASB[C#@C_рE{CS[c+@cx@9c. !)#!+ ` g ATCMTc$@@"RfRERW`N`@?`4`@;4 Tg@ [@1@dZ !#@e6` @`@_5ܶ7T{@`K@w@@O@D !@2(1TO@*{@*O@{@* )34D[@@@JsFE@@B@T{ASB[CcD+@_CрE{CS[#@gc`@!`.!`, ҋ` _ @TAMT$@&R`#*R``@`4T_@{`@sٍ58Eg@@B@T<{ASB[C#@C_фE{CS[c+@cv@!`.!- 6` o? @TB T$@$RFR%Rl@ @V 43@ TF @vsT@@* 6Sy 4T F3R3R3R!F o@ [TD !@@E4@4F?TDa !@@9(9{T@R.1T@#R.1T;@O?@WC@SG@["@4F? TDa !@@҆{T@cu4@u5 Rs@x 1`Tw@ D !@@*;5@*G@5F@1a Z` ! `7='q` @q@zTw@5qa qK@AzTc\S**W`4@|q!T5$ߒ1b TDB`a !@i$$**$4 dGB`d  `c5@a !QDW@@Eo@@B@T{ASB[C#@_рE{CS[c@ocu@c!`.! : ` W ATBMT$Є@FR`,*RP`I`@8`4`@h*1aTi T3RR` @S_ 4T`@ٱ*@7aTR`@ѱ*`6*W@#q` @zT5 Rqc\SU4c2G@**9*G@**$sEqFsEo@@B@T{ASB[CcD_фЀE`.{CS[#@_ҁ; Ғ BTCMT$@fR-*R`+`@`4`@(4` @w(`4K@a OH)@ !@ **7+#?@***#6DK@@)sF'E_@@B@T+{ASB[C_рE{CS[c@wcw@!`.!< (` _ BTCMT$@fR.*R``i`@H`4`@'4` @ (`4aT4R`@`@*6sj4T@w K)b g@*5@*`5[@1eZa @ !@ **M7"@1T**t*qa qO@`AzT**H*q`Az T\S******l*"4D[@@sF}Ew@@B@T{ASB[CcD_{BESA@D`O(1!T`@`7`j @j*a@7!a^4E@@B@TL*SA{è_{C;BEE.?Ssh`[֚Fck+@@?Y`2@`@!lFb B !@@7!A$F?TFB!@@]`5L `!T!lF B`!@R;k@4!pG!@y4 ` '  B?@7!aT x`6@@7рӨ6T3@ϝB$a@7!aa@7р`@@7!B B @7!сa"Rj@@47cc#7c$"Rj5B!@@þ4ҁ!E?@"@c@TlSA[BcCkD+@{Ȩ_{ESB[@'_TvV@ mT `  cB5!` @f*1TԻ`R*ʌ FϝB6$a@7!aa2E'@@B@T"[BSA{Ũ_ c,˄E*{S*[@?ҡ ! @7O"c$*``=3s 5w7@@hE?P@B@T{@ SA[Bc,_{$@  @{¨(A9C5{$@ R @{¨{$@ "R @{¨ {ES[E@'ҀT@@T@@7 B-!1` FM`  c"e5ET@!FT@!T@6c؃#@@TDa !=@,b B`7!<` #ҟ T @9e*1TRR* @'@@ҡTSA [B@4@{ŨS'@@@TISA[B@{Ũ_{ES[@`іET@@T@@7 B-!1` @ >` @ C"56-T@!FT@!T@6c@@TDa !=@b B`7!<` @ K @@@ҁTSA [B@4{Ĩ@@@TSA[B{Ĩ_{ES[@`іET@@T@@7 Ё B-!1` l>`  C"ҋ56-T@!FT@!T@6@@TDA !=@B B`7!<` B"R @@@ҁTSA [B@4{Ĩ@@@T~SA[B{Ĩ_{ES@_T` C 84@@!T@a7 Ё ` B-!1 3`@TDA !=@@5F!E@"@c@TaT[BSAcC{Ĩ_фE{S[cksW@G oCF@ _1@T ҔO{ y b9` =RRRRO#Kc`W@c@ Tc@9*4`xQdqT`Q$q)T`xqTqzc czaQ`Q?dqcQzcbWt<qT*Q R Q&՚|@5` qT` q(Tb''S!*!@@6*6*@64qTc ichc ic c5qT qTRR*@`6bWj Tq Ez) TICG@ cg5W@c@B Ta@9i?qTo@Wc@`k?BTc@9qTb WZ 7Rk`xQdqiT`Q(qTqTc i c@RR:RV?qTW=6Go@c c `ko@K@* CG@ cWg40R6*4*2q@T_K_Kv4@k@T@qTw@@b?=|o@b31_@*[@(|`E@@B@TZ|{BSC[DcEkFsG_ҹO{`ES[B@GҀ=_T@R@4` @c"5 aR{`5@B ` B!1@DT'@@2@a!FT@!T@6`_~@@T`DA !=@{B Ё B`7!<` @ T'@@  @qkT@'@cO@ @4#@``EG@@B@T{[BSA{ɨ_{Sa!E@#@7a !8Py`5%@;@ !?`@@@b/{3@cT.q!T"`FJa!E@"@c@T{SA{Ĩ_{bBESA@ !y`5@@a&@ `xG@ a@7!aam`E@@B@T]{SA{è_{D;SE.`?ch`[ccEk$@b@7a cA 0! @x`4/@  5`Da !@g/`@`Da !@RzZ ERT/@  @ @!T@!7`Da !@0=A@q+T!T54`Da !@t,`xG@aT5U4a!E!@@1Tq!T`Da b@!@`xG@( 3@A@!1@TA/@ /@@7!aРa!E7@"@c@TzSA[BcCkD{Ǩ_{S[1T`*@uB@*7BB`6@v@67BBa d! cb(x5*6 a*@ @1@T a6@ @1@T RSA[B{è_{ccES[d@Ot1`T`&@u"@&7BBo`*@vB@*7BBe`6@w@67BB[a e!@dbw56Aa&@ @1@T `*@@!1@Tb6@A@!1@TA@!T@!7#R5'@/@u*@`*`*@`R`&@@&7!A `*@@*7!A`6@@67!!a!EO@"@c@TySA[B@{ʨ_{S[1`T`&@u"@&7BB`*@vB@*7BB`6@w@67BB؟a e!`db[w56a&@ @1@T a*@ @1@T a6@ @1@T RSA[B@{Ĩ_{S5@1 TlTRT@`&@A@!1@TAb& T@a g!fedcbbBw 5@7р2a*@ @1@T a.@ @1@T a2@ @1@T a>@ @1@T a6@ @1@T a:@ @1@T @7р`_`6@`:@``Da !@SA@{è_{S@k7@SA{èoSA@{è_{ccES[`@W` #C8 `5H+@4cRϘ5/@7@##@?mT#!!P#'@!!P'D!T? T!? T TTE@9?Thc8kTB_ TcR}_Atc`EW@@B@Tx[BSA{˨_@a@`@BR>@46@6@?kT:@:@?kT>@>@?kT2@2@?k TF@F@?k T @ @ T "R*|@$TiAyFAy\t**Xt33<@ )k Tha8 @@ @< @7ABRr@*7!a@7`qMT@BR@]*qmT2@BR2@V*qTF@BRF@O*qT@BR@H*qT qT`FS5q`T`E@!1T`DSA[BcC{Ĩ_{ =SN=!R N =;KBCa@ 67!aa.7!aa&RSA{è_{ccES[c#`@O~-cd8`6-/@)O7R`*7/@R'* 7/@_7/@7 @**R7@7!сaۖa@7!aaԖ3@yh`EO@@B@Tp[BSAcC#@{ʨ_{S*[*c*# ~ aT6@"@A `D!#B @@ qC*RvSҗ3`rn [BSAcC#@{Ũ_dE{CS[cks@o҃s@S@BT#@/RFRRҳ@TtF@̩`%Ba@7!aa9`T @ق  @ق @ق`FT/`Ӏ0`ZzZGTa ka8;@{`6 k{8@{``7{aTT@`|F_&T`! .T`@x43@4a7!57!a`G"ka8xb6!?aT!Y.T`@x4 @4A7!ѡ• 7!ѡat 6`@7`R]`5G@?@`Da !@8@/`Ӏ T@9uT ku8kAT!  .T`@x4A@47!A!t7!AamєѿAT@`|F_!T@1@T`@4?T!.T`@x4 @57!ѡaAt  6fJ@ "s@4a 7!ѡ +UER` _/T`@x:ZATa7!ѡ @`|F?!T@1@T`@!$ "y_/T`@x:*@4A7!с 7!сa۔Aa  6`@7``ϔ @1@T`@ `Eo@@B@Tn{ASB[CcDkEsF_dE{CS[cks@w҃s@S@BTc@0RFRR@TxF@Z`%}a@7!aat`T @  @ @`F!T.`ҠҀk`:zZG{{FTTj`8A{a6 TTj|8A{a!7\T@?!T@1@T`@H/T`@x8d!@4A7!!47!!aTa!Gj`8"xb6aT`/T`@x8:@47!с 7!сax `@7``#R@5O@G@`Da !@8@B.`ҠҀ_!T@9~MTѿTj|8?k!T=/T`@x8!@47!!!~7!!aaT@a!|F_T T@ c~ ҿT%R; ;@B;@ /T`@x8??@"@47B"b`87B"bY;@9@`|F?!T@1@T`@8`/T`@x8z@47!с2 7!сa+x `@7``!`Ew@@B@Tm{ASB[CcDkEsF_{Sޜ@7!сaaTsRғ` @TSA@{èRAhs8?q$CzT9RAh38SA@{è_{S[B_T@@ ;C"҈5G@6aT?BтT@@T@6@aT@9A!8E4@T@@9 " a B@G*@Ԃ@`x@X?G˿T*clvhh%t@W>G`ҥ @`{@[{?G˿mTҵѼ Th{ha TaT@9t@\?G*lx@9n@@`c@CcGs TC@`c@CcG*T~@ ٚ? T!S@@`u@U>GT*kTh h5ggIt@Y9?G ՚?TRÁ@`x@X?G4˿mT7ۜ7@ T$?T9g x7g7@ggk@`]C@`3@Y@E@@B@Ti[BSAcCkDsE{Ҩ_{SRt@7!сakaTsRe` @TSA@{èd@a@A!G𒵢V>G@FT.`ҠҀx`XGҟT ja89{`6jy8{`79?aT !.T`@x4ެ@4a7!57!a@Gja8xb6!?aT!w.T`@x4@4A7!ѡm 7!ѡaft > 6`@7`ZR`5G@?@@DA !@8@.`ҠҀ_aTz@9QxtѿTjt8kAT!).T`@x7g!@4 7!!A _7!!aџAT? T!Jx ҿ`TER@@~.T`@x7 ,@ 57!сa~.T`@x7@4A7!с̌ 7!сaŌw  6`@7``~V>G@Eo@@B@Tf{ASB[CcDkE3@_DЄE{CS[cks@w҃t@T@BTcЄ@ 3RFRRܬ@TWF@H.k@7!ѡabaTu @Uv@u @&v@0u @uv@V>G𒔢V>G@F!T.`ҀҀPw`Y9GҟTTj`8!{a6 T_Tjz8!{aa7ZA~.T`@x7Y@4A7!47!a TA!Gj`8"xb6aT}`.T`@x7/@47!с 7!сaw `@7``֋#R@5O@G@@DA !@8@7.`ҀҀ_! Tz@9vҿMTџTj{8?k!Ta}.T`@x7!@4 7!!A g7!!a{{aTkT} Rª@57!сazw Lv ˟T%R??@@\X}`.T`@x7??@"@47B"M7B"bF99}.,T`@x77!сa4`@7``-V>G@Ew@@B@Te{ASB[CcDkEsF_{S[_TlT'@ `#ʹ5N@Ք@7!сaT @@E! ! $@T @ @SsT@Ea !@@D T@4 @`@@GsssRғ`ˠkfj38@FA!E@"@c@TLdSA[B{Ĩ_@|{@UES?T@1@T_"0@ AH@ ?`V@` T7@5@D @!7@ @A`@7``@F!Ҥ @ @B`8 @Aa@47!aah @A7!aA@ړ`k @``@7``~!`aT{A`A!E4 @SA@@{è@SA@{è@SA@{è_{S@Ga@?T@E?AT` @4s @@Fa@?s€`@1@T`na@7!aSA{¨_BBET{SA!F! 3@E@@?a@ 7!aa` @A7!a a/ "@@E_AT-,SA{¨_{S[v@T  %W5  %#'@4v@SA[B{èSA[B{è_{CcES T`@b@_T @?T %R5 # %`4 @mT@SA{¨zSA{¨_CDE{CS[ `c'm3@Ga@T@4?HT@@4RFRRb`A!4Am)9`@``@7``%4)jHA`š@@?@ m@EG@@B@T b{ASB[CcD'Em3@C_{I)E==C#='=+=/=3=7=JJEE%@/C'/ )A@@A!E/@"@c@Ta{Ѩ_{I)E=C="c #=c`'=+=/=3=7=%@/'+ )@A!E/@"@c@Ta{Ш_BBF{S@@! "!@(`7`@1@T`@W@FSA{¨_BBF{S@@! "!@(`7`@1@T` @ <@FSA{¨_CcF{!  `@!@("Җ@7`@@*R`@|@ @%T @`y`@7``T@!1@Td a@c@ @){¨@ @{¨_CcF{!  `@!@("]7c@a@ @ {¨6( @ {¨@&# @{¨_CcF{!  `@!@("@7a@_TbA @8{¨  @ {¨) @{¨_CcF{!  `@!@("!7a@ c@8 @{¨ @{¨_CcF{!  `@!@("7a@c@ @ {¨)ҙ @ {¨*͙ @ {¨&ș @{¨_CcF{!  `@!@("7a@ cA * @{¨ @{¨_CcF{!  `@!@("7a@ c@@* @{¨ @{¨_CcF{!  `@!@("Ҷ@7cAa@Fd@e@ @ {¨*} @ {¨8x @{¨_CcF{!  `@!@("ҕ7`zq@e@dҿkMTx`A@!1@TAa @"x a@ e@* @{¨DFK @{¨_CcF{BBES`@A@"! !@(b`7@T@ 7@D! !*@BBD! !@+]4@ @1@T `@a؆/@@F?qa*A!E@"@c@T`SA{Ĩ_CcF{BBES`@A@"! !@(!@7@T@ 7@D! !*@` b@! !@+BP@q]4/@q T@D! !`+@L@ @1@T ` @a @F/@aA!E@"@c@T_SA{Ĩ_CcF{BBES`@A@"! !@(@7@T@ 7@D! !*@# !+]4@ @1@T `@aR@ @1@T `@aJ@ @1@T `@aB@FA!E@"@c@Tt_SA{Ĩ_BBF{S@@! "!@(`6q|@a7@FaSA{¨_CcF{BBES`@[A@'"! !@(u@7@T@ 7@D! !*@^D4F! !+\4a @#@5@@T@a@@?T@D! !+@ҟT#@  @Ҁa@ x4`@T@  @ TT? Ѐ a@ x4e@$`ҿTc ABx`b C @b@B1@Tbx `@a@FA!E'@"@c@T^SA[B{Ũ_BBF{S@@"[! !@(7@T@6 @a@? T@D! !+@.-` @b@`@Tzt7Ҁa@ x4fe@$`ҿTc ABx`b C @b@B1@Tbx `@aM@FSA[B{è_BBF{S@@"[! !@(7@a @T@6@6 @a@? T@D! !+@0b`@mTztfaT`b@a@B_@Ѓ x4e@$`ҿTc ABx`b C @b@B1@Tbx `@a@FSA[B{è_BBF{S@@"[! !@(T7@a @T@6@6 @ T@D! !+@:bҟTzt a @! ! @"@A? Ҡ` @  @@ R`*!Ѐ`@x4~`?TcAc xac @`  @`@1@T`x!!`@b@FSA[B{è_BBF{S@@! "!@(`6 ΢aTQ@FcSA{¨_CcF{! S!@(`@"[7`@@a@ [B6c@SA@{Ĩ`:@@4a@ [B@,b@SA@{Ĩ` @@Z~`ҟ T`@xt>z4`@K~`c@ T`@xv.z6a@SA[B @`,{Ĩo,*SA[B@{Ĩ_CcF{! S!@(`@"[7aB!a@SA [B6{èMa2@!4a@SA [B@,{èC~`c@ T`@xu @@7р4 z5a@SA [B,{è$SA[B{è_ֻCcF{! S!@(`@"[=7`*@ 4a@ SA:[B@{Ĩ`@b @ a@ SA[B@{ĨV@}`ҿ T`@xu @`7р z5a@SA [B,@{ĨڕSA[B@{Ĩ_CcF{! S!@(`@"@7` @m@7!сaua@SA @,{èRR`@AT!!F @1@T $FR@a@ c@-@eBSA{èSA@{è_#cF{!  `@!@("Ҳ7b @@@T Frh @{¨ @v @{¨@ @ 8o @{¨_#cF{! S!@(`@"Ҍ7bAA c@!!F3" B! @7р@M@7!AFa@c@ SA@-{¨$F8a@`*@SAq{¨ %F-$E*SA{¨_#cF{"BES`@A@"! !@(A`7@T@ 7 D! !*@)! !-Y4@*4@@&5 D! !-@h@@1@T@` @b @ @1@T `@a F!!E@"@c@T[SA{Ĩ_#cF{! S!@(`@"[`7tB5Fc@`T @! !`.ea@c@ SA[B.{ècu @AT @! !`.e c@! `@!.e2@SA [B.{è#R`@a@SA [B.{èSA[B{è_{S@T@`7 F! "!/@`7s s'@SA{è@NSA@{è_{@ST@`7, F! "!`0@w@7s s' N @!T@A7@ D c @!@U@`7р2SA@{èSA@{è_{S@T@`7} F! "!1@=`7s s'@SA{èISA@{è_{S@T@`7Z  F! "! 4@`6t 'I@ T@ 7 D# @! @!5`@ 7`Ԁ@SA{è_ F{"@! !@7q{ RZ_{S @,TE5SA{¨p F! "! 8@ 6SA{¨_"BF{!!ES@@[c#"@G! "!9 7tF@W/ aF@/bF@R s5@k3?@TWc/@;s@kTc@Sc3Kq-TRŔ@4sQKqMT*R4QR*4R1T**4**/@@7!A=!!EG@"@c@T,ZSA[BcC#@{ɨ_{  @5!R @{¨0#chF! "!`:`@C4 @{¨_{#cES*[ca@wh]4e]@5 @T@7@T@6ݰ@5 Dns QqhT hF! "!:@`4acRy`4d#W@Ry4[z/@`T` QqTzzqT?'@O@Ҕ&Z*zzq4T F1TqT q@TqT 6q,T!qT6TTq`T qT q`TTT +T TmT T E!!Ew@"@c@T{YSA[BcC{Ϩ_{ Y@5 @{¨+S#chF! "!;`@4 @{¨_#cF{!  `@!<"҄@7!!F @!0@{¨!(@ @{¨_{#cES[Bcksd@__T@LT C"5@<*1T`R`@q T Da ! @ y@94 D !%@Ҝab@`@!<@?aT`V@@@7@1@T Ҳ*@a6qTT Da !@d!~!!F`vA95`b@ !@3@PdqT qT4 D*! ER!@$R@RT5еFBR"3yq)TT`b@! !@1E@7р`~ М A? 36֚F*"3yqk%TT`b@! !@$  A?`#@7!A~`>@>~B`N@@N7!A~d@(A?u@7!Ar~`@\ B7DRR@7!сab~u`@"3BR?y*6@6^6`5ѠL~6֚FR"3)y@7q!T D! !@WA?.@7!A+~R#RҊn@67!A~7!a~S@?B9sU)@s)39\e@BC7 7@@7Bт7}7@ @7 `}`>@>L~B`N@@N7!A}`@`5KC6[`@*" B)@ @@T@7 D! B @!@@7Ѡ`}@*  `N@aN~$ЄE8#cFq`@Ҵ7`>@u>~B`>@@8 T D! !@aB * B-``N@aN}`@`zq*56}d E_@@B@ThW[BSAcCkDsE{̨_{S Ga@?T E?AT` @L4s @ Fa@?s€`@1@T`Ȍa@7!aD}SA{¨_ $ЄE{S[cks@w?@ HR/2*@ |5R7g+`ҝT5!@ T@6 @3[:8@![A@eT!!8E3q:33?@wGiT@8q TRX˵˔sT_@9qT `8qT D !@<@ "RT@8?qaTBQ?qTB_qTT@@z! T D ! @"0cw@4 @7 `|@7!сa|]!R w3[RR8@8q TTq Tq@T*qTqT*,2* 2* 2*2*2*qAT3@=[@!T@6_T``2 dT@8qTjuT@`|xX6QBҵ~@XT@8`h`x@X6Q |@! š? T D! !@@qTdT@9q`T3@R@!T@7 D !` @9*1aTP Tq@9x #R-T@`|xX6RQrBRT@8*ahaxaX6K! ?k T D! !@^bQR3Qq(T $6`T@8 D ! @DH3@G@@HVq@)TTqTq TqTq#T|cqTyq.TqTQ! !TqTqa-TqTQq,T _C@?rT?r@@.7@8m.TX`@T@6`@c @1` T`I!!8E4c @cd@$Є@qT@@-T@D*B`E8@@A@?T! B U@$@!!LF!@T -wT@!D ~ @ґ@7BѢb!t)@7`t@7р tttSA[BcCkD{Ǩ_{*S#='= Eib@+=/=3=7=;=?=@?i4p `@57c)@@6?H4a@kT@6 R`b5bF@bQa@|}bF@`a@}"h`@@1ATc@a@ TAahE|@|@E @1T|@7c)@DB E?@@B@TMSA@{Ҩ_"B E{!!ES[@@"@/ 5 D@4 s s#C'@7E? @ Rc@X@7рRs @ c`RH+@tt#@s E/@@B@T3MSA[B@{ƨ_{S@[c# 5@@5@9QqTqR@z TQqT %I* Cj@!!F,q G҂@@BD@ 6n4|F Eq@T Rc% *c R`@7``r `@7``rRSA[BcC#@{Ũ_{E==#='=+=/=3=7=w@/'' )@Tc@T@CE/@@B@TL{Ϩ_@ !EbBBQ!@h"b"݂GPH9{S*[c#]`!E_xr dEi 7@sXDis;#@[BcCSA{Ũ` RbSA[BcC#@{Ũ_{R@S#?kAT`b@4a@!Qt@PR tn(`Fa@!QaSA{¨_{R@S#[ck?kAT`b@4a@!QXt@Qm R`b a@!QLwb@a@4!QFF9R`@akaTab@a5%`a@t`@Q`E-R``@Q`?T9!}ӭt@z6xo R`b a@!Q~@7T@}j`"h goa@!Q[BcCkDaSA{Ũ_{R@S#?kAT9`b@4a@!Q!t@!Rq`b@5AQRl`-2AR0a@` R!Q`bta@!QaSA{¨_{R@S#[ck+?kAT`b@4a@!QUy@/ `@RbkaT`b@`5{@Ҙl`wb@56ҁR a@{,@/T}{@z5n R`b `@Q`~@7T@}j`"h nc@cQc$Xya@!Q[BcCkD+@aSA{ƨ_{R@S#?kAT`b@4a@!Qu@WuRR 4a@!Q@aSA{è_{R@S#?kATk`b@4a@!Qt@D/t`b@@5Fa@!QaSA{¨_{R@S#[ck+?kATB`b@4a@!QUy@ `@RbkaT/`b@`5{@k`wb@56ҁRca@{+@T}S{@z5n R`b+ `@Q`~@7T@}j`"h  nc@cQcgWya@!Q[BcCkD+@aSA{ƨ_{R@S#[?kAT`b@a@4!Qҡ `u@R?kT`b@@5v@!KR `b@v 5aKR `b@v4`@Q`#AKRa@ Q``@Q`R`!E Ci !@Bi@L` a@@ ^`b@u5 @RŽa.@P $!EĖCi`b@u5!`RJ4L. R!E Ci!@Di@`b@u4a@!Q$aR`,.R%. !E Ei!@Bi R!Q`bua@!Q[BaSA{è_{R@S#?kAT`b@4a@!Qt@}W ab@t5RO@ta@!QaSA{¨_{R@S#[c#?kAT`b@5t@ңj R`b a@!Q5wb@4a@!Q/8NT}t@z6a@t* l R`ba@!Q~@7T@}j`"h la@!Q[BcC#@aSA{Ũ_{R@S#[c?kAT`b@5t@Lj R`bҽa@!Q:`b@@57dNT}Ɏt@z6tvwb@4la@!Qa@=* l R`ba@!Q~@7T@}j`"h tla@!Q[BcCaSA{Ĩ_{R@S#?kATG`b@4a@!Qt@ab@t5@ta@!QaSA{¨_{R@S#?kAT%`b@4a@!Qt@ab@t5@ta@!QaSA{¨_{R@S#?kAT`b@4a@!Qt@t`b@@5Fa@!QaSA{¨_{R@S#[ck+?kAT`b@4a@!QUy@ `@RbkaT`b@`5{@si`wb@56ҁRa@{)@T}{@z5k R`b`@Q`~@7T@}j`"h kc@cQcTya@!Q[BcCkD+@aSA{ƨ_{R@S#?kATl`b@ 5u@OR@R`b@5@, Rk@`b@5aR@EDi@ ƠQa@` o`b@u5ORx Rt`b@5, `b@5Rh`b@u5ORaR]!E c&R!@``b@u4a@!Q=ORGRC `@RbkaT`b@ 5t@R4`b@t4`@Q`aR)a@!Qaa@!QЄEa c`R@_ R!Q`bua@!Q@aSA{è_{R@S#?kAT`b@5u@PRWR!E c&R!@,a@`/`b@u4a@!Q*PRպ tWaRͺ@RɺRR 4!D @cR!@ R!Q`bua@!Q@aSA{è_{R@S#[?kAT[`b@4a@!Q!v@@`b@v5d``b@v5R`v `R{a@!Q[BaSA{è_{R@S#[?kAT#`b@a@4!Qҋ `u@R?kT`b@5t@!RQ `b@t5RJ@`b@t4`@Q`%!R?a@ Q` Q`@Q`RJM !E Ei!@Di a@H`b@u5WR!%M !E %@WDiEir`b@u4a@!QoW`RL` !EĖCi R!Q`bua@!Q[BaSA{è_{R@S#?kAT`b@4a@!Q)t@`ab@t5ab@tA5(ab@t5!KRab@t5AKR ab@t5aKR@ta@!QaSA{¨_{R@S#?kATE`b@5t@R`t M`b@`5Rw`@Q`SA{¨_{R@S#?kAT#`b@4a@!Q't@J@PqTA@AT@7р`!g`@7``gdW W@7!сagdo<Aca@7!aaf4@@7рfj`@7``fR@kjT@g+Uk 9kqT|C@4@7р`d -)k@7Ѡ dS@eR6R* $oS@ev5 R`EW@@B@T>[BSAcCkDsE{˨_{SEa@@? @`F@`@a@Q `#@;`@A4qaTw`a@ B4Q BkmT;@dwC#@c@c@`pCq Teee-E?@@B@TE>SA@{Ȩ_E{CS[c*+=/=3=7=;=?=C=G=@OҺ}5j  )CG@@ C``z*|@7!сadu@`6RѠcddEO@@B@T={A*SB[CcD_E{CS[cks@oңt@T [_ T@H Tc@6RRRw @`@@T@`7b B-!`L`@k!*1aT*wx@xTv@{TFz@TZFt@F FFFF_aT҇B@@T@ 7D B @!@` @A !`Aw\@b B!ҹa@7!aaQcY BF GAvG@@1@T`\AC%3 @7 `6cK@dA@7!Aa)c`@7``"cy?!T @7 c)R(!@7!!a cQ!|@ T@1T`@6`@ 7`b `@7``bvv@CG*WcEo@@B@T<{ASB[CcDkEsF_{  sF`Lv ` @{¨X @{¨_{BES[*cks@@?@a4@@ D B @! @%@@@T@ 6^6BAB @?jTxaC!:k@`@@!F @1@T F`@9F]A!xFTb@@T@@7D C @!@@}`@1 T`'u@B J@7!ѡaFb3 FT`@T@7D !@`@6Y4@|E"@@"T@B 7 "h@_MT BF`Tb @ !@? T`@7``b@7р`b@ D!` B @@$FT` @TO `@7`a{ @9? T`@xy@1@T16@6`@ 6@6@7рaZ@a3@8@`7ae@*7!aa@7`a:5` @TlF ! @`aѠ@a @T@q@7!сaa`@7``a@7Ѡ`|a@7Ѡ`ta`@`7`ma4745E?@@B@TX;[BSAcCkDsE{Ȩ_RBF{S*A@!TG`Tb`4` @@a(7a@ҟaT@?T*y`@7``$a@SA{è_R{S `@7` a"@@ SA!{¨xkSA {¨!qkSA{¨_{!ES["@'+HS`FlA#`@7!ѡa`s@Fpa@7!aa`taraE'@@B@T:SA[B@{Ũ_{S*c @#a@SA @"{ès`@ qTa@SA@ {èc@ "sa@SA@ {è`"xsSA@{è_{S_TLT "#.5@'*1Ts`R@SA*{èSA@{è_AR{BES*[c#A@/ҟq 3T@A@!D B @!` @Q#9F! a@7!aa$`U@@T@ 7D B @!"@5@7Ѡ``{ @_@TD !#@#@6@`@1@T`@@1@T@7Ѡ`_b@@T@`7D B @!$@`@`6 @@T@6`=D B @! &@`@@6\s@![@7!сa_Sb@@T@6` D B @!'@`@7`_1s@]`[` @AT`&!9a@7!aa_E`wx @`BZ:`@6j@ @1@T cA-Tx`a@!1@TaCx "`R1-!@7!aX_5`@7`P_r@`coa@7!aaB_@7р`;_R @@!T@?@7Ѡ`(_@7@!_@T@@7!F @1@T sF@T@7!F @1`T 1Cl A+`݄@7!a^`@7``^@7Ѡ`^@7`^@`7р^Fn@7!ѡa^@7`^@7р`^`@7``^@ 7^* B!`(a@7!aa^E/@@B@T8SA[BcC#@{ƨ_{BES[cA@'E=*1aTq n`AДF`kP.6I|E Yҁtt`+Z`Akq;#@ҁ@ `@ 7`I^+C`A@k7Bтb>^Ta@a7!a2^b@7Bbb*^'@@TSA*cC[B{Ũ'@@@T8[BSAcC{Ũ_R{S!4D[ t 5!Gt5 @`@ҁ@E?!TT@[BSA7{Ĩ!F!!4Ds5!Gs`4 @`@Ty!4D8sq?qKTT@ 6 4]@7`]$q`@7``]@7`]`@7``]@7р}][BSA@{Ĩ_{[@SX v`6@#@@SA[B{è@1 T` @SA[B{è[BSA{è_{[@SWu`6@#@@SA[B{è@1 T` @SA[B{è˜[BSA{è_{S Da !@{a @s p`@>@a@|E#@@@TaA`?6a @b5@SA@{è_{cc@4S@a`&[t!@!FqBR!W1TqaTb@G B @!@ @ [BSA{èsSA[B{è_{S`@4[`&@lt6@`*!FqBR!|WqT`@1T`1T@ @?Tr@!1@T p[BSAR{èO7[BSA{è_{@S!E[#@/Ah@!D B @!*@ym#@CmF@T'@`@1T`4M\`- cGqE@cm'@ @1@T @7Ѡ@#\+@F @@%E/@@B@T6[BSA@{ƨ_{@ST@T@  (C"һ5SA{¨_SA{¨y{!!@?S ZG@1@Tt UmSA{¨_{S[c_T@@T@@7B  B!< (b C(5  @`@T 6 T @A^[`J@!@` @1@T xaT@_zTo``@v 7`@[`v @ hw@!T@a6@6@a@!a@!1@TBCl D !(@՜\[BSAcC{Ĩ_ХE{CS[c+@?҄@5 ?T_ CMTЄ@7RfR%RҔ{`Sx@T`@en #z!@7!!a[@T aT` @dn za@7!aa[T@@oF `mD `@@7`Z@1@Tv YlE?@@B@T4{ASB[CcD+@_{S@F@ @1@Tt 9lSA{¨_{S[ N@p43R@N@F@@7Ѡ`ZXl@7р`Z[BSA{è_{cc@<Sa dBRҽ@T`.``Te Х  cB@?BRҪ`Te Х cB BRҟxmTe Х cBCRғ4mTTBTe Х  ХcB CR!$@9 ҉4BE;ET@@_Te  ХcB$ER`@e  ХcBDERS)@?T! @_Te  ХcBERB`@@AT7(@Te  ХcBDGR)! @?Te  ХcBGR@e  ХcBGR@!e  ХcBdHRfxTR$R e  ХcB$IRT _8E(6e  ХcBIRޥ`!р B*ee  ХcB JRΥ R{_{S*e4e `c B$Rҹ`@Te `c B@DRҫ`@`@T@6*6*SA R{¨_{C;[E.?vh`Sc*2@2B*C! `@7`@U'ҥa@7!aaU@7Ѡ`UT2@*2VM[@7р[BSAcC{ĨUSA[BcC{ĨsSA[BcC{Ĩ_{SsF[EccG#*c@/q9ETaCC@+O`5+@`CA?TaC A5@ˣ# dC`C?aCR+06/@!@AT#@*cCSA[B+@{ƨcD/@!@@T>/#@*cCSA[B{ƨ{C;E.@?{*`h` @2{A;E.@?{R h`a @s2RRL@{ @ _qTlF !@@5A9b4lFARa" !@uBF?ATa@"Rb""R9RR` @_ @R`" @{¨_@RR@{!ES@#@!lD_T!E_T`!F<!$`6˪@va@7!aaTtlUR!E@"@c@T.SA{è_{ @"A9_qT"8 44gFlF !@{_{SVkt@6V@H6@1TRa@A` @@ 7!AoT@ ?ր@7рSA{¨cTSA{¨_{ES*[c/@7U G/@@Y 4499a9*a@7!aa:T 6`@!lDT!E!TC;E. ?"*xh`D@@*999@*,!F!# 6`@7``T83@'@6`@7`S+@99ҕ9@7`S`@7``ST U'@!FaT'@F_ TD ! @AT/@`@1@T`+@@1@T'@@1@Tb@@T@6cV@6#Cc" 6TTD ! @"+aTa@ @1@T /W' D B @! @ D/@g!FR"R5 `@7``S:T8TE7@@B@Tk-[BSAcC{Ǩ_{SB_TmT  !c""5 F "! @y6b@ b@aTc@ Tc@SA@!R{èSA@{è_{ @SqTlF ! @@5A9#4a@BRlFb"@ !` !@=#Rc"9a@a` @u a @@R?9`"@!dF_Tb @AR_9a"@7!ARlF !@\a @@R?9`"xD@R4`hD@ɣG@G5SA{¨_{ @ qTlF !@7@5A9c4lFARa" !@)#Rc"9F` @a @@R?9`" @{¨_@8{BES@EC@' @_qTlF ! @ 9q-ThDAR@a"qҙ" 5 A94a@BRlFb"@ !` !@A94xDAR@a"T!FTlF !@͓!Ra" 9`@ BG9RB@` "@dF_ T @ 7 ?R3! ! c" 4CR#@` @ )RRb@b'@@!T` @SA@{Ũ@BdF!T@7BB RlFBRc @ @!9b"s~xDARb @@_9a"i 4`@`uhD@ޢmG@\5g'@@@T+SA@{Ũ_!F9RR@@! E_AT/!F!{BES[cksA@O0TUҥ}L@~`@T@6@T@`6 @?C7#;5D ! @yBB 7@g` 4;@gK@4@ @G@@@R,?@AOA@6@6 s@46{#aT7@@ 7@ZQBD !@:@Ē@@7@`LQ@`7EQ-!Aa?Q9Q7!с2Q!сA,Q@7р`$Q@7Ѡ`Qz33 {QyQdU[EO@@B@T+SA[BcCkDsE{ʨ_E`.{CS[#@>@o ( BTC Td@fR8*R9q `@#P@ 4A;E.@?u@ h`@`C7lF !=@3Q@T@gTD !@(FI/ TD !@:y5D ! @0c `@@95D !@ [@ !? l7@7V(O@'[@z3@T/@T[REo@@B@T_*{ASB[C#@_{BES[cks!GC@WWf`4Tf4@ @9Y q @`7р;P#7@F 4;@@1@T?@@1@TG@"jc`b@1@TBRJq+ TT(@6R@l` Ov@67BbO@7BbO@7`OP@@7OFlCAKaU 6@7Ѡ`O@7р`O@ 7ѠO+qPoP;@mPkP?@iP]<`FBc @`@7``O@7!AOEW@@B@T~)[BSAcCkDsE{˨_{"@SE@'@T@7D !@ݐ  ![e 4#@,4@@"T@B6@F_TB@BT@B6B4F?TMU@!1@T@aT_< @! E_`T,X@!1T  @@7!A,O@?aT @1@T #@` @A@!1@TA@b 7!AO`@@a@7!A O`@@a@7!AO@`@aO` @`!Fa!E'@"@c@T(SA{Ũ_{S@J@!F @1T W`@7``NЄFB@ @BF aa@7!aaNSA{¨_{SL@!F @1T W`@7``NcF@ @ Ya@7!aaNSA{¨_{S(@ @.@`2@kW;sA*@!F!pR`7.@!F!gR@72@!F!^R 6`@@7`QN`@1T`sFF@@T@Ҩ^`T^`@7``3NSA{¨_{S(@ @`@W=;*@A ! a7@ !a@6`@7`` N `@1T`sFSA{¨_{S @@`^a@7!aaMSA{¨__qD;{E.?րh`{@w{ R`ϭ!R @@!Ra9 @{¨_{ aR` @`5!Ra9 @{¨_{`6{!{_{ES=EBХFg@9Bc@'҄ #5c!R p`6E'@@B@Th'@SA{Ũ_{Sb4!@!E;E.`?*h`Sj`@ @7!aIMBFT`@aMR @7BB9MSA{¨_{E;*E.? h`*j@7!AMR @{¨_A;{E.@?$h`@@  !DB B !@} `6`@ @{¨_{S[A94D !@W#@`T@6 @ Tb@ D!c @@B @gB  @6B7BтL7BтbL@ @Q6>J` @~$7J@@AT@v!7D B @!@kT``D !@@`F?TF"@@T@ 7D B @!@@`J@.Z6 @1@T aJSA[B{è_{#@S`T@6 @lTb@ D! c @@B @q`@?5@J@@7!AFL@@AT@A7D B @! @W.9kT_`D !@@`F?TF"@@T@ 7D B @!@4`@Y6 @1@T aSA{¨_{S@UеB@O@7!сa>J?`n"SA[BcCkDsE{ƨ_{S[vyxB @jT@vBxs_T|B@"[BSA{è^SAR[B{è_{q!F{ _{S@4qTa@ SA{¨! @ta@# b@c`! @ `j_SA{¨_{!ES[ck"@7ҙ4qTE7@@B!Ta@ SA! @[BcCkD{Ǩ@`@`@`@@ATa@ `! @2'fһ8`` [`@  @ {4 TV c`0C+`@x4E +T@7BB=bx4 TlF !0@3 !D@J@7!сa=a@ @1! @ڹ@7!a=@7Ѡ`=E7@@B@T[BSAcCkD{Ǩ_{!ES["@ҶE4qT@@ҡT@ SA! @[B{Ĩ @T@ @U@@ `! @a@7!aaS=@ >\@@ `! @ua@7!aa;=`@@@T([BSA{Ĩ_{!ES[c#"@7ғ@4qK TE7@@Ba TSA [BcC#@{ǨpC` -mC`Q@ ւ1@3T@b B @'a@7!aa<3@B C֢1c3@w4+@`@1@T`/@a@7!aa<+@@7!A<@ 1! @a@7!aa<ۏҠE7@@B@TSA[BcC#@{Ǩ_{SE[a@@'?q TD ! @~ 2B`lq4 Tb@ lF!2B @@@<֚FX 6D@ۢ@ 4#@J 6@ 3@7BтbT<uɎ@*@tb@ @`3v@@6 3m@7Bтb5<@ !A*<P @<҇<@<EE'@@B@T [BSA{Ũ_{BES[!FC@!E 6D@h 4v@@@Ta@ SA3! @[B{ĨZq`5a@ 4! @  -Tb@ lF!2B @@Ҡ@7Ѡ;@@@T[BSA{Ĩ_{!ES@[#@ҶE6@@ҁ TSA [B@4{Ĩӷ!F! 7@; aR@9 c ?za@c@@ҁTSA [B4{Ĩq`5;bR@9 ! c _zc @5 -Tb@ lF!2B @@Ҡ@7Ѡ];@@@TM[BSA{Ĩ_֡! E{!,@S ?@@ Aq4T A@@XT`@7``(;@q 6N@7!сa;a@7!aa;SA@{è_{[8DS@cks?`T: @ ZC6lq4MTSA[B cCkDsE{ƨ% @@1@T ` {c0:a`@T@6` @mTP Z*@7!ѡa:`@6=N `@7` :6`@`7`:``:4' @`'a@7!aa: 6@7!ѡ: 0;.;,;*;[BSAcCkDsE{ƨ_{@SA@SA @{èq4 TSA @{è@7C`@ `ma@7!aa3:X@SA{è_{[BEScks_ @D@w;7D !6@,o%@T@6 @bc;ҠFҡ!`GCҠF7F?! 69? Tzyo@T@` 77@O4@94 @4F?T@@@1@T@@@T@6@ @ZA@66`@6AC@ q Ts@_!T@`79@?@@T!A!9!A9:'M` 9X`67a@7!aa9F[ мF{C&__@?Tbxy^ 7s@z9_T`@T@ 6a !oEhE@@7@`W9`@_7``O9O`@T@6x @{b8T`@7``<9D !6B6@B !`7I;@@73g@ @g@1@T  97@?JT;@`xy@T@7G@?*qlT6g@@6`@7``8ҺF]G s@?@*!7!с8K@C7k@bT"x`Ta{`p:@A 7!с 8TO@c@7o@@@T@`6\ @< @Cw3s @@`7@8GcbҟTxeC@Tx`_`Tb{`` @@l@@@T@7@@s@1@T@` ! s@S@7Bтb~88@1@T8j!An8h4 @b# D@7!сa_8UXg@  <`@7``Q8g@ C@B`?@ [CJ[@@<!Ew@"@c@T4SA[BcCkDsE{Ϩ_{SAaAO` ` @`@ 7Bтb8 `@997Bтb 8SA@{è_{SA[ca AjO`&@ @@1@Tb6T{v@ ѡ7`73@7р`7[BSAcC{Ĩ_{S[ck+`T"6 B8 "6 >8ҟT@{t 2@  @Ra@ x;{v AT TU@!D@!@1@Tf Ơ-PA@ 8ZB  9A`  ҽW1`T =@7!ѡ@!@ ?z@7р@!@ ?0'A@7!AA@!@ ?ր@@7р@!@ ?uD @ B@9@7Ѡ@!@ ?`@7`a@SA[BcCkD+@{ƨ!@SA[BcCkD+@{ƨ_B;ա!E{Sc[E.`?Vh` @[@4@s!R,[@5 @@[@5R0*EA@B@T{@*SA[B_{ES@'+@4@` A;ՠE.@? h`*E'@@B@TSA{Ũ_{S[*c*#(P**a@7!aa6[BSAcC#@{Ũ_RRCC;եLF{CES[cks@@GE.?th`9FTF!Э BFT!qǜ U`!aS s- @!T@6TS s-S s-!aE ҥ- @!T@6TE -E -?P?@666 R666SR@.q`Tlގ dE>9S`@7``5REG@@B@T{A*SB[CcDkEsFC_{ C*1ATB;ՠE. ?!R@h`ڬ* @{¨_{S.O`B;ՠE. ?!R@h`*a@7!aa5@*SA{è_{cES@[ckd@/+bCX;ՠE. ?ִFk`` :;C~6Ѭ` :;Ҁ4~6ZFR*1TH@@*43?CqaTE. ?k`!R!X,qTR*RE/@@B@T[B*SAcCkD{ƨ_{SN`B;ՠE. ?!R@h`|*a@7!aa4@*SA{è_K{S[*nN*a@*7!a4[B*SA{è_RRR{D;[E.?ch`S#dW@S:@ @!`A-@@7р`4(!F:!Ҟ@7!ѡa4`@7``~4X@7р`q4[BSAcC#@{Ũ_{ES[c@/:@ s5M@M7A;ՠE.@? h`@ @!A !`P-`FGB#)@7Bb%4_Ҡ@7Ѡ`444E/@@B@T SA[BcC{ƨ_Ґҍ{I;c E.@? i`7o@;s@SE[Ӏks*?*@g27@W3`@7`a@!@ ?j4~@~.  |}.ҿkTB{`"{ ckTxS*fb@1@TB x bb"$?@ #;@_3@?@ cW7@~@؏@b6 Bт@A@ ?Z@@`6 @B@B@@?0`@7`b@B@@?֠Eg@@!@TJ SA[BcCkDsE{ͨ_ѠE{CS@/s@S _T@B T#D@<RFR%R҉S`?@`T@sF@-@!F!n t66F@ D!@:B @@!FTE;ՠE. ?Ҡh`S4@7р`2E/@@B@T {ASB@_{E;E.?֠h`bD@T@7!D B,!@Ctb@BT@7d@T@7!D B;!@3t{Ғn{{_{SE@@'a @@@@V- @ @1@T AjT@! # @a@!1@TaCx E'@@BaT@SA @!{Ũ< Ѐ !;;T'?|#RBc`b N % ~~AC@٪ @!@@@ C[@5W[@T5A@N[@5-[@T5u[@5~~RJRlu[@`E?@@B@T SA[BcCkD{Ȩ_ւBE{C@yE@@B@T {¨_{ @ST@`7 Ѐ B-!@?A;ՠE.@?4h`NqTTSA{¨]TFSA{¨_r{[6@SlTD" @@C@cT@dB$@ c 3!@ @e҂@J` XJa@7!aa41[BSA{è_тBE{S[ck ! Ta @`@ 7` F@A7!ѡ @BT@7`@7``O.@7р`H.D ! @o@@A7!9.vM@* ѡ7`..Y6`@7``&. a@7!aa.[BSAcCkD{Ũ_{c!ES[k+@"@_s@`@1 T`w`@(Ta@!@!T@7  @b@A@!1@TA9Fw4` @_*T@'@,TE !8@Do9BFD` Ta@!1@Tab@7Bbb-@!"@B1@T"ZBa@F!@!T@6\ n5@`7Ѡ- ҟMTzu@7!A-E_@@B@Tu[BSAcCkD+@{̨_ЄED@{CS@ҍT?@AT$Є@&R=*RҺM`@@@@V;a@7!aaC-E@@B@T3{ASB_{ES[cksC3@4@@1T@D_g`@[@?qT R$Rҁ R_@' _@`'4`@1T`"@`t@@1@T`@7`R,XR8R#N``@7``,b/GҀFK[[?G@@pF2@`?@,TT@L TnHP@9˄ ?kT4ADK*@7Bтb,6#`qTd. @7 `i,`@1@T`K@T@@[@_?@[K*@7!сH,@6_[@T@AqD xK*@6 7/`@6 !*,``$,@ARD @7р ,> @a@7р` ,A4@7Ѡ`+@7р`+SC@ [@ @4>@7р`+`@7``+ҀE@@B@T[BSAcCkDsE3@{ި_хХE{CS[c@7@3 ?T_ C TC$Є@>RfRERL`"`@ T@o5?J@7!сa+aT@%F!E7@"@c@Tk{ASB[CcD_хХE{CS[c@7@3 ?T_ C TC$@ RfRERҨK`"`@ T@5>9J@7!сa0+aT@!E7@"@c@T{ASB[CcD_!E{S[cksX@#@ҘA@3!`5c@ @!Dc @@B @`@7``( !4@SA{è_{S@</`@@!@!@X"qT`T @ D!`B @@njҎ % `@7` (@7!A(SA{¨_{[@Sc$AT?T`@1TxT @@ @A 6@`Ҁ`@`T`@T` @` .a@ `x`@ЁTa@@!ac@B1@Ta 6a @`@!a 1T`:!Ԛ?TSA[BcC{ĨǦ`,`"@~T ֚mT @7Ѡ (@b7(`@1@T`@7Ѡ`([BSAcC{Ĩ_{Sha@7!aa'SA{¨_{S[s 7@`7.(,(*(SA[B{è_{!@BE = C@/@=A@!1@TA<@ (Fr` `2E/@@B@T @{ƨ_{@SVеB @`-E!q+TT@ 6 F 6`m'"`@7``d''@SA{è_{" @BE A C@7 #@A@!1@TA/@A@!1@TAҥ#@'/@'Fr ` `1E7@@B@T  @{Ǩ_{BE @@/+@ @1@T @'Frr ` `x1E/@@B@T @{ƨ_{Sb|@ TSA @{èG-r@@ `! @ a@7!aa&y@SA{è_{S!E["@' T TB Ё B!@ !xG!@<5D !`@h[@@@1@T,@*7!ѡa&6D @1@T `@a&@ @1@T `@"RFab9&;U@7#@4`4@7!сa]&U;<*@7!ѡaO&46 @7р`F&R `@7``<&!E'@"@c@T+SA[B@{Ũ_{c*!ES[kys"@Oҟ|qT q@T5**!'`-*@!6!xG!@ < 56 GM*@7!сa%qTT@1@T !xG!@; 54@1@TR*@N`4`wҀ \;@;#?_ T*@E. ?ցk`B B @ ;@W` 57@*?@*63@@ $@ $N3@G@@@$@@$D*G@A6@7!A%K@%9@7!A%K@aD*K@6@A7!%%@7!A{%Z7Y4"6@@7!Ae%a@A6a@6%a@A6%a@6% R!aaL%%4@@7!A@%@ @7!a7%)!EO@"@c@T&SA[BcCkDsE{ʨ_{S!E[cx @#"@7X!F @1@T sF!xG!@;5`@@`@1`T``ғ 9F@7р@$`@xw?TKT"@@_T"@@_AT"@@_T@"@_D 6{F @ T@xw 6`@`6O`$ARcRa@*7!aa$V7/@s!F @1TsF  @`MTF!T`@`7`$ C*a@7!aa$V7 @T -i x@1@T`$$E7@@B@T[[BSAcC#@{Ǩ_{S@T@7D !@e< @T@7D !@e0c @ҁ!F_JT`@xbD !@@N @T@d7TB@D !@>@!1@T@7!A$SA{¨SA{¨_{#҂BE A@' !` nR`5@`7@/@R7@sFa@!1@TaG$E'@@B@T @{Ũ_{#҂BESA@/! !.#8R`5#@۪`7#@?@##R7D@҂BF4$ $E/@@B@T@SA{ƨ_{ST_8!k T5 **! jrDс@9?qT ! pT_8< D@8 _T#hb8qT} ! pB_ TSA@{è_{cES[c#d@oEo@@cATSA[BRcC#@{Ψ@9 uBѧv_8`>a"@8V TiTUbcHT@bRc@a AsOc =c@`"a A``@@`?B 8H?TO@9"9`j4T T`_cB9T`R`Eo@@B@T[BSAcC#@{Ψ_{ c S`p@SA{èZ!{S uBс@9b_8`>s"@8" TB`R&@@@SA{è_{ B S@@pSA{¨{S@ qaT@q!T`E@ b@**n` ` o {bBE= c|SalxaD@_T@@A@!A@ASA[B{è_AE)?khTcD@!D# C(_H!SA[B{è_A @ SA$[B{è_* F!P!_T`jI! s@?bC`(75@ {S A[*3 c@*z`ATz b@dQq T*z @@d`zSC$@$Rz`@DkTSRlShSd!KDU)@,j#[BSA{Ĩ_րAb@`cURDA@|@)adD5`@S@`@@B@@d`d4cxFA1 T 5 AV@ @?@ "R 4!=<Nf<BBT6r TRKR@cC*~z R BR5RA~ BQ%?k* B_0@ ?kT   `@94 R`E@H@@`?ր A cCqxSkbT A;{`E.@?#h`b@|?DS)@klT{_@|@q@z`T@8A 5`0@ @0@5!RBA@  B;{`E.`?Bh`#@ _B@@Bh@D@"?C{_A;{`E.@?S h`@ AF5` ELA``. ``P`SA{¨_BBF@!Q!@J3@ 5A!a``.P` `~ `SA{¨_a!`.!`j {s@E[*bW@@?b7BsbW`@ 7 ~bW@S7`a@A* bW@a@@c@`@7bW@`@bH6a@`@@@|Eck?`T87`@` a3, E V־FXFY9E c3@@ѣz`T@@`C`@b _ T_ T_| (T_T_|(TzT@@aW@6a@a_ T_ T_| T_jT!0@B?T!hb Ta@"@_ayT" @_yT  pTnT\@ oTb@ o@T@Sa@6 @1T@@1@T@7@@7@@`ҿMT#x`dT@dI7O7BybWC;`E.@?b@ch`@b@`AUc7@@ `C@tw@z t{@@` fa@ a@7!aac;@@ jc+@@bcS@@ b`_렖T`#_T`_T`C_TA!HD@8E!@D@`f@a?`g""w6a@c@A!@GATA!Da>_|ɕT!(@BѪ`/`@a@AY#@?T`@@!@?TaC@``G@a``@ `@@`@a@``@a@``@a@``@`;@\@@F!Ta@BBF@6SAcCkD ?S `@ ^C;@E. ?a@bh` !RB@`A3a@T@D! b@!@@rbW@`k@zT`ky#s@`@a@@Tbs!`aQaa@abW@3 T3@> aTC;@E.?V֚F`h`@@zT`@ SbW@b6@`w6V֚FC;@E. ?ah`@!@?vTh"@g"@Cf"@ @b" @bQh#@9g#@#Gb"@¿ @b" @?h@c@"@@뀸T`7@"`f&@& "!@b@_뀿Tb@b`@ !@?T`g@2f@&7»@`@ T`S@"@ @- 7t5c`w@6Rn@w07p4`@7`85B`C;@E. ?V֚Fah`@!@?T`@Ҡb:87R!A*A4V֚FB QqTT@4 *a@7!a7ckBBFy6@|EbW@^TH7Ss~E`!4@B 9"o@?@Tao`br@a@`@!@ T``@ a@bW@?TG6`V@`6BobW`@hT`#F;g&@b"@2 @b" @0@"@B@ @c"@0#@c`@`UsbsW/bH6`A`C;@E. ?"RR`h`@% AR(9bW@`bp6`_@@B'6`@@Tb@! @D!@qSAcCkDe@HD@TT@xG@ TT@LD@ST@0G@RT@D@@RT@hD@QT@E@QT@E@`PT@pGA!|D@BB|F@FdAA!,@U&,@0@F&0@f4@08@c&4@Jb&8@&?<@bL&<@@@FI&@@HH@@L@c&H@b&L@RP@h&P@T@qb&T@g1@ @c&@fb& @F$@BO&$@(@fb&(@&7+-/(@$,@b&(@5C5&,@0@&b&0@4@b&4@A g0@$@ @TTb&$@(@b&(@M @@g# @R&@@c&@@<&@f<@ @f&@&c&@@O&@@:&@: @g0@(@$@aGTb&(@G,@b&,@"g0@0@,@!dTb&0@&4@b&4@g0@4@0@aTb&4@&8@b&8@4g0@8@4@@+T4b&8@&<@b&<@F'g0@<@8@ T8b&<@@@b&@@F@ 70 ssasW=shsW:Ҩ qJ @7!p@|`@o7``o SAcCkDx|SJbg0@@@Tb&@@b&@9AbW@ @BibW,!T]<@t|@b&@ww&|@@Db&@&@b&@yҌB t@x@c&t@b&@t|@v&|@@A&@F@@c&@A.&@.a+@.g0@H@@@ATb&H@fL@b&L@ Bg0@@@AxTb&@fx@*&@F*a0@!@?ATMCf#@ @c# @c@C&@@[g0@t@x@ATb&t@f@b&@&qxg0@@t@ATb&@fo|@b&|@=teg0@@@ATb&@% @b& @&4@@@`jTc"@ @b" @(0@g0@L@H@ATb&L@FP@b&P@LH @@30@Y,@(0@c&,@fb&0@F4@&4@8@ b&8@fr<@8@@c&<@&b&@@H@&H@L@b&L@o"g0@P@L@[TLb&P@ET@b&T@Fdb*x@pt@b&x@#&t@@b&@U|@b&|@"|t@ @TbW@M4@$@ @@T #@G@ T@0G@Tj#8@4<@b&8@c&<@@@ƪb&@@H@b&H@F8@C@@@@(@*Sck@RT#' @@ATf&@f@b&@ g0@@@ATb&@F@b&@f`CsdsWy8@V0@U(@L@›P@LT@c&P@Fb&T@HX@ &X@\@ b&\@#scsWY$¸g0@,@(@ATb&,@0@b&0@&(`@?g0@ @@ATb& @F$@b&$@fqL@ @7 "b@@n' @ @Tc" @@b"@B"@_UTbW@#@@Ta`@``@`@@#@a@@T`a`@`@`@`' @ @ATf" @"@b&@sgsW#'#Ctb9Ns(@`4TG4@b@|@b&@f3&@@bhT@/nLSAcCkDbTw6`_@ Tb@ @D!@D !@ ISAcCkD#g0@x@p@ Tpb&x@ft@b&t@&%b@ @D!`g0@@|@`T|b&@@b&@F2T@1bT@PX@b&T@*,&X@\@b&\@F`@b&`@F0b,\@"\@X`@b&\@&`@d@b&d@h@b&h@d@`@\d@c&`@b&d@h@b&h@l@b&l@fҵBd@`h@b&d@&h@l@b&l@fp@b&p@&ҥh@dl@c&h@b&l@fp@&p@x@&b&x@&ҕl@hp@b&l@f&p@x@&b&x@&t@b&t@&҅x@"p@lx@c&p@ƾb&x@Ɵt@&t@@Ɯb&@frx@@g0@T@P@`TPb&T@fX@b&X@8g0@X@T@`TTb&X@\@b&\@)g0@\@X@TXb&\@`@b&`@Fg0@`@\@`T\b&`@Fd@b&d@ g0@d@`@`T`b&d@Fh@b&h@g0@h@d@`Tdb&h@Fl@b&l@g0@l@h@`Thb&l@Fp@b&p@Fg0@p@l@`Tlb&p@x@b&x@fl@"l@@K"|@@c&|@&b&@@B@^`@t@O@!1`T¤'b@[X@T\@c&X@b&\@`@&`@d@b&d@Ҋ\@d@g0@|@@`Tb&|@@b&@@g0@@@@TBsesW Re@@ 7@SAcCkD+b@ @D!ckO@D c @! @b@iSAb@ @D!ao`br@a@`@a `Ga@?Tg@Tzb@ @D! T@7рxSAcCkDa@`@bs@?T(g@D !@~i[6SAZhT@`7 @_B;{@E.`?Bh`!@{ A@`AY_ {ST}`RC;@E. ?a_bB`h`!@@h@d@!c?bSA{¨_SsFaB@ Pg1TsBsJ@ P'{A;S@E.@? h`[ @@sDTVEb Ճzs"Rc@aT)z3sTRSA[B{è_@D ! @ZF  {"R !@` @{¨_ BBF@H_{[!SV`@A!ET@_dAT`@r T?q TSA[B{è_a"@ 87b@c @7 T@F@@S @@?bAkw  T@1!T`@7`a@!@ ?ֶ4@qTSA[B{è_ @`@7`a@!@ ?֠@1TSA"@ AR@ 3"SA@`7Ѡ"@5!R 3"SA4`"@AR@b 3`"[BSA{è(ҙ!?q!TrT`@9!7@9R@F7Bbb=SA6Rj|raTa9`!6@9@Fvb6a9`6  {C;k@E.@?BBESc`h`C@7S @@s$TWD[ZcV6Fs[{EY9G T{s@T@r T @r`T` T@9?|q!a! @z` T_@ T@9?|q!a! @z@ T_ T@9?|q!a! @z T _T @9?|q!a! @zT_T@9?|q!a! @zT_T@9?|q!a! @zT_T@9?|q!a! @zT_T@9?|q!a! @zT `T@9?|q!a! @z`TT R!TsT[BsERA!E7@"@c!TSAcCkD{Ǩ_TaT`g\7g@ 5@7рvN6[BsE@{3 R[s]@A{37р@ R@T@7рKHu "_T IҀ$@ I?HTCcF`D@cL@š_  C;{@E.?[`h`S"|@WF@AT@TDQ">|Slxaa@Te@`@`@``RSA[B@{Ũ_`E)kTa@ a d(H ` @ *''@`v@I bC`(7''@@5@@ T 1*)("{RRҏR RRRRR0R բhb8q`TqTBc8B5"c8b8C5A *?k TT? kT? kT|@T*#"cb84 d|@!xT{_?kT? kaTQ# !|h!8Q!|h!8Q !|h!8Q R!|h!8Q R!|h!8_T@@Che8T@@chb8qT  "BF@D@BT@  {B;@E.`?S@h`[4F@@AT"q`">#r B$B$bDxdd"T%LB}ӆhb@kT_q@Ez Tb@"aa@!Qa4SA[B{Ĩ_a$@SA!xS[Bxa @` #{Ĩ_փB@B@#2@ T`I` _u @RvHeA~A@F @ eN!fC H_TD@@?kD@!A?kT?q@TaN! H@"_@T@Ba D@`@@ @b`H@|@`HbbD@dC@cdjucHCbR9juҀ@@`?j5`I` `?֭`bC(7td@5@k {R !@` @{¨_ {!!ES"@'# @"B4F?T@1@T` E'@@BҡTSA{Ũ_"BD?To'A[n TD# @T' T#@!  T T'#@!  '#@!  T#@! 3 '#@! 3 '#@!  3 ' #@!  'T[ 5@7р[B@#@+* UTH 5#@  [`@7`@#@x@7р[Bk8Fh[Bc`@6@  a {SiT@ @1T A T@ @1T A T @ @1T AT@ @1@T ATD`҃z`a@!1@Tax T D;@E. ?A_C@рh`!@@h@@!D?SA{¨_A @T@ @1TA mT @ @1T "BFA@@ Pg1TB@BH@_ATA,T P' {B;@E.`??@h` T@T@  AOSA"BF!Ac@BJ ^Q "5 ` @{¨_ @{¨ 4F~?MT{¨E R" Y`{S[BC;T@}s:Nӄs}@E.?B!}wh`?hT!$T6֚F K@?ր| sV@uH7J5[B @`t SA{Ĩ_֠@1`Ta`[B@ &R`" `6֚F@!@{_S[a_ @B~@A _@?@-V;!@?A T@E. ?j` b @qT @A @sDT "xsC@dC6s!T"BF@D@BT@@?@E. ?j`@@AB?<q,T#cD_T"!uSA[B{èuDA@s!@ ?ց@!TA@ ?_ @B@4SA[B{è_ҺT  _b_A@c~!@b!A_!@?_@@_  {A;@E.@? h`{_   `@@qlTRA_{#@@qTRA{¨_$_ RC@@c#A_$_ RC@@c#A `@B6_B@!@ {S@ Q`qT`R@tbSA{¨_@ QqT@4FF 4BKBiSA{¨b@"@!_B@!~@?@Q{S!!E[@#@'5zF_ T` @T@cbexa"D@ TF @T`TF@ TTF@T TG`fxfTaTV@lV H7  E'@@BTSA[B{Ũ_!`TexaT@$Є|EAT !?AT!?Texac7FҘҘ@u7@7ѠT` @cC Tcz~{7`cCrcC@C@-TD @ R?T`TD@ TTD@?T TB``Dx`TaTR_ R_?T@ |E?_ {"BES#@D@"BE!T" @_T! `TTR!!E@"@cTSA{è_@T   {c@ksS[(@9t4@!!E_T[BcCsE kDSA{ɨ_@1TBRC*@C@67@AT7@!h{T4 q` T&@9 ҵ @ @9"$@9Z ZєC ?qTj8eӠ` @`Tj` T {EӔT?qT?<q Tzx TS&@9!! š@@1@TBRO*@FG7!!B7@T@T5"@9@xs @98$@9#!і#?CC@T ;@7@h{T@T?@ ZEq?|qmTzt{S{@FHzST!GDG@@`{#S[ck+ @9$@9{ ؚ{c t5qT3k8S`|Ӡj`T @@T ZqlT3k8!T[BSAcCkD+@{ƨ_ TSA[BcCkD+@{ƨ_?q T3{x3@T Zt ?q T3{x`|Ӡj``T @?TZJӔ @t@ @_T @"@!J?rT@r Tr T@?r T?r` TcBb|15[BSAcCkD+@{ƨ_֔ Zt@ @_T @"@!J?r!T@r@TrT@?rT?rTcBb| 4ZJӔ @vq-T3{tqT3{t33{3{s@@cBb|4c@@?raT@{QR@SS [s. qT`H6  G@ @1@TTs; qTTq TqaTSs!O7 TG @1T vB; E. ?ց_Bh`!@@B@Bh@C@!`?@SA[B@{Ĩ_ss3q`TTQRjAT D @!#@8`O7ss @O7 @1T D !$@w= D !#@o=@cT@6#@c1TC@c1ATC #{R [{_{ #cE`@Tc@@TB; E.?&@%@h``.`@ T @{èZw B@TE; E.@?&@"h`B`.B`@!T @{è`@7`@@7р@ @{è_@{kZ@S99EaR[_c`+{b@9 5A`_4P4v~@T@p7@T@ap7`@ @ @9q T?h"8#`@$@9c š!_Tc @7`cc +@at!==N=RSA[BcCkD{ƨ_@!!!4FTS@!!!4FT_ ?TV@4@ ?TW@4@<qT?x"x$@9"B Ú!_@Tb @5\8Bb _ ? ?|qT?x"*RRA`@c_"PB"v~c@7@@7?x" {#[5v ՚SaUc~kZr*A`TqH TqTA@E?q T!Qod`R!|RHA`cdyc*9t~`C[BSAcCkD{Ũ_~؂T"BF@K@?@ `u"9y&9`z*9Rt~%`R![BSAcCkD{Ũ_ҿqT>qHT6"ٚ,~qT6"ٚ 6"ٚ {Sb@ F@SA{¨_{S[aV@`p6C; E. ?a_bB`h`!@@h@d@!c?b@1Tt RC; E.@?R`h`@m`[BSA{è_ր`@7``( { ``V@ p6D; E.@?"_#@рh`B@@h@@B$? @{¨_{ST@cNB}8NkBYO!7}ss}T:ZF[@ K@?|Rc@ V@H7@J 5 Ҡz9SA[BcCkD{Ũ_ր@1`TRK@  [BSAcCkD{ŨZ  { RC; E.@? @R`h`{¨@ @{¨_ {  @{¨R%E{S[?@wAc*k?TRO ,@r@^Tr]Ts?ATcEkF Ew@@BҡT{BSC[D_օ@9\87D[R F!4@1TcEkFcEkFX4F@ _1WTҔck,[ %J?@g@ S@T@_@q!T[@k@!@@?r Td@9q=T|qTqQT0T`@9Q?qh/T  c?k 7?@R?k5?@X:TW@˴G@C@)cEkFqHET?CTb@9a@9EQq)Tq`BTqR@Ez()T%QqTR! rc 0 ! ?k|qHTq)3T?Td@9Q?q%T c! ?qT8)Te@9qhT@@Tc8$_Tga TTe@9q TqaTk@ R+rR@qT?1Ta@9e@9&Qqh0Tq/Tq Jz/TQqhTd1  c ! $xITd@9q)T|qhTqIT? Ta@9%Qq,T$ c! $x@`Tc$x_?T#`'#<S!'(\S'``N"(/&h%p!g N!H@nNNN n0R66l ? ??|qmTx A*R)Gf@PB 4x aRPR/a_#A@`@!1@Tx5_8!*!"U88` @`^-4'`5{E G@'CC)KmT@ C@d7`<} @@!1@TB @aTE'@@BT @{ɨ_ֆ qT`<*}@!$*F@@ Pg1@T P'@H@ {C;  E. ?dh` 3BE@C@/!A' O )cF"^ @BQcJ%"C 5!S@@7#@!<"}a@!1@Ta B@@A@!1Tch@A_@d@!@!?b!E/@"@cT @{Ǩ__ch@@b _qT#@c@1!T 4c@"qT4FAd@) 5@!d@{SIT^t|ӿ svvP) @SA{è_@ RFs"`@ {lTS~ F K@?ր!FS "T@"H7J5SA!{è_"@B1T"ДFҀ K@?kSAG!)@40@@T@7h@ _"T@6{B;!@E.`?@h`!Ң@!{_ ?_@_ @@cTET @ @@cG!EAT@_  {_C;E.@?$@`h`"_@B@h@@Bd ?{_օ &c`"B*dR>T@@B6B;{!E.`?@h`{@!!`A!Y__ {S@>@"!_AT @Tb@_rT_rTa @BB`A|`SA{¨_SA{¨`a @BBA|`SA{¨H`@7>@SA{¨@?<HT@!@ !|_$"C!R!KDBexbӣ|C@TD_T@hxb}CTD _T @fxb|CCTbxbӄ`B|C@TxdcTCc |@!|_   @9))!ǚ)"%@#qT h81Th#8!`@T%@ @9#qT<q,Txx!T<qTx#x!`_T_֨Ec#h81@TJcc#qTh81TcEccc Ec#<qTxxT<qTxxaT|qMTxc|qmTxcTx#x|qlTx#|q TxcATx#xxEc#{a@B~ @!@C!aa_!@?@7!a`@@7!`@@7!! @{¨ 420  {@#_T@_}B8NB}C;E.?`h`@,@qTЄFcQ,!{@X@Bh@D;E.?%_h`~d@@@d,@?qlTF!{@X@Bh@ { @@b@_aT@b@_T @{¨_|E {!ET@#@/B7E/@@BaT{ƨ_S]`abF95`V@laV H6SAF[C#'ҽ'@4+@@@?TT[B@S[SAB;E.`?*[R@h`@O65z` ?7~5[B@BA;{E.@? h`0@`{_@  @AT@6A@_D{@!B @vP{_  {ShTsRFs"`SA{è_[Ru^ӵS ~@@}5avUvs|[B 4R[B6R{SdR C;E.@?"R`h`@8@ T@6`@1!T@1@Ta@*6@*SA{è_`RKa@7!a  {#@cy4F[!@?aT7 @7 @T Tv _S`jT@4cTTT `TT TTzv zsszsszs szs szs`szss`Tzsuzu zs zs`zszszs zsTO\lT{SAR[BcC#@{Ũ_RB}`?bF@@APg!1T@H@@z6!7!PAP'@z3A7!F@z3A7!>@z37!6v @7 [BZ&[BqR"$K@z57!a@z3a7! v@z3A7!}SA[B@z37!Z@z37!!O@z37!;@z3a7!6@z37!as1@z3!7!<@z37!:@z37!!/  {B @S!TҦ@V@ p6D;E. ?a_b@рh`!@@h@@!d?O9`s`@1Ts SA{¨_`` `@7` `?x { @`@@6`@ `@@@7!@!@ ?`@`@@ @R{¨_!!Q@7!AI@a7!A@7!a9@ 7!1{ShTsRFs"`SA{è_w@`wT*SA{è+ST ~@ }s`v"D^Ӵ@ T@_ @aT R_{q{_{@SBED@bT@"6#@BE!T" @_T@!E@"@cҁTSA{è_} TۀRI{S @[@T@6 @1TC;E.@?R`h`@N@Tj*a@6[B*SA{è_E;E.@?Rh`$`?a@*7!aacD @!@ `@M&@6 &@`?*a@6`@7``"@D@@!c c! mMNJ@!c c! \M`@7`7   {c @S[T@@A36`V@@7`@@1"T`@1@T`+bV@ 7@ @2K1TX2A;E.`?@ h`@bH6aAA#6%`@T@@*6@1T@1@T *7@7Ѡa@7!aA*@`6SA*[BcC{Ǩ_@1!T@@#`?* @!@ ?^s6A;E.@?@k$h`@E@7YA?T@TgT @v?_8_8_T_8[R_T_8{R_@T_8R_T{Kb8_T?kT!Q8@7!@!@ ?kDRsEB;E. ?a@Bh` A@ `AY 6?qT;*Kdf8"8?kT$*b d8&8?k-T"*&Kdb8&8?k-TbBK"KF_8#8?klTD*V6,E@N4!xF*G@a4@! FL>"@@_`TB" @#@G"@B1@T6_8 *A!$88sEbр! @MT?&''@9$@%l@ ǚ1 T@ =h%=N =T7@s v*kDsEV6E*6!<@ ?TGNkDsE4kD*sE66@1@TV*@@76lRGf@GB @! @KkDsEY*cD @!@ `@K$B @aڃ! !} oGb@@!@ Kb@! K|! ~K|{B;[E.`?Dh`5CSA@"JB,RECP@'cA`s?kT`YT*B,BABW@!E'@"@ATSA[B@{Ũ_9G@5a@E?T` @T< 4ÂAR`@AaJ@%,1,ӡP!A #3 YTb@37B"@!@ ?@36?1`TҼsM {S!E[c @7҃@ET@TTӮ@`@x @1T` Ta@k T@` 7 @Y;@!T@ 63@Y;E. ?!k` 0@@` T`@T@7@@!T@63@VE. ? k`0@ Z Ts|b{z T@ 7 @@!T@ 63@E. ? k`0@` Z_ATkDsE kD`@7` E7@@B! TSA[BcC{Ǩ_kDsEY;E.@?!@"k` A@ `AY@!T@7؀R[FkDE.@?"k` @A@ `AY@!T@7؀RDF@!@ `AY@!T@7؀R5FTҬks@kD`@6@sE@ mTZsvD4 Rk7Ӯ@ R  {@cEe@҃T@6C @!E@"@caT{¨_޿؀RE{S T@6 RSA{Ĩ_`6@7A s`4["3a@7`6@`JTzu@5[B@R`V@[Bm@`V!F LkhT["   @{SF K@?aV@H7J5SA!{è_a@!1TaSA{è+*u~@  BE{C@$@T@Sb8@B@cE@d@ TSA{è`4@@`T@ 6xFT!F!A 7@!FA`T@@7!AHE@@BҡTSA{è_ @@@0@@!E!@aTE@@BҠTE@@B!TSA{èY1|Db@!@,IDb @!@"IE@@BaT{è**SDB @! @ISA{è{FS* K@?F47`T@!H7J5q ҔZ`t@SA{è_A`T@!O6@!1T}_~  !Rb@9qlT@'& ?kT_tq@ThT_qT_ qTB45b@8?kT__qTiT_lqTb@8_tqT T_qT_q!TQc šT_q T_qT%5b@8%R_lqT_qT_qTQ4_qTcD{@! %{_{cES@[`@/* #@9qTcQeqhTqTD!@%7 qT@!%! Ú?BTqT!R!E/@"@&T*SA[B"R{ƨe Xcxce%"@9`@a@_q TA7<!}a@TR@_88qT@1@TE/@@B!T[BSA{ƨ_" b_qT`@!a@`@!7,!}a!E/@"@cTSA[B{ƨa@`@7<!}a@@ @9q(T/E/@@cҁT[BSA{ƨFa@`@a7<!}a!E/@"@cAT@" b_qT`@!" b_qT`@!" b_qlT`@!Rk@7c_ T*6 *0@7@@6@7!a9 a@`@A 7,!}a@!CC9ia@`@7,!}a!E/@"@cA T@SA[B{ƨIa@`@ 7<!}a!E/@"@c T@SA[B{ƨ[@@9?qATcCkD<La@`@aA6" b_q@T`@!@@ @9q@T!a@`@4A6" b_qLAT`@!@TA!F @1TF" b_qT`@!6" b_q :T<!}a@<!}a@!EB@/@"@8Tck" b_qT`@!" b_qLT`@!D! @b$*R"kDC *cR@7`@7р`cCkDC*cR@ 6@7рD!@*$cCkD ҮcCkD9 !a@`@54$7<!}a@a@`@!7<!}a@@ @9q TE/@@cҡT[BSA{ƨ!a@`@U"57,}`D!`@#Y! a?qLTa@`@a7<!}a!E/@"@cҡT@SA@m[B{ƨRRa@`@7,!}a!E/@"@cATSA[B@{ƨw" b_qlT`@! q T@!"! Ú?@T_8qITcQb_qTqTB BBXcxcb"@֡ Rcc`,@ T*@ x8a@`@a7<!}a!E/@"@cAT@* R0@7рcC* R!cC@@9?tqTcC@7р D!@D#cC" b_qlT`@!" b_qT`@!-a@`@ 7<!}a!E/@"@cҁT@SA[B{ƨa@`@! 7,!}a!E/@"@cAT@a@`@A7<!}a!E/@"@caT@SA[B{ƨ*D!@@"n"@b_qT` @!" b_q T`@!" b_qT`@!kcCT7<!}a@" b_qT`@!" b_qLT`@!" b_qT`@!d@aT!@a?q T"1SA[B{ƨ<!}atE/@@cT[BSA{ƨ<!}a{FSҡ }`R@SA{è_{@!T@A6@?<T@!@ |{_$"C`!R!KB_TxbxxDaT |@|?q`@TG!@D"D!@<"IR @  {S@T@g$@T @1Tu @`@jTb@RTx5@a SA{è_ 7a@R4x5@!*R @@SA{è{S@?JT @t~aˀ?T3TcF@*}ӥ@fP@`D@T1@RSA@{è_TR 3yt~F!@*ҥ@P@D@`T?@ cF@*fP@`D@TD _a{C;[E.?ch`S֚Ft@@ T`qdrIbbxb`cTbNc}hc@kTqBz T$@nS? TSA[B{Ĩ_֔ TSA[B{Ĩ_>@B&2@T[BSA?{Ĩ![BSA{ĨրbC/6@`5@  {@!T@A6R@@B6R{_:R ?BR  ,c,cE{FS[k*sa@ҥYA}@@TtJm0T@5F @ `DT҂@(R&@)F*K@JE gT jAT TB @B_q!ҿT& ՂxaF@eT j3T T4B @B_qc!xaF@cT ja$T T4B @B_qc!TRBEj8T*A+5I% ;%Tc}=5ҟ3T ##C?  _ 3 #@ET!@G@H`?|@+T7C\T)TG@H`?|@TaT}B ?T@#@$G@H`?|@KTT"TM T7Ҕ C) Ts{*w ո@`HDz`w@aT:@ @@ӚrOTr#@r OTr#!!q4TT{@*T@ @|SsFDz`;@bӔ4SN#@rTr`LT!46cTF"TCB}ӡ˘?@C@"#Ts@@;Ak@@5g@|@o@|{?@yh"h"9< }; TgIsJ[@c@@q T+@!6TcCеFqA,)T@!(TMAYs 59@1:TEH@B&T{@SA ,[BkDsEc,_?@ TC@@AxaK@ A?T  jTB@_@1"#`?|@JTsJgI[@c@@4cCһT"\@#@raT!@p5TV#s% ;@!*TMAYеF8T`zt+TBE 6Td@cPB8BA4 @4TH!-?@&ˤ@} @B js} ! չj3C@(Ts@@B@_@1fQ#R!|{@EAha@!@!CABBsTTqMTQ"|{!|@B@_kmTl@;A!B!BQ!|{a3@A]qT#l !;ABFj TP;QRA|@|{B\$B_@_*T!?B@_@' @T @@T(R**5%;4} с_T @"@#?cT, T,c$ c`  zz{:Z_ T T@Ќ5F @ TcCcF @"@#?cTеF ҟJT{t@7!AT@TcC<@c ?,T,c! % ;ӵ4}F`c @cCT4FFA,% c#еF! ;EFcCD!@FIZ_T{z@7!Z&@C@F#L TNAYcC:FMAYcCZ~+pJF(R)E**҆xb@ !T@ @@ T4  j!T T4 @* RqcB_T5!Pj@!@uFMAYSP^@>!*PR@@1  {@S@3@ғrTr@T#@rTr@T!u4|SSA{¨_@#@rT!@j5য়! {ES[*ck@?2kT T T@cC*+s T*k`  T*c@ T*[ T*S`T*J`z6T+@@95E?@@BTSA[BcCkD{Ȩ_}@@cc*cR@Tzs@7!As6vuVD!@?Ts_ {B @STIV@`p6A;E.@?b_cB h`!B@ =a@h@@Bd ?~fb`=u@SA{è_`?` ~=`ab`=`4`@7`` {S!E[@ @7!EƌDFT`T@R!E7@"@cATSA[B{Ǩ_ @c@T B@aT @TcCE@1a T`@!BsB?Tb@B@!@5NB @@@@4sT@a|@Aha?$UT@m 5@t@MT@4b@_DV!TsBATcC@@@@1 Tc@sBaTcCE`@5`5 ET[`55'@@7!'``@7``bZf @/! @@ BJT#ccCa@4D4cCIc7cCE@@!!ӊ@4;2`@7`@'@@7!%+!{S@n@bA!_T@1Tr@`LE?$@TSA{¨_@?@r@LE?$@aTD@!@>`@7`@4SA{¨D@! @={ @T@@6 FJ `@?1TD;E.@?"_ch`B@ @c@ch@d@3 B#?` @{¨_C;E.@?"_dh`@@#@т@Dh@@3 $?𡊀R"9 {BP@cp@AT @ @"@_T B @"@!1@T{¨_`?֠ @ ? 7BA;E.@?3h``2@ @{¨_l@ !hD!@?`4z @@"@_jT B @"@!1AT__@? 7Bb_{D{_{S @[1cksTcbB<Rv&@@ b@B ` @c` V"TRSA[BcCkDsE{Ǩ_T{QB1ATZE  j_[BSAAcCB~kDAЁsE{ǨL@?AT @7 R @BE!T"@_T33@`5 @31@T BR7"@*7@7B"Bq,TaTcbB3@T@TubRaW7@ @7 `  {cES[k@@w?cT@" T T| R AOU?TTB@TC@@@$|efjd&cj$B@bTATR!Ew@"@cҡTSA[BcCkD{Ϩ_TE!!!$|edjd$$T@ A+?q`Tұ+[{C4{ T"@_D[T9CA? T@ABC +@#@9C{a@B~  @!@C!aa_!@?`@6 @{¨!A@!@ ? @{¨{ b2@ @{è_֢@@`D@B`nB@b@7BbD@BCB TBCB  {SFt @@H@`@ Ta_[b_ @B~d@@A@ `2a_!@?_TV;E. ?j`@bqLT D Tc}w @`@6`T@`@a 6T`jx`@a6T_`@! 6T_`@ 6DTwbztс @р6!Tt @E. ?j`c@@4cC?LlT!A"^_<qT4FAT BAOc"SA[B{Ĩ!@!@ ?֟Tt @!@!@ ?֟%Tt @E. ?j`c@@a@ ?֕[BSA{Ĩ_!@!@ ?֟eTt @!A@!@ ?֔Tt @!@!@ ?֟%Tt @a@2!@?TTV;cg"b!@!@ ?ևA;E.@?c@ h`@Tҋ@qTt @I[BSA{Ĩa@cCb_ @B@[B`3 {ES[@O*"@BT@_cd@*Tb@*DT@6@l@B*AT?`Tb @R!EO@"@cTSA[B{ʨ_!@d@`@ @_ T4R@@cҥ @9 Ś Ú_mTBEҀ(@9RBBqB ŚB}BB@BڂK`5`@sCc @k#3K3@z 4C@@1@T?@@1@TG@qT@1@T@1@T*@6@7!с%5`@ @`TlF!`@cCkDsE @9 qTaRcM@@@`_a @^`cCs_cCmT5@7R`kk@cCkDsE]  c@7!kQqTb@@* 6@7!!793 q4 T5@7# @7`=cCZkD#F` e ƚ Ś_T*cks7*q5@7@1TDkk@Q@6@7р`cCkDsE@ 7x@7рp2!j_8KcCЁ`Rd5@7@@7cCkDKa@7`A@7:cCkD4cCkD.V+: {SE. ?[U;a@j`@`b@97!a5A*@P@?LTcb_C 7aZB" c_@@c~e@@b@@b_B@ ?TE.@?ֵj`5 @bq T@A @@T `_ Aa@F<qmT!@ ?5SA[BcC{ƨB E?aTB 5cCSA[B{ƨ_aZB"b@B@_`T#a@#9 @zxkT_8:o#@4ҡRҪ+Aa@@P*@? T!7a/T@/@qTa_@@!@cC`S{S3[c (@9!$@9@s"4Tb@@@6b@C@dC6sBaT"@9 qTBFSA[BcC{Ĩ@X@Bh@CA@!@ ?DA@sB!@ ?֟T"@9 qAT A@E?<qT*@9b4!!SAcCVH[B{Ĩ_Ts@@ TT`T`@`@A6`@`@6sb4`@`@!6`@`@6sb`@`@A 6`@`@ 6sbT`@`@6`@xb`@6@`@6@c`@A6`@`@6@`@6`@`@A6#T`@`@!7!@!@ ?!a@!@ ?!A@!@ ?!@!@ ?!@!@ ?!A@!@ ?!@!@ ?!@!@ ?!@!@ ?֑!A@!@ ?֎!!@!@ ?}!@!@ ?r!@!@ ?a!A@!@ ?^@_  BE!F@_ {$@aTS? TTt [~ӟ)TRTbD@_kT*_k)TD!@h7SA[B{è_R@S?q!TrTrc|eTD<Tfab2AT @!@@9B @_@8 _@8 _@8TscT`F@`8TSA[B{è?q Tr T@ T@B` @!A!CN!BNN<T_@ TE~B˧~`|aTe`jf@=@nAN(!`h'6B!"@9"@9"@9! @ 9ެnF@A_!1ATSA}SA[ByrT@|c_T@<(ar!@vrAa@?qTRF"t?y! B|z!@!1TSAJaR`2Dd>AB !`)TD@"$xSA6 {@b_T{¨_@S_qAT rTr" BD@9RB9cFt_qs~zssT`@1aT @7 `O @` @"@ sFb`T@7BBa@ _1@T a @0  { @T@`6`"@06`@rTTrT` @ ` @{è_b@$1T@`"@a4`@rTb@a>@4`@b@"`@ `B   {SE@@@T@6"@E_T" @_@TD;E.`?֓h`t2@2`2@t2@7!@!E@"@cTSA{è_ֽmTE. ?D;.8{S?TR5`@rTra`@SA{è_@9R9!FStqs~z3s`@1T``@{S AT@9RBFAh`!1TSA@{è_R'lSA@{è_Fl1TSAҵ,SAD!@@SAAh  {S T[*U5֚F K@?|FT@`H7J@5!at5t9[BSA{è_@!1Ti SA[B{èjG! @m֚F[֚Fl1@T,[B[B  {SE. ?[V;Ղ"@c!Ej`#@/S@@s$TEU` աzs/ @!/T"Rz3sT@Ҝ@*7&@E. ?j` @@sTEb աzs+ @a+T"Rz3sTE. ?j`"@@E#4@*E@BA!}&F K@?%V@v`H7J'5 `w D@?MT@9F(6_qR%R?T@9Gb(6qc?T@9G(6qc? T@9G"(6qc?TRig8'(6?qcBG|@?"T@@B1@T@@g: @B1T@h>B1@T@@@gB*@B1i2gF@ T@hFB1T"@@gB1@T@hB1@T@d2B1@T<6@`6`B<<@B1TB`. d$a )AAe )cfZa^~ ~ ^A4@!A@` @Ta@9?\qaTR Ta@9?\qT!RaRu@6E/@@B T[BSAcC{ƨ_RRRѠ`@!@ ?TARBBbhb8_\qT!"|@!,T5|SRRG@1T25B G5B L5B Q5G YR#RR2c8c>cDcMZ@hFB1AT"@@gB1aTkk*@AB@@ @.! k@k+ڂC @+@9Y˿T84kD҂+@@*E@BAkD!}h hlhkDhD! @`4h!@ CJTAku8@U#C<qTA9 @su~@3TAk87s!87+@BB!!*A9v;*@ A;{E.@? h`@{@_@ @.! U {SB!}aV@AH7!F!JA5!SA{è_SA{èhg@a@!1TaB;{*E.?SBh`T@ASQ95SA{Ǩ_q#cb#kZF9#$[RsP36b8o*zb@?o@ 7s~S5[BcCkDsEo/'o@oJ@o@7!сo$@o@7oo@@@1@T@oo@@B&c@TBF@X@Bh@ {%@[@@ Sc#p &@ Q&?q- T?a@&@B&A7!aa@!@ ?ֿT#@[BSAcC{ŨK@T@7 @Z6`&@Q&qT?a@&@&6@`7!`@7`SAcC#@3D[B{Ũ_ҡ!%24a@a6SAcC#@$@dQ$qmTR_{2q{_  {D;cxFSE.?[h`Tc@`?`@ATc@`?@7[BSA{è_ @T TD!&@&A`4@@7р`Ҥ!Dc@!@B&*b@@@@@1T   gE{SRR[xcks?cG@OcGK?_8qT TqTq T 5hfߔq@z` T?sR_8qT75q?"qT5@?E?@@BTsE" b_qlT`@!A@@@!7<!}a@3~ aT]A@@@7<!}a@@ T@6(T!8E4 @ TE?@@BAT@<" b_qT`@!" b_qT`@!`@9`9@@9`9A@@@7<!}a@@ T@6 @ TE?@@B!T<A@@@7<!}a@P-Tc9" b_qLT`@!A@@@7<!}a@`TTG!8@ q@@B@7@<}`!8EE@P5E?@@BҡT <" b_q,T`@! a?q Tb@B G!8@ @" b_qLT`@!<!}a,`/@Sr!T@?q`T?qT@@#r'a@s`@7<!}a@ @T@7 -!E?@"@cTsEE?@@BAT>" b_qT`@!" b_qLT`@!E?@@BTsE>!8Ecc@56c77@c@@AT !-*@1@T @ !B@b_qT<@}`_!]{SEk:@@7A@? T? T?| T?IT2@!`c@ T[R+a@g@1@TT`B@sk@TRj[B9+@cCE7@@BATkDSA{Ǩ_?|(T`B@skT@BFT @d@@TB;E.`?@h`@`AtA l@TB,,C@ C4@BTBC@clҠ T T| TT2@CT@h`@@@|T@CT"@`@B @_T@#@@_ T @@T_`T@T_T@T_ T`dxd T_aT5Rny @T@|ET;@a6@! z @ T5RX:@! qBTG`TF?Ty @`*?TV@5RtVB6@ B*@!WR@! @S"@ B@_!TT@+{OE(:@ *@тR@ [c+AT{FcC- .!T+ .! LA;{E.@? h`@ {_ .! 9 .!3 @T@6@%@@ @GT(@9& $@9 ɚ4@@ @%"F#` R_֨ @@@%"C D RT@&TR_@mT@ $@9_8 ɚP(h@ @ @mT @ `MT@ -T@fLTR`lTR@,TR  { @@C@b@ @{¨@1@T @{¨_{"@CT@@6J@SBB5!TR!SA@{è_`?`*SA"@`"@@?`DB @!@ @F(G@@! <(SA{'@SE[@'v@T@ X6@ujf5 D@Tb@D;E.`?B0@h`B 6I !E'@#@ҡT[BSA{ŨҠ?E'@@BTcϝ@c,#@A?-cCE'@@cAT[BSA{Ũ:b @ !E'@"@cTSA[BcC{Ũ_֕{A;SE.@?4h`@T1` @@`(7`@@?ց&@!&SA{è_z@4(!D@!@B `@7`@^{ $@#Q$?qT` @@ @{¨_ց!%(4{_Sa b_ @B~d@@A@ `8a_!@?_!TA;E.@?4h`@bq,Tb@ ` @@H6`@@7!`@@7!a`@@7!SA{¨@!@ ?@!@ ?@!@ ?a@8!@? Tt@.@q-Tb_ @B@`3SA{¨_ {R@SA_k$T`@$5[ cx@`R?k`$T֚FH@?%*`b@b@!5k*B+b:RkT`b@5y@`b@y5#@b@BQb_Tw@*z4BbkTL`b@4b@BQwb4kD`@+@Q*x``@wQ`4yb@5`@ҟTZ}_gTZcscR@ mT@ T @`T@T@`TR@}!j`Ch |@!,TF@V@@?@`@Q``@?T@C@v@?`TC@c@?TC@c@? TC @c@? TDxcd@c?AThT ѵ}ӿfTbc R@6 T@҃xa#b@_Tf@%@@9_Tf@@@%_@Tg@$ @@$_ `Tdh@' @yd'_!T !TB@ !TkD+@b@[BBQcCbSA{ƨ_ZA}ӊ b@*`@ Mb@BQ R`b-ң?TҞ҉Ҏ@Q(}%K`b@a@`4!QaK`b@5֚Fw@H@?` R`b7[`@Q 3[b@AQkD+@R[B RcCkD+@`b![ R`b[`@kDQ+@{!ESs @"@Ҡja@BnTb @aA@9a ?@qjTtzsQLq)TD!`%@ !@[!X`x`! [B ca@"@*cT" @!F\x`bT@1T[B` @Q` E@@Bҡ=TSAsE{Ԩ_֠hD@@1`T[Be {@jTҞc * ("s4[BI|@1'Tc 5& T`c@T{b TuaTo aTi``@Tc_#T]^'TcU]z3sATc {@:Tq@9Tҟq>TL[c325c@V3k?@3T5:14T@369 {@CTZcs4 c_S(5ckc G1sT K1rT O1qT 1pT S1nTC@;?`l;`rqonqp W1 qTh 7#[@C@w@?@;@@#@'@ og+/37[@@c35C@?@;@[BcCkD!F @1!AT[BF4RE {@ITH `B`cI5c@45R/|@1`T ?c 4E;E. ?"Rh`@c4@`@ 6@7р@A[BҊ5R {@ATv [BRRR  T{5m!E @1HT[BEe!F @1HT[BF\!F @1T[BFS %c#T{@{h"TWRڵѶ@qA}֔Zk RKc|@  ?T͜* @qhTȜ @qT? z99~ a 'T4E35`@_[Bb@_@q![ck37@[BwRRR @qTqVzT~  kT kDcC4`@w@T@c7Ѡ[BcCq@T5[BcCkDc@b@5Ѡ`9R@7 @7Ѡ cD2c35[BcCc@r D!"@S[BcCUcؾ[BcC\@@c7˾D!`#@5oc45c@7р`D! @!kDcCS4c @7р@!`kDc@D!$@a D!@[B@wD!@kDD!`@ k`7RR8kbӣ4KscS 5c@`K"7`@7`!@7р@9 #R*Cs4 D!$@[B\I~ a!T[BT` @@ @@9b @@` @qTDb A !.@vyc `@*1TsD!``@c`@`$`4`@![sDD!@@P[Bd@@c7р`[BҙD! @=ɽO D!@0[BҺ[BRJ<D!@[BqB;ՠE. ?@h`@c@ {@ T @D!@!@[BU3@`~ aT[B3@H3H@`~ aaTH~@` baTA`j-s5[B3@0~@` bT[B3@#  `@7``Q@c7Ѡ[Bc@ Uc5c@ҟTa@ x4c1`@7`@ 7р$!`@c`7`D!"@}|;sc@Czyw qtiq`aUOH@=9M[BcCkD  { @!@?BT" @9{_@ h @9@71aTD!`@R{@s*!k T`@ 5|@! RSk`5zc@|z5`@kT`@|@ q T|:5!!+ R25`c@|5!!1 R@C5`c@|5!!@6 R[c%5zc@|.5`@k@T`@|@ qT|z-5`@k`T`@a@|@ q7T|5 `R?k MTx@kMT*b@aB-BxUB) NaR)xk5!Q[DcE|SC!QkF{BasG_a@R|"b?kTzc@5cwB)[k`T`@a@wB)5APR iaR ^+zc@w5APR RaR n zc@5`@a@r@g@*ŘC)* (a@[D!QcE`@RbkTzc@5t@@ zc@t5a@`!Qzc@!Q|a4a@SC!QkF |7`@axa@ qTzc@. 7`@axa@ qTzc@J 7`@ba@xb@ q!Tzc@Ia@R|"b?kTzc@5wB)kT`@a@wB)5NR6 B,aR  -zc@w5NR! B,aR@o2@zc@ڥ5 zc@:5`@a@Lr`@**&C)a@!Qzc@aa@R"b?k@Tzc@:5tB)k T`@a@tB)!5AQR o aQR{aR@aRzc@5zc@5`@a@r@C)a@***!wa@!Qzc@|a4a@SC!Q[DcEkF`@Rbk[Tzc@Z[5t@zc@tZZ5s a@zc@!Q|a4b @j@dBf@ @0H) H@cL@@  q@T2a@!Q 4@zc@`@a@qC)`@t`g@**** a@!Q[DcEazc@ |`R?k`Tzc@:5sB)kT`@a@sB)a5PR2 ҤaR* ~zc@5`@a@dqg@*%C)*r  b@BQzc@*b a@R"b?kTzc@:J5sB)[k<T`@a@sB)M5LRR zc@s<5LR#`aRaRczc@:850@7`@a@q@C)g@*****a@!Q[DcEzc@|a4I`@a@p`a@**C)@?  `@ L@ H@@A@@@D@ a@!QOC`c@`$5`cB)kAT`7`@ac@xB)#5aB- }NOaRx RtRp `@Rbk@T`c@5`@Ҵ4`c@a@35`-9W `R?kT`c@5`@a@`5W@uO_ac@Ka 5aR= S` `@|Z@`@K@QS@zb`?!T9G!}(G@,`@a@z7zc@sz!5!R LRR` zc@s5!R 0LR/" /aR.aRczc@5H`@a@3p@C)&g@****B@(Rc a@!Q@`awzc@:5a@Vt@!@@:T!@}Zj`"h b@RBQb `@a@of@*C)*O@aB.AR1 sa@!Q R`cs`@Qb@*x`B4`c@5 `R?kTt@aB-MR!ERc&!@DB.AR`a@!Q,Ba@!Q8a@!Q` R`c`@RbkT!`-@N^zc@4@`5`-uK  N^zc@4a@!Q@`a4fAzc@5`@R0zc@aR*@R&RR(5zc@cEzc@cE^ 7`@a@zc@sB)! 54a@[D!QN!`Rzc@5R@aRcN`@a@9odg@*C)* !Ec&R!@'D `@QQK@!Dc- @R!@D a@!Qzc@cEzc@ R*`c Q' R`cQ`@Qa@!Q3qA a@!Qa@ R[D*!Q`ca@ 5 `R?k@ T!Rcw@zc@Z 4w5!Rzc@z"4cEa@!Qsa4~a@ R*`cSzc@aR)s 45 `R?knTs@!Rxzc@5LRsFRl zc@sl5!Rezc@:l5LR`lR\k/I kRUzc@:j5RPjRLi!Ec&R!@Cha@!Qh R*`c[D!Q{@zc@4a@!QLR. FaR&@R"RR$5zc@a@ `R?kTx@NRaR @RRR 5zc@x5NRaR@K!R 5zc@xZ5NRaRM-@ORRpu>zc@4x:5NR aRM@MOR@`@RbkTzc@5t@Ku=zc@Z4ta@!Qa:4!Qwal4`@Q`7`@a@zc@wB)a4a@4!Qa`@!R*acQ`x@@?LR~Ry@LHRrzc@5RmaRi@ReRRg@5zc@@zc@4a@!Q!D@c@'R!@B@a@!QcEzc@!Dd@c *R!@B a@!Qzc@!Ec +R!@sB@ R*`caR$zc@WaRa@zc@!Qz?g!ECi+!@bBiC@a@!Qa!Qgzc@t_cE R*`co+!EdCi?: 7`@a@zc@sB)45HJzc@s:v4a@!Qazc@wZ5NRB,aR ) M zc@z5@zc@5`@a@m@a@**C)UB,aR9Ch?#zc@ R**`cbzuRzc@:u5RtaRtc `@a@lg@*C)*N&= R`c$`@[DQcE`zc@@cEzc@a@!Qa@ `R?kTs@APRc`R\!Ec&R!@A a@!Qzc@wa/4`@[DQcE`zc@a@ R*`c!Qa:[D RcE*`ca>zc@Z4a@!Qzc@sz5APR' ƟaR@RRR5a@zc@!Q R*`c>!Dd@c@&R!@GAD@7`@a@zc@wB)4a@:4[D!QcEa`@Q``@!R[DQcE*ac`SC!Q[DcEkF R*`c Ra@*`ca@[D!QcEzc@[D RcE*`c >pcEzc@<cE:zc@sx> R*`ca`@zc@Q` R*`c7*a@ `R?k Ts@!Rzc@4s5!Rzc@4a@!Qta:64a@!Q`7`@a@zc@tB)4a@4!Qa@ R*`c!Q7>zc@4AQRsh`aQRl-uRe!Ec&R!@@ })a@!Q`zc@zc@AQRP|haQRH  uaRA@R=RR?` 5zc@ R*`czc@t5!R+ AQR'Th aQRtaR`aRzc@5ezc@z==zc@4a@!Qzc@a@[D!Q!Qzc@a@ R`c!Q R*`cKa@!Q`zc@f R*`cb=`c@@4a@!Q!Dd@c(R!@@ lx=`c@ h4a@!Q`c@t`5aB-H`aRR`RR4!Dd"@c.R!@?fwa@!Q@ R`c`@tzc@45Ba@ zc@!Q_zc@:5`@a@jC)șa@***3SB)R{s@ a*{_{SB[*w@?T`@R*`_k`Ttb@*5`@k@T`@u@ q`TuT5`@kT`@u@q T`@Q`k[BwSA@{Ĩ_ ?k[BwSA@{Ĩ_l`7`@axa@q!T4Ra@7`@axa@ qTtb@@q @zT`@#RaB)cJ?k TTaC@qTG@!R@`@@:7@ 6K@(c@7@N) dB`Z@{@k(Ta@R)"!a q'T!EO@"@cҡ$TSA[BkD{ʨ_s@c{@`:@Kk T`@@xx @?1T@ 4BT@?1`T @@4T*@?1 T@w4@T:@?1T@m4TJ@?1T"@c4BTZ@?1`T*@Y@4!T @Q@4BT @?1TG@ R!cCG@J*4RURBWcs@{@K~@TC@fj58G@UBT`:@8!{`: @c:@DE|`@buh%W D*q@T`>@cCq @zATuJ@4a@ T@J4bf@7K?T aB)`@?k!TR9{S!}cw@`?kmT K~}FrTq`TqTG@O@!`?t@@jv"G@O@!`?t@@jv"G@O@!`?t@@jv`"?kT+ G@O@!`?րj6t@jv`G@"O@!*`?րj;t@j{G@v#O@!`?րj6t@jvG@vCO@!W `?րj6t@jvWvc?k!T+@cCya@c+y`@+7K@K`^@ B e@@XqTE!Rab@HqTTdqTTtqTGa!6@<cCIK@Ef3@|@cs=4qTT<qTI` @f`4ccf2Pq@TTqT!DcRc5!@#<t,qT0q Tf@5`B4r=fcRc<_Df3@DG@P+@wIcC@@7!aB@@6aRC@{S ? TT@Te8e6RRf@ @r@ Tr Tۇ@SA{è_` Ta@?Ta@T`@Tb`#T`@AT`Ta @?TaT`@T! T _@TRT`8 6R@9R9!FTtq~z4@1T@F@ _1ATҔ@ @@  {K)?qAzT`@f7d@!7@7@"@BT@B6@B@BT@ 6 @b B@BT@ 6$@ @BT@b 6(@" G@T@ 6G@@A T@ @T@ 6@g @T@ 6@ @T@g 6@' @T@64@@T@ 6 @{@T!a7RT@@9Eӟ@TA@9!E TA@9!E TA@9!E `TBRGhh8!(|@E !LTaBc Cӥ ! ! kDTR{_րDa! 9@^Ga!8@V`,R 8Da!9@H c,{SE[cAc@"d F5`Aa@abBb  45R1Tc@"b_T!_8? k!TaBbK!Qa"5q*Iz`T0q T`@aB` Q` q`T`B@pqT1TzQ?dqT~qRAz,T6qT*q)TqJT@tx@X7c@BR@c@9!xc?q$BzTq@R@z`LTrqTqR@zBTq`R@z@BTQ***R*qhT* vq@>TlTq=Tnq:Tq:TkT~S @+B@?!@xdx` @x`x @y P6a@Qb@q NTtq(T `/dBH8qCz@T?dBD@))Tb BaB !Eb"@cҁT{@ SA[BcCc,_4qT(q*A:!Tx@aKwC54kz By@bB :A@94c@ T#@9?qT?kaT!ZBqT*@4ߺqTzq`T(qTb*B84* a@`@?cBdB@))Ta B`B @Rq)Tq!Tx@sC?qT wC 5`Bq4-TQ`"R|@ccPH9qBz!OT?qT@Q@6a*!z*!Eb#@@uTksqUTTqhTHqBTqHTRR*xQdqITQ$qT~qXz,T* 5w@x@_ 7TaBbB)@)Ta B`B  RKZ*x`qhT<qsTqT~q@TqT@t@vx_6*4qxTxquT(qT`@tC5* a@bjE!cc!KKz*!Eb#@`hT R`5aB?qTd@bBc@xC`@5dK 5 ) )@zTa B`B RkzBc@ctC'6dB`))C5RkD`@tC5k` RRR*qT*q!2T*q!3T*q4T*qa4T*q!4T*q6T:#*q`TZ*q`TK*  ՟&q T2qTrq{T**qq@zT6q@+TzB55`V@b AX@?kTjT?qT@(IkT`Ab!aVR`XXY( a@abBb `65kD@(IkAT`Aa@abBb 5kDkqw***P*qa-T*kD `BqLT|@b@ca tP9cB#c@djEc#`@pCqT@x@sC?q T@4wC5`Bq@4T@Q@7q%Tx@sCqT @@7qk@^@9K?qWT5*`4qTs OKV5q^TkDq@zT`@`A7R|@T@wxRX7q dT*Wa@`@?cBdB@))Ta B`B RkDsEajEanbBRb*kT8R6kTRpq)TaB@*?DqyT?Xq@T1TqJzTkTa@`@?cBdB@eB))Ta B`B `RQ5bB` ) )RkD @ 7 RZk@9q@/TtBzBR)R)kD RqMkTbAQaVCQc74c!!|@cX@kTCQQaVcA64c!!|@cX@kTB Q Q`Vb54|@cbax`?kTbAQaVBQbqT!|@` X@?keT(Ik}T`ARkRs<RRiqR*AzTRb*zY*y5q(T**5Tq 7THq`Tq TkDsE9`@`BqaTRzB*:4 9 ?qAR*AzT!RkRsRR9z9w9tlq RBzTqRBzmT?q͜T@Q 7 @?kTQ!R .9Z9W *k!TxRkD****>*qT*@*Eb@cATd@c@{@ SA[BcCc,uB*4A*!*5kRsR;RozBHqaT*qAR*AzT<RR"*zA*a5q-T*Z*Z5Tq 6THq#Tq!T*8RRqR*Az TR**|@3qR*Az )TRR8R4qTkDsE4b@ R@B@9xbqAzTajEanbBb*k0T#Rb@w@ApCv@!?TqLcT |@ oAp"R| =a-d"0 4,9#@ 6cjE#cB#X ?aj<=? @9?qT-T?qA-T@@9!xb?q /|d,`D @`B))a B`B R3k:RsRRqR@zT7RFa! z5R:RRR9R(1/T R` *Qxr@kTʁ@tx _X6ɗ*-4x|@@xwxt_6*t5^Z@*4B@aEEZEBha8_q T!?KT OEqJ86kDsE*;RoUqR*BzTo@RK*|qAT Qqh@TC*QqiT~q`@T@vx`>X7b*B?l5 @kTE!R^b@B!sTd@c@kDbR4@5a!wv*!Eb#@ҀTR!R ***M*qT*IkD*cRk@T@*=s**qaTa@`@?cBdB@))Ta B`B R!*q'1|T`BkDaB@R))aK55pS*qaT[@s@S@B_ Ta!za!=t*tb @AREbaBb@Bҡ=TkDBR@)!Q_kTa!@t!E*b#@ҠTa!`t!E*b#@8TeRRc`R@9^a*!>@ax@X6*a!>9*}a!?$Rd" tCB4x ) )@zTa B`B  R `BaBRO a /!`:ksj @* `xX6qaT*~qa6T@* `x5_7*Aa!t@k5y@*5`@bB?cB@{ ) )Ta B`B kDR*6t@XTa!`;A5 T 9!@9 7Ga@T5aB@RbBcBkD))aB`RbBcB))kD5kD(#@9qdIzaT!ZKZ **a!;s`BqITQ`L*`@dBa@cnE!pCbBadcjq TVR|@ Ll9?k Tq@Ta!@s*q@TR`BW`@dBa@cnE!pCbBadcjqTqATa!@sR`BBa!@s=wC`BqCA4Tb @RkDb`BaB}**c@`dB))$@OT |4*n~@tx_7*3`BkDaBaB[# R``xCA4xa@`@?cBdB@))`T@KkATa!ra!@cs*qT {SE[t@@'ҟT`Bw2k1Ta`@9!E'@"@cTSA[B{Ũ_aB@?(qT`zE`&@_``@@t`Bu `tjRt@a! !s` @`b@`@`@pCqlT`@``J@ 4`rE ҇4` @a@b&@!K#2+@`@@5` @#@a@` T_8?(qTa@Ta@?|_8_(q&T pC%5`BaJ`?qT`bE`@b+4u @aB@?(qTt@q$Tt@сcW5` @! !)@) 5` @`aT` @aR`aBtvE v4 #@ "4` @i}` @a h68`@4F1T@7р`C` @91T` @fa@ @bbET@" %6 @cc @7!с%##@ `5}{` @`?a&K?qT!D!@ RabE! @9 5`@5`@ `@9` 4`@a@vnEh:aB!a 4`@|nb@a @Bbn!a ~@a@!pC?q Ta@aR`BtbE`@ 5`@@`R`B`@ f` @``41T`@@`7 @ʟ@7Ѡ``@5`@`` @R`aB`R`B@7Ѡ`` @R`aB}`@4xR`BuR@5` @b BR9 Rb @_9 |@R` $ ` @`hD@ 4 a@` @Ta@?|_8_(q Tb BR9 Rb @_9 | pC 5abE`B`š` @`^`6 Da! @D[ W` @1|` @a h48@a@aj7Ѡ`a@?Da!` @5qaB`@!atRtj;` ``B@(qT`@pC5t@`@ol` @@`R4t@R 5?1T{@CTB_8_!kT B!Q {__ a /!: a /!`:  {&@ 1T&`@@1`TTf@@1T)Tf@@1@T IT`gx`@1@T!T.b @CpCRc @{¨ (TTTb@@1T@@h  *Ty`@1@T @{¨_ @{¨{CSx@[5@ckN@sA@@! jT`@{@| 1T=J@uy"`cc@#5`@a@KS@BRC)=X@s@*a@**#R! BBRw`b@BQcc@b@@BQ@[Ca{ASBbsF_`@a@S`e@C) O)b@ R[CBQcDkE`c``@a@Rg@C)*@s@ `@RsbkTcc@5wB)k@T`@wB)@R Z\cc@5`@sa@Rs@e@*C)*a@ Q`M`B)?kTTb@a@B`!QB@_XqT`at w@GK`@aRkT`c@5OH(b@BQwbC2`Y`RM`@aRQ`Ficc@`@t4Q.7`@axa@0qAT`@Rsbk`T`c@5tB)k T`@tB)AR$@`@a@cR`@XC) e@****ۮa@!Q@sas`@RsbkwTcc@w5xB)kuT`@xB)AAR @Y?`@Rbk@Tcc@5`@LRsIs@`b@cc@@Q`<5`@sa@Rs@@f@*C)*ia@!Qcc@a*!aRKd@C)O)@*!aQJd@C)O)*!aQ`Hd@C)O)W$cc@5wB)kT@7`@=b@R*Bb?kwTcc@AQcD5`@a@ w5@`R_kqTwB)ksT`@wB)sKRqb@R*Bb?kpTcc@o5@`R_kmTl`@RbkkTcc@j5`@`Occ@*i5 ORG Ea@@`UM@@?:,CTGc@G@cQcjw@`@ Qa@bqQe@C)s@@ a@ Q``B)k=Ta@b@!`!@?XqAT`K@BQb?Tw@{'N`I7s@a@v~}u~@ hv@CN7`@axa@q`Tcc@8G7c@a@b@@Qcac@XqAT`,K7`@axa@(q Tcc@!7`@a@aB@_q`Tcc@`I7`@axa@8qTcc@  `7`@axa@p qTcc@ G7`@a@aB@_qTcc@`S7`@axa@q Tcc@7a@`@!`!@?,qT@Q7`@axa@,q 'Tcc@V7`@a@aB@_q Tcc@cc@a@!Q@`#5 `R?k?TwB)k5T`@wB)LRq 6 KRe; `@a@P J7C)g@*@*;@***2`@QQ``@RsbkTcc@#C5wB)kAT`@wB)@@`@a@xP?e@*C)*a@!Q@cc@a\`@RsbkTcc@Ô5wB)k`T`@wB)KR  !! R`4`@a@IPe@*C)*zȬa@!Q@cc@a#cc@xc55AAR5`@a@0P@5f@*C)*Ҁ`$v7`@]`@Rsbk/Tcc@.5wB)k`-T`@wB)AR ,eW+`@Rbk*Tcc@)5z@R@TWb@cc@*BQCb'5`@sa@OC@s@`0f@*C)*Pja@!Q@/cc@a3Wcc@wc5LR/`/KR.`.`@a@O-%C)s*g@s@***N7a@!Q,cc@!Qsan4b@[CBQcDkE}`@RsbkTcc@5wB)kT`@wB)aARH `@a@O C)`@e@****Sa@!Qcc@apC@7G@`@ A@}Zj`#h O@@T`@z99K@CK!} C@ :O!}zIV@'cc@Õ5`@a@4O@7a@s@*C)RBB Rf@t R`c1b@cc@BQbAQ!QaH@ 7`@cc@wB)4a@!Q!Q]=6b@ R[CBQ`cb@ R`cBQV!Racs R*`ca `@cc@Q`7`@cc@wB)4`@Q`R!A`@!R*acQ` R*`c R*`c R*`c R*`c8!cc@4a@ R*`c!Q!Qb@BQbBQb&!cc@b@7`@cc@wB)C4`@Q`!`@!R*acQ`@7`@cc@xB)4`@Q`^ A`@cc@Q`V`@!R*acQ`O`@cc@Q`hs@7`@cc@wB)4`@Q`\Z Qzc R*`ca^`@!R*acQ`M R*`cI R*`cma@cc@!Q!Q R!Q*`cb@BQbAQ/ b@cc@AQ( cc@4a@!Q! cc@4fBQbc b@z'7`@cc@wB)s4T R*`c+a@ R*`c!QL b@B@`R_kTKRC `@Rbk Tcc@ 5G `@Rbk Tcc@C 5`@s cc@*# 59ҁR e@ ?@:T`@\{7sL cc@#4a@!Q@*`a4!Q!!@}Bk`"h @8,TPc@G@cQc}b@BQb5LRk4`5b@cc@AQ b@BQbAQcc@b@BQbAQ b@BQba@s@`Q@ R`c(0b@cc@BQbH R`c0b@cc@BQbtc"4b@ R*`ca@!Q cc@a)cc@`@Q`$ R*`ca[7`@cc@wB)cN4`@!R*acQ`cc@`@Q~cc@ 4b@BQcc@5t_B)kT5@7`@*cc@wB)sC4b@b@ R*`cBQ`c@4Q`[CQa@i*|a@Ucc@5y9Fw@ H@?5@`R_k`,Tw@),aR ,NT+a!EbDi:@REiFƠ#8`@Qa`@Rbk Tcc@ 5wB)k@ T`@wB)`v3.cc@c5RyT@`@a@L@BRC)sQs@g@***(BB@R@$'a@!Qcc@sac 4b@[CBQcDkEm!Raca@cc@!Qcc@a@!Q R*`c7`@cc@wB)c4a@ R*`c!Q#t[CBQcDkEDb@BQb!Rac_ 7`@ac@tB)=4`@sQ`zb@BQبa@!Qcc@`@Q` R*`c R*`c%`@!R*acQ Rs`cX R`cBQb R*`cacc@QYcc@Q `@!RsQac`=b@cc@BQ R*`cacc@AQ;9!}ô )C@F`E"BiƠ@("Ra@!Q` cc@"`R)wcc@a4C5aRk!TKR&_U%!RI"Nca@!Q%cc@!QaI\`@cc@Q` R*`ca R*`c7`@cc@wB)Cl4`@Q`,S`@!R*acQ`"!Race Rs`ca R*`ccc@c4b@BQ>cc@wc5RF`@Rbk` Tcc@ 5`@sҨ`cc@*c 5#CBC@ T`@\{99sQ`R@!}Dkadh!@?8,Tb@aRBQbR cc@w#5R` cc@wC5 "cc@w5" cc@w5T "  a!EbDi:@REiF`S!@b@BQcc@`@Q`c;a}̳;@ R`c-`@cc@Q`aR`WRa!EF. !@Di*"! a@s@`/OF.a!E`q R*`cRcc@C4a@!Qp RF.a!EƠb@cc@BQk?T RvR$!a@cc@!Q R*`c@AT@a6_`D{A@! B @{_{ccES[cksd@ @@`AaR;9$@i#@#Q!Q$?y?qT57@Qq-T@B`B@<"K@9G6 Y @9Bk`B@< *3 y9 @9 !'@ @u1`TY@9 3@| ֗_ @yu@Ak VT@!@QyAp@ ?ր@3@`@7 @!@?! T  @a@B~!@C!a_!@?@7!a@@7! @aB!@<"k`8@9!| ֖_ @BAu@@_kT @1T"} ?@TR@9`B@* @tA4M9n5l@`"hB aB  W@!!,E!@Q4@!@ ? A@!@ ?GA@h! G7*?\T @sC!@ ?C@s@Q@U9"!@ ?ּ@9`B@9@<| 9* Gd@?STd*(R@7!@!@ ?""/@y@kT V`@ A @P@"@u!Tw#?qןC`CDtCaC5a@?!T@ @@q Az T@;@7`Uuҹ79@@7!9Q"?1T?K7n!!hD!@`5a`59U"\@!@ ?|@7рK x@9aB!@<@9@9!xb !@!@ ?A@!@ ?0!x`7@x9@9`B@<@9@9"xa ;;@!!D ѿcT@!T@ac6A8hRy_8`B@<_8xa ֡@!@ ?! B C !A " *(!<҅`]6*р1@!@ ?փ@ "BlD Ed@4T R<!R0q|R<8 aB!@<Q,S!|*y qa6T GXy9!@!@ ?7@!@ ?~#@_u Q@7B@A@ ?ր@7р@!@ ? @7 !@!@ ?@3@@@"@ "B4F?T @?9}T?8hR_8y`B@<_8xa рY@y@kapT@ "BD?yT @?9!yT 8@!@ ?O@!@ ?U@!@ ?[@!@ ?b@!@ ?5!@!@ ?֠!@!@ ?֒!D@;!@ ?;@!!>@!@ ?C_`8@yAkTh@!@ ?֑K;@965@9`B@<@9@9xa @y@kT р @ TR8hR_8y`B@<_8xa W;@ F?`T@y#R!R8 R _80q`<! !Q!<*_8y`B@<xa  @@9`B@<@9@9"xa @!@ ?@"р7!@`B!@<"kb8kb8@9xa A@ ?@y@kTb@ D_T 4F_@T<#E_`T!!F ;! @!!G;@ATAT@O6@#0@rT$<@D5#6!4@?qT*`4C; E.?`h`@pC@;@RWA8sa@!@ ?d~a~`R8c@ F?T @ TR8X@!@ ?^!!@!@ ?}@!@ ?db@~@!@ ?ֵ@sC!@ ?C@s@@!@ ?kT@ @qT* @sC!@ ?C@s@ EA; E.@? h`@5?!m~;@K@B@@?B; E.`?@h`@pCJ R8hR_8y`B@<_8xa R8R8R8@!@ ?!ѡ @!@ ?;@g@Z@!@ ?@;-~;@!Rsl@QpO@7@ BD? T#E? T 8hR_8y`B@<_8xa @!@ ?փ? qT@b33@94!DB!@VN@@CB@@?C@@7A@ ?֡@9`B@<9@94#ѵ@9xa ֕Zs!4F@`TR<!R_0qR8! !Q_8!< *_8y`B@<xa @!F_T @? T@@_"T 8@9R 6@7""|@!@ ?!@!@ ?P@@@*K  @7 `q@"!@ ?!aE@!@ ?&a@(@y"!@!(! @C@kHTR<!R_0qB8! !Q_8!< *_8y`B@<xa @y!@kET@!@ ?!G!@ @5@7`@"!@ ?@C@!@ ?q%@7 ѥ@ RKɓK@@5;@}@K?K@R>6@7р@!@ ?@!DB$ @!@W!@!@ ?o@!@ ?!ѡ@!@ ?C@Yf OxD fu@u4@7р@!@ ? @7 !@!@ ?@9`B@<@9@9Bxa !DB !@4 @1@T 2@23^q3@g!@!@ ?@!@ ?ud!,E!@]4;@@!@ ?a@ ?@y@k!T ќ@!@ ?K*@4F!@ ?j@!@ ?J @c7 c!@"!@ ?_u!F"@T@7!@!@ ?w#$@˄RC`CtCaC @9`B@<@9@9xa ց@!@ ?@y@kATR<!R_0q R8! !Q_8!< *_8y`B@<xa @^Ҋ!,E!@ 4!0GB"!@p@@i@b@y@kT@!@ ?F CR?k@yAk!$T ќa #$?q TztB^5"@A@D$ @B -@V`@7``a@!@ ?R^A@%TGc!*?끠T@ @@?qT ^ @1@T }ӔY6R@9`B@@M5@sB@t!-cc@4@&@Q!Q&Z 0! {b@!DS8@7@33@*@9B.QKw#c@CudCݍtCaC*7a@ T"@9`B@<<@99@9xb u( "|84 @y@@ y`B@<xb `B@@<xb ֜_u "q@*7!с@!@ ?֗7a# RCdC |$tCaC@9`B@<@9@9xa w#$Ҁ˄9uC`CRtCaC @ @@ z5@9`B@<@9@9xa < b @@@1@T@A!K `"!@Rw#$@˄uC`CRŒtCaC @9`B@<@9@9xa ~a@ E/@ #T@Af@uD|@b85b @E @;Whd8|@G}` A0CSG@K*Gs4>qhTC@39 RCS@ ;@Rqq@s' 4T@*"e5i @"|84@y@y`B@<xa ;@c@9BtAFM9*#`B@<xa _Fu nsh u @7 !@!@ ?0@7!ѡ@!@ ?v@r!T@"!@ ?d$? q,TD @@@u1@T@#@9`B@<<@99@9xc hD _@~ugn4'@@1@T@7@!@ ?@7@!@ ?ր@7р@!@ ?!@9`B@<"BFxa<@99@9^? @]@!@ ?"хA!Ka@!@ ?@!@ ?@9@9`B@<@9xa !@!@ ?" RGL;t;@;w!"y5A@TG?T !!%; 4=*;@@@@@ ,6c!"5A;E.? h`@`Ai_!T @A@ ?_ @!p@u ?`w#RC`C;tCaC@9`B@<@9@9xa @3@@!hD!@@4F֞@"7@!@ ?9 `5@9`B@<@9@9xa "@9`B@<<@99@9xb *^u!lD ~5!@E?`T @7 !@!@ ?@9`B@<"@9@9xa *qZ E@u?!4T@3T@ @ @@(a?` Ta T a7!JhD@Lu5}ma\@!@ ?=Sc!"?qaTA;E.? h`@!`A!i_T b@;!@ ?;@f$$?qlTg1 7`p@9`B@<"Ѽ@9@9xa ;s`;@@`7р@`7 !с)@!@ ?֕(H!;Qs;@@!@ ?94k@3@`@@@!DB+ @!@5N@rzTy@!@ ?@3@`@w@!DB* @!@N@9@<@9@9xb @ @ _pCu@@)>@cAka>T"@_k>T @B{@L@=@@C#[B6``@7`@[B```[B!D3@/!1@ 7Ѡ`[B{R@S#[?kTB)kT`@v@@q T@*ck*BRn+5b@Rv*Bb?k`)T`b@(5wB)k Ta@!w:B)@ `b@w5`b@w5`b@w 5`b@w@5g!! RӬ4b@`b@BQb5`@k T*`@@Q@a[B`SA{ƨ_b@ab@*BQwb5cCQkDuZ@7`@ab@wB) 5  `B)kTa@!`!@?\qT+` !! R 4`@a@7a@g@*EC)*"Rb@`b@BQb5`@+@kT*cC QkDu!Rҭ+`ARɭ!! R^ 5+@oR+Aab@a5R!! RH5+@ab@w4b@BQbcC@QkDz+`b@+@w4SvB)kT׭7v@ab@+@1έ@7a@`@!`!@?\qT`@a@@ C){aoAg@**>sa@!Q``b@a5+@!! R4`@a@@C)`@r@ g@****ɔ`@a@g@*C)*"R sa@!Q`b@a4+@*b@`b@+@AQa*@4+@ R*`ba*+@}b@ R`bBQbw`b@4b@ Rw`bj`@cCQkD+@a`@!RabQ R`b{S*@[5|@xu@@_k`T @$@_kT @@_k T @@_kT @D@_kT @@kT Հ@RSA[B{è_ր@`@@!xu"@   Rre{!S3}@[@b_hT@ T @SA[B{è_ @v"TBF@H@? }v_ ! A@SA[B{èm {[k @SETcU#*s@Ҁ@ N7K qT`~@P,@!,CskT|h!@RGdk )Tu~@9 qZn7G@P{7F @? T!@ @?T`T @@?`T?T!@ @?`TT @@?T? T!@ @? T`T @@?`T?T!@ @?` TT @@?T? T!@ @?aTN T @@?AT@?!T7@Tq6T7@Zc@g   @@B@!"BT[@_DT@A7c@Cs `1TG;ECVE_TUCZ@f@T`@h@ja;a@.@{@^_;@C@A@zaTk@R(Tc@Z@s Tb@@@!~@"@`@o@@`;o|`@7a@!@"c@ATc@T @!~@aTk@?T @ aT7@҄k@T@sT S=`N=@T[C`/(7@`@a@1@T ?2@$ @7 `]k@_TB@7@B~Bk@[@Ҁ@$T["7[@ T7@ qT2@%O@@S@@G@=@|!Ej<Nj<H@BH@@BTSAcCkDsE{ը_{bjG@{#E P @ ? T!@ @? T T @@?T? T!@ @?T@T @@?`T?T!@ @?TT @@?T?T!@ @?T@T @@?`T?T!@ @?TT @@_T?T @9@@T? T @9@?AT @G@ҟv P @T @!Tr @RA9g W@@gh A??WQ`oB`5N6b@@`B1@TbwC ?a @a7!a c@!\c@@B;M^;@ @ 6 @7 `\k@`TZRa_7a@!1@Ta`C@T@!Tv@vB7@k@@C(7@@j@{7@@ @7j5K@j@7r{Z`7{@b@cC!26B @0{@!O\U@@@4^\4LcR҄ "@?TB@c@8(j@i{6?@B~c@{66_뀽TB@CCB @Z@C@@C!@/c\@`?Z@4s {9c`Bz ҭT@o@Ac?T@B@55K9  {S@[V;c"@B@@ T` @s@6E.@?j`A@!`;@ւ/@Tc@bBc\@`?s@TR@@Tc@6B)@`B CT c@c\@`?a@@~`T`Bc@ CT@a@b@~cw@T@cC[BSA{Ĩ_QlqTB BBH`8`"@R_?qRR_?q`RR_?qT?qRR_?qRR_?q T?q`RR_?qRR_?q@RR_?qRR_?q T?qT?q RR_?qT?q@RR_?q RR_?q@RR_?q`T?qRR_?q`RR_`R_R_֠R_֠R_*_րR_{R@S*s!k@T`@5[tVB)kTa@!t6B)bb@t§5`@k T`@t!@?d q'Tt5`@k@T`@t!@?l q`$TtB5`@k T`@t!@?h qTt5! R5 5`b@t59[Bb@BQsEbSA{Ǩ_Z a@[BsE"QbSA{Ǩ_bb@t5`@k!T`@t@q Tt5`@k@#T`@t@$q Ttb5`@k T`@t@dq`#Tt"5`@*k"T`@aB@_qNTa@tl7`@a@aB@_d qTbb@{7`@a@aB@_h qTbb@| {7`@a@aB@_l qTbb@*aof@*C)*F5 ma@"Q@[B R`b`@Rtbk`Tbb@`5cw@ޔa@cC!Qa~bb@w`@B|5aRkxTRky@`@`@RbkyTbb@5z@ɋbb@z5Dp`@RQ`ק=a@!QcC!QkDaL`@RtbkTbb@5cw@$`bb@w`@ƒ5aRk`TwB)kk@T`@wB)!R`gMDf:`fARe`@a@ff@C)**c`@QQcC*kD`*a`f@*C)*Eғ^*a@f@*C)*F҂M`{7`@axa@qTbb@y7`@axa@dq`Tbb@^7`@axa@$qTbb@L7a@a@Rt*!a_k@JTbb@I5c ky@`R*?kGT`@k ?T`@xB)!R&`@Rbk`ETbb@D5`@kЯ`bb@k@``@Q`B5AR `@a@O;C)`@ )1=`@p<f@*M)* la@!Q@Bbb@4Rbb@4bb@xB5!R`@Rbk@Tbb@?5x@bb@x?5oaR˦bb@x=5eaR a@bb@!Qa!Qy"$5 `R?k <TwB)k<T`@wB)!R`AR`@a@`e@*C)*.a@cC!QkDa R`@Rbk9Tbb@":5z@ bRR`95bb@z857aRp@7Rl6?$@6EBi@Ơ:7`@QQ`ARU*bb@a@! R4!EBiƀ;!@Ci`@QR;$EBi@Ơ:`kc@cQ`$bb@*cia@bb@!Qy5 `R?k`@TxB)k=T`@xB)k!R`#9`AR`@a@F@(C)*@g@k@~`ka@!Q`=bb@)bb@a@`@y35kD!Qwa5 a@bb@cC!Qam!a f@*C)*F~@aR)xbb@5!Qy5 `R?kTwB)k T`@wB)!R@ WB 8@ AR `@a@` f@C)**`kka@!Qbb@cC!QkDa8b5 `R?kT!R aRY# 8AR{@!EBi!@`{R!E@S[cs$@w*c?k|T`@|5xB)k`QTb@}@x@@q@T @@@?qT @`@kzTac@@hvc@B))ay5k``Rk@uTFy@H@?`u`c@c@ [5 R`k@XTb@X5@k"T@k"T*@Ò@;`a@?q#Tb@cQ\5`k@!T@k!T@|`@ q` T@3@!Q!QyaTac@AT5`@mTuѵ}ӿf(mTblRp0 @ mT!R "@}!j`Ch |@!,TF@V@@?c@`@aQaa@qlT%b@_qBQ@BzTf@C)P) g`@aa@ĐRkDb@c@cQ!hv"@ c@@cQ@a!Ecw@"@ҁGT[BSAcCsE{Ϩ_z@@@T@]6CTTA@9Ga@:T?qR$@z5TRs|G/G@{@@@H\Tfh`8?kWT_ Tf@9?kT5 RG.G@5s@:5RY4@@r W7@6@@9q`KT`C<@=W L=R` =Ò@`cQ|7@Ò4T@Ò@z3sf@9?kaT| B_8?kTрkb8?k@T3@=R9Vр,SQq`T%b@_qBQ@BzT Qq@T@|@%x`@_qBQ@BzhT 6Hb@S5B)?kT T7@~b@5B)kTY7@aRk@>Tb@=5@sN;b@Ò@!<5KS:``RkBT`b@ 5x@``b@x 5R@ >.Y=`@q`:7f@B)C)y@<`@Q`_TZA}or@3`@c@{4sc@K@cQS@@@@@Òs@;K ;@K@@ 0|@_$TA@}ӄh`#h P’@RBQ’;k6ҤATxaC@Lq%T!@;ZC ;@ҟMTE{a@_Lq"T!ex"3`@;`@GG@$!@=K,@G;@ K@"=O ;@SEg)o!`=KOgMTCxz@PqT@p@K@9-4S@5- 4r.G@ R-RX@7@D)E)x@O@@?aT@ w{ Z;@@OKg@o@@gX)1Tk@@@aB) @͠Ò@@cQCs?q@R$@zT3@=ARUaea@!Q R`cџ/7x@b@}@hv@|s@5h3@BRR( QqT!T .TTA@9&RRRB*5$Rs7!}[q`,Ts)87! @95s@@4<A@9$Rҡ`s@J6@3@7р`tQk@Ukb+b@@4Q3@ycNc@cQxcҒ@f @Ҩ@E@_Tybx"BB@B@B!!9OKg@@gX)Ò@cQd b@4cQ3@@OKg@@gX)7 #QÒ@OKg@@gX)Ò@K@@S@@N Rbb@Ò@cQÒÒ@cQÒz ! `C<@=@3@K@ @S@@@@7 `GjdÒ@G@cQ Rb;K@S@@@@ P@ Ib@Ò@=;f|o3@=aRc@kDcQcD @`@! 3@ƴ@3@7р PG3@@!> `c@4c@5.N R`c)c@-dc@ RkDcQ`cac@4c@cQv7b@)Ò@cQ<kDcQҾ RÒ@*bO;G ;@G@_@B@;B}d,;@c R*bc@ R`ccQ!E3@!@ƀ>BiCiodA@93@M R`cc@cQ@3@ R!Q`c&  {S@[@H7v@/T@T@p7`@SA[B{èQ@!_6`@! RSA[B{è_? 5`@SA[B{è ?TV@@5 ?5`@@!/!T`@`?4@"T@bp7R_{!@ !`_`6` @R{¨_B ?TT@`O7 ?5@"T@bp7R_{!@ !`_`6` @R{¨_B ?TT@`O7 ?5  {[@Sc*@9@ 4`@&@9 T!/Tւ s T`|Ӵj`t@T@w6@_6sAT RSA[BcC{Ũ_ `|j`s?`5TsT?!TV@5&@9  Tks/6@4 T@T@!p7@Z@@T@p6@a@_`6@b9TkD?ր5@?59b@T@tT@T@p7@@@T@!p7@b9AT@T@p7@@@T@aw6@ @_6@?5@?`4kD@ @_6@@_ 6@р@_6@р?@5@`?4mT!/`T `@xt` 5!TT`@xt`?5TJ ?A TV@5 ?TV@5 ?AT@W@5 ?T@W@5s@_6@рz[ ?!T@W@5S ?TV@`5@ ?5< ?5C ?5N ?֠5Z ?5Q ?֠5[ ?5{ @3/?AT`@T@p7 @R{¨_@`_ 6` @R{¨_ @{¨ ?T`V@O7 ? 5 @`R_{S[/c@#bTsT6{sV@T@Aw6@_6sTRSA[BcC#@{Ũ_aTy} @?@5a T@?@5a Tjy?@5aT_?@5sT_@?@5sbTxs ?TV@O7 ? 5 {SE[aV@@AH6v@/ T@T@p7`@@v@/! T@T@p7w@@T@ap7v@@T@p7`AR!E@"@ca TSA[B@{Ѩ_@ _6`A!!E@"@c T@SA[B{Ѩ@_`6v@6@_@6@_6w@?@4?֠5`@?5`@`?`5`A ?ATV@5 ?TV@5 ?ATV@5 ?TV@5#' ?@5 ?ր5 ? 5k ?ր5rv@V?4xw@W/T?4mv@/ T?֠4bb@!@?(E  2c dRҟ {R@S*!k T`@B 5tB)k`T`@t@?qTt 5`@kT`@t@?$q`Tt5`@kT`@t@?\q Ta@t!QaSA{¨_*a@Bb!QaSA{¨_7`@b@b@?qTbb@7`@b@b@?$qTbb@7`@b@b@?\q!T bb@"4a@!Q R`ba@!Q R*`b R*`b{[UB4Bc/#S҅| ThedUAT,T@ dUAT_LT@dUTKT@@dUT TRSA[BcC#@{Ũ_?Tb@DT@$w6B@Bb_b6Bb@ ? 5BT _T`V@ 5@@?@`5RR{R@S*!k`T`@5[uRB)ck@Ta@!u7B)%`b@u5`a@u[B!QcCaSA{Ǩ_7`@ab@tB)5`vB)k T`@v@0q`Ta@v`@RbkT`b@5kz@sF |b@ 5 7i7@Tz@v{99a@z @?<T@!}Ӝbkah!6Ib@RBQbY`b@ 5`@a@ C)2 f@****AR!kDsEa@ 7`@axa@0qT7!}3k@b@ R[BBQcC`bb{`b@4a@"QH R`ba@kD!QsEuada@u!Qa_^a@"QkDsEX!Rab[B RcCkDsE`bb@[BBQcCkDsEkDsEua@Ab@[BBQcC_ R`bS  {[@S&/?T@T@p7w @@T@ p7v@V@T@p7w6@@T@ p7`@` `"@v*@6!/T@T@ p7w@@T@p7`.@@`&@@`:@`>@s@/AT`@T@p7RSA[B@{Ĩ_@!`_6aSAR[B@{Ĩ_@_A6`.@!?֠4@!_6w6@@T@w6@ _!6`@!?ր4@A _@6w@@! _@6v@w6@/T?4@_@6w @z?ր5` @?5`@@?@5`6@? 4@SA[B{Ĩ?5`@? 4 ? TV@5V ?! TV@5? ?TV@@5< ?!TV@ 5K ?TV@@51 ?!TV@5@ ?T`V@@5I?`4F?֠4B?4>? 4: ?55 ?5  ?5 ? 5 ?5 ?֠5 ? 5v@6?4w@w/T?`4 @W/?T?ր4 @/?T {R@S*[!kT`@5tB)k T`@~}t @@@_tqT @`@kTbb@c7B)5 @*@q Tt"5o@t`@ҭb@RcCc@a@!QBhvC@ @[BaSA{Ũ_@a@@[B!QbaSA{Ũ_c7t@`@~}hv @ 7a@cbb@ hvB) 5` B)k T!`!@?@qT**`@tRbk@Tbb@5RR"4#t@`@Qa@bVC)BRHf@****ARw`#@\a@ RcC!Q#@`b!Rab#@`@bb@Q*`xcC Q#@`@Qbb@b4a@!Qa@cC!Qza@cC!Qva@ R`b!Qp 7a@`@!` R*`bMbb@K qT``@_qBQ@BzIT_"Q?qT`b@_qBQ@BzT" Q?qTB|@`xb@?q!Q BzTB"6__  {ES[c**k*s*@oҁ4@ T @@?Lq T<?Pq! T@!|FB@_@TR<b@C@LqTPq!(TD@#RB|F@ -Tc@b@_Lq`#T_PqA%Td@B|F#R@ TzBbC{bd@Lq@"TPqA#Te@$Rc|F@BTR'*'4**""5RjT!Eo@"@cTSA[BcCkDsE{Ψ_@A<@T*@@sB_jTczba@?Lq Tc@D@f@e@?Txax!!#@ҁREECR?JTxab@U4_PqTc@f@aTc@D5_Pq!@bE ; TA#@`@Pq`TT! @!@?PqT4a@;@"@_aT!@A Jz!a@@C7O[GG@K@xs@Pq T@7@GHGG@5sT7@sG?7@7@GG@@7@O@7b D)E)n` 7@`4@****L4_PqT @F!RRRA@A!@ T*5R3;U4-S@A;@7@;A{ss7@!@?;@TS@<7@*S@***Wna@A!@!R!Ra@!@!Rm!!R!RS@%H!Ec R!@^7@!@ 7рRGBC{! B {R@S*[!k`\T`@\5s|B)k`.Ta@} |@@@_xq T @@_xq T @`@kRTcb@c htB)Y5G `b@|X5@ab@|`@O5aRkTw@k T*a@~@!x{6B)cb@w(5`@k $T`@x{@qTw'5`@k@$T`@x{@qTwC&5`@kT`@a@x{@$q@T!Q|a`@@asEa@!Q[BaSA{Ȩ_A`b@"5wB)kATÔ O7`@~@ab@wB)!5fBRb@`@BQb`a@ÓRb@!ht"@ a@[B!QcCsEaSA{Ȩ_RNk=?!Rޒ?4`@a@=!@*g@*C)BR kD`@v@!R*kA@AR!@!R@?4`@a@^8g@*C)*BR Y`=kDc-*` cb@Q*a@`R"b?k<Tcb@C;5ky@W7cb@y#05Pa@y$ 7`@w@a@w@$qT"wRb?k`5Tab@`@45aa@kRk,T-cb@a@!Qak@`!Qa#5AR`@a@f@C)**AR`@Q`pR BR`eYa@!Q R`bՓ7a@`@!`!@?qTcb@ʓ`7a@`@!`!@?q`Tcb@@/7|@a@} ht@ R`ba@`@Rbk`"Tcb@!5`@s@cb@ 5:?G?@ s@` bb@B 5a@;{;@{@@|@"TA@}Bk`$h `@Rbk Tcb@c5`@sҠ@cb@k*5:R&a@s@`` @9TBc@cQcJ,a@!Qa R cb@kDa@4J_ T`@{#csB`@cb@Q`R `@ qa@cb@!Qa5R``@a@)f@@C)**AR`@kDQ`kDcb@0Bb@RBQbȒcb@57@+`Xa@"QkD R*`bbkDcb@ZA}ӱdG@_T`@b{8swA@}9bk`"h |Z;A}ӗd;@a@kD!Qa R`bna@cb@!Qaa@!Qa;FQB R`b]a@kD!Qcb@aFB R`bR`@cb@Q``@kDQ`kDcb@#4a@!Qa`@Q`la@cC!QkDsEkDycCQsEҺ`7a@ccb@f Xa@!QkDa@kD!QkD R`ba@ RsE!Q`bQ`a@TkDVa@ RcC!QkDsE`b`@Q`scb@ã4a@!Qa@cC!QsEya@ R`b!Qj R`bm@CT@cp7R_{B@ b`_7 @R{è_b_7 @!T~`E~dBѣ@b@@`_"@@`Da$`_@~`c _TT@ O7@?@5{S4@[*bqT =@7@==@=SA[B{Ũ_TZq!TSA@[B#D)%E) @{Ũk^q@TVqTSA@[B#D)%E) @{ŨrD!3@=@fqTjqT!@@*[BbD)dE)SA{ŨO!@@*[BbD)dE)SA{Ũ!@@*[BbD)dE)SA{Ũ?  {[@c7FT_` @SbMTzst@T@p7s!T__@B~SA!@@!_@?[BcC{Ĩ_@TSA[BcC{Ĩ_֠ ?ATV@4@_@SA ? {[S*4*c**#*NRSA`)X)cC#@[B{Ũ_D!@SAcC#@D!@SAD!`@SA {R@S*!k T`@` 5[tVB)kT`@*t6B)d@qT`@t 5a@ cdj#`cCR``@a@ f@*C)*ڝ@cCa@[B!QaSA{Ĩ_ې7`@bb@u6B)5dB)kTА7`@d@SVa@"QcC[BcCb@BQb4`b@4a@"Q`b@5a@tb@[BBQb@ R[BBQ`b[B RcC`b R`b{R@S*[!k T`@ 5uRB)ck`Ta@!u7B)2 `B)kTa@!`!@?q@T`@cCQu`SA[B{Ĩ_o 7`@ab@tB)a 5@b 7a@`@!`!@?qT```@a@R`BRC)Ef@****(BRa@cC Q`b@4a@ QҹUa@ Q"cC!Rab!Rab`@cCQu`@!RcCQab`@cCQ R`b  {R@S*[!k` T`@ 5t@``b@t 5`b@t@5`@kT`@t@q@Ta@t"Q[BbSA{è_BRa@*` Ra@ȏ`7a@`@!`!@?q!Ta@EUa@"Q R`b-`b@4a@"Qb@BQ Ra@t`bR{C@[*s!k1T`@15kzB)S_k@T`@S}z @@ @?<q T @@@?<qT @`@k@Tbc@`@*a@hsB)55c `B)kTa@!`!@? q@T`c@z5 `@c`a@㉀Rb@!hs"@ SBcDkEa@!Q{A[CasF_@a@@{A!QSB[CkEbasF_`@5B)@4a@ `R?kT|@!pR`5bc@|"5B APRݎc9!0 Rm(5cD|bc@B5KRʎ bc@b%4a@!Q`@*za@45 `R?kTRR5a@bc@!Q*zat`c@z5 @z7a@`@!`!@? qT`@PR)@`@a@@g@*ŚC)* @FTa@ RSB!QcDkE`ca`7z@`@S}hs@ % 6a@ RSB!QkE`cL Rz`ca@SB!QcDkEBa@SB!QkE<`@a@cc@hsB)4a@4SB!QkE/bc@"4rc`[R)Rb)kTbc@5xB)kT`@xB))? APR w PR  `@a@Qg@ ?@C)N)~`@Q`v W5`@a@Q `@`5Sa@!QcDbc@+cDbc@bc@4a@!Q8cV 4E@Ơ@DiEiE `@Q`bc@4a@!Qҷbc@cDbc@x5bc@xB 4`@cDQ`[)7`@bc@xB))4`@!RcDQ*ac`[)YqaRcR R5cDbc@!EDi!@Ei!EŽBi!@ƀCi cD R*`c=Sa@!QcDbc@cD R*`cT`@cDQbc@`[)t!EDi!@ $Ei@[`@Sa@!QcDa[)bc@^cD R*`ca[)X{R@S*Bk1T`@15[tVB)ck Ta@!t5B) b@R*Bb?k)Tcb@C*5kx@ZFs@H@?`&cb@b@5@`R_k@(T`B)?k Ta@!`!@?0q T`@xQ`@G@BW@@?cb@b@kDBQsEtb5 aB)?k T`@aB@_0q T`b@t5b@`t[BBQcCbSA{Ǩ_7`@ab@uB)!5 cb@t4[BcCa@!Qa7a@`@!`!@?0qT`a@"Rx@a?k@T`b@`5`B)k Ta@!`!@?0q T`@;xQ`xb@5a@ `@8mT @!}kah!ό`7`@a@aB@_0qT!a C)`@jf@****!RLb@CT`b@a@{!Q65 `?k$T`@k`%T*a@!`!@?xqGT`b@a@{!Q@45 `?k@T`@kT*a@!`!@?Tq7T`b@a@{!Q25 `?k#T`@k`$T*a@!`!@? q:T`b@a@{!Q/5 `?k@T`@kT*a@!`!@?, q@0T`b@a@{!Q-5 `?kT`@k T*a@!`!@? qT`b@a@{!Q@+5 `?kT`@kT`@{@ q*Ta@!Q{@`7@a`A G@"W@@?b@kDBQ`b@b$b@ @BQ4@[BsE`bSA{Ȩ_cT`b@`5xB)kaTֆF7`@ab@xB)5^ `b@x5Vb@`@BQb`a@#Rb@!hu"@ b@[BBQcCsEbSA{Ȩ_`@Q|a T7|@`@}hu@!`b@R\5`B)?kTR`N7`@`b@RY5`B)?kTRK7`@{R`M7`@a@a@@pq &T`b@`b@R`95`B)?kTgR N7`@>`b@RU5`B)?kTYR`H7`@`b@RU5`B)?kTKR@D7`@`b@M5{B)kT>D7{@9`b@R@B5`B)kT1RD7`@`b@RM5`B)?kAT#RB7`@ `b@R@I5`B)?kTRC7`@`HRŅRR`@RsR%`@Q7@`;@T`@{7@b@C{ 7<=7a@c`b@"huWB)@&5` B)k&T!`!@? q/T**|@0`@a@ f@*C)*@R@-`@@`QR`@!RsR@?Ka@!Q``b@{4!Q{{;`@Rss@`@RQ`,R `@!RcsRKa@!Q .`b@{ 4!Q`R`@RMsRKa@!Q`9`b@{4!Qy`R`@aR7sR Ja@!Q 7`b@{4!Qc`aQRRR`@ARsRJa@!Q@4`b@{4!QHcf@!@@a)(7!FR*5a@!QaR%`@ARrRJa@!Q )`b@!}V?@R"`R`@RrRJa@!Q -`b@{4!Q`R@`@RrR}Ja@!Q`b@{@4!Q{b@5a@7@,@ t4 R`b`b@b@kDBQbbJa@!Q R!Q`bZJa@!Q`b@{`4!Q"R*bb"R*bb"R*bb3`b@4b@BQbb@[BBQcCsE6b@ R|`b[BBQcCsEa@!Q`@!RabQ!@}{Bk`"h 7@`@?; T4d@`@Qa@ba@C)k:@tC_T#@cx`c@#x `b@Ra@@4!Qs`b@4b@BQ҂a@`@!``b@I`b@ R[BBQcCsE`br`b@*skDQ R`ba@:@@"_-T$@xa@x!! R`bg@k@***v`@kDQ`eIa@!Q`kD R`ba@!Q R`b"R*bb R`bx R`b R`b R`b!R*ab R`bkD R`b^`b@a@!Qwb@ R[BBQsE`b R`b R`b!4!ERc!@RlIa@!Q`b@!QU"R*bbQ"R!Q*bbLa@!Q!Qa@!QC`b@Ra@5"b?k!T9`b@R4a@!Q!Q2a@!Qa@!QTa@!Qa@!Q"R*bb4"R*bbF"R*bb]a@!Q)"R*bb {cES[cks`@7 @1T Z;ՠE. ?֡@[k`!1T>@ @1TWB@@1 T@ @T@6 @T8 @@T@7!F @1AT@T@@6sFEa:|?TbB|_T a?73@|@1@T@T@6sFEas?ATbs_Ta'73@@!XET @V  @1G T  E. ?bB@k`a_@!@Fh@e@tZy^!u|c?b\95E7@@BA T[BSAcCkDsE{Ǩ_։6`4 @F@1T@1!T@ @T@@7`! R"FZ;ա@E.@?!1[k`aT>@ @1T Z `FT|3@<@Ҁ@7р@7Ѡ @7 `@7 @75 5`WFT'H` @a@+X`СۀR @RD`СۀR4}4z4w4t4  {R@S#[?kTB)kT`@u@@q@T@c*kR+*ŒR a@5*!uakT`b@5wB)k@Ta@!w:B) `B)k@Ta@!`!@?HqT`b@w 5a@bb@!Qa 5b@kT[B!QkD+@xcCaSA{ƨ_a@@!Q@`[BaSA{ƨ_@7a@`@!`!@?HqT``@a@g@*C)*ARї a@bb@!Qa5b@_kT *a@`b@"Qwb*5kDAQ+@xcCQuB)kTՁ`7u@pa@ R`b!QSGb@BQ@`b@b4*cC!QkD+@a@`b@"Qb*4 R*`bb`7`@ab@wB)A58`ja@ R`b!QacC!QkD+@`b@ 4a@ Rw`ba@!Qa@!T@a6@_{! R`"{_  {@BT@"6@?jT  @{_`Ё R"sE!@t {R@S#[s?kTB)*kTcw}`@{@`@?q T @"@_q T! @*kR@?q@ T @`@4b@䌀Rc@a@Bhw#D@ @vc?kT`b@5uB)kTa@!u 4LR@?` DaЂ @!@ @ړ"@|N"@R{R@S#[?kTB)kT`@u@@q T@c*kR+*BRDa@5*!uak T`b@5vB)k`Ta@!v:B) `b@v5 `b@v5tbb@a@!Qa"5b@kT*a@@!Q@`[BaSA{ƨ_R}@7`@ab@vB)5@ `B)k@Ta@!`!@?8q!T`D``@a@6`g@*C)*!R a@bb@!Qab 5b@_klT[B!QkD+@xcCaSA{ƨ_`B)k@Ta@!`!@?<qAT``@a@g@*C)*ARے`Bb@BQ`b@b5kDAQ+@xcC*!Qva5kDQ+@xcC\uB)kT|7u@@| 7a@`@!`!@?<qT|7a@`@!`!@?8qTa@ R`b!Qja@`b@"Qb*4cC!QkD+@^ R*`bb*a@ R`b!Qa Rv`ba@!Qa`b@4a@cC!QkD+@?{$@[c@ST@ 6V@ 7@` %G` @@1 T@Gc@c1T`@@c@6[BSAcC{Ĩ_փ@`@@7 cуC@!@ ??a@7!a @X@F?ց@A7!с:.Fa@@5@1 T5@`B;ՀE. ?@Bh` A@`AY16Ҭ RG@@!'.Da @!@ @@@_{R@S#[?k@TB)k`T`@u@@qT@c*k*bR`+5a@Ru*!a_k)T`b@)5vB)k&Ta@!v9B) `B)k Ta@!`!@?@qT`b@v`#5 `B)kTa@!`!@?DqT`b@v!5 `B)kTa@!`!@?qT`b@v5 `B)kTa@!`!@?`qT`b@v5 `B)kTa@!`!@?qT`b@v5bb@a@ !QaB5b@kTkD QxcC`@@Q@a[B`SA{Ũ_`{7a@`@!`!@?qAT``@a@Pg@*C)*R#B@Ra@bb@!Qa5b@_kT *WuB)kT.{7u@B*!Qvab5kDQxcC{7a@`@!`!@?`qAT``@a@g@*C)*R@b@BQ`b@b5kD@QxcCz 7a@`@!`!@?@qT``@a@ g@*C)*aRz7a@`@!`!@?qT`k`@a@ g@*C)*R z`7a@`@!`!@?DqAT`N`@a@g@*C)*R Rv`ba@!QacC QkD0z`7`@ab@vB)!5a@ R`b!Qa`b@`4a@`@cCQkDa@`b@"Qb*4`@!RabQ R*`bb*{R@S*[!k)T`@D)5tB)kT`@~}t @ @_q T @`@kTdb@c8B)%5 @*8qTt$5`@kT`@hv@<qTt#5`@kT`@hv@|q T#ta@'5 `R?k@T`@*kTa@!w8B)v `B)kTa@!`!@?q T`b@w 5g b@`@BQb#@`a@Rb@!hv"@ cCa@!Q[BaSA{Ũ_@a@@[B!QbaSA{Ũ_c*`w `@a@f@*C)* R``@*`]@`@a@f@*C)*Rǒ8?`@ R`b a@`@!Q#@tay@7t@`@~}hv @@Ny`7a@`@!`!@?<q@Tdb@Xy7a@`@!`!@?|qTdb@#W~y@7a@`@!`!@?q!T```@a@n`@a%C)**R?` a@`@!Q#@aYy 7a@cdb@ hvB)5` B)k`T!`!@?8q T**t`@a@@ f@*C)*`RK`db@*`b@5wB)kT(y7`@ab@wB)A5}y 6 Rt`ba@cC!Q db@$4a@!Qa@"R`@!Qbb`a@ R`b!Q >a@!Q`@Ta@!QQ`@"RbbMa@ Rt`bcC!Q#@a@ RcC!Q`ba@`@!`db@{S$@"A9Q5a&@@7!!`v@a&@`!a&TtzSA{¨_փ^R8c6a&`&@`&@!@ ?@ @B t@t~{R@S*[!kT`@5tB)k@T`@~}t @ @_q`T @`@kTcb@c7B)5 @*q Tt5`@ub@čRcCc@a@!QBhvC@ @[BaSA{Ĩ_@a@@[B!QbaSA{Ĩ_ctPx 7t@`@~}hv @Fx@ 7a@ccb@ hvB)#5` B)kT!`!@?qT**t`@a@-e@*C)*-bBRc=`a@ RcC!Q`bcb@c4a@!QҦcb@*x7a@`@!` Rt`ba@cC!Qcb@{a@cC!Qa@ R`b!Q {S@B@_qTR3$@@#a7cskT@@7!!@@7! @@7!SA{è_@s!@ ?ւB@_k T@!@ ?@!@ ?`@ T7``a@!@ ?ւB@_qTSA{è)@B @B$B}1@T u@R@u9`@@?T@`@. @1@T a `_`}`@7``@@SA{èi){R@S#[?k$TB)k%T`@u@@q T@c*kR'm*⍀Ra@`-5*!uak@-T`b@,5vB)k*Ta@!v(@A  ^& `B)kTa@!`!@?\q@T`b@v'5`b@v'5ab@v!&5 `b@v@%5bb@a@!Qa5b@kjT*a@@!Q@`[BaSA{Ǩ_`B)k`Ta@!`!@?qT+` ab@A5` B)kTb@|@Dxc@ qT+@`@a@ @`@+[ @T 'g@$&***]G@ F`@@!_!1a T@҂ba 6@`@A_!1a T@Ҕt7!!SAR{¨_!%@&7!%@:A7!%!%@7!%@.!7!|%@"A7!t%r%p%@>a7!Ff%`@@!_!1T@A]%!X%AҔ@t6@A! _T{ >+``V@ p6D;ՀE.@?"_#@рh`B@@h@@B$? @{¨_ {[*#@ck@`T@6$@S1@W@T$7@@ =@@@c1 T@w @ Y @W@@ 7@@_TT @?q@@T@7рSA[BcCkD{Ũ_@? @zT`@`7`a@!@ ?6B;ՀE. ?A@Bh` A@ `AY@'(6B @? a}`TY@9 @1@T :@1T @7  $@җ^7v5GB@A@! Ҧˊ @7  865ҋ@"E@?TYtG@ڊ4uc$SAw_$D;ՀE. ?aAh`@2G@`5nDAb @!@ @^WG@4ҺH@?@ҰS  {S%@@?T@ @7SA{¨%5`6#@`a !?7@@1@TSA{¨_{@@7C@D@ Pq)TDa!@ae PHd8d% hc@!1!T{_ւBFA@!1 T{ hc4 hc$@aЀG!`C@@ @{ h9 hc`{&*{ hc{ hcY/!hc8E?q!F{ hx9 hc{"J/{ hc4BF@@1@T@F{ hcK7{ hc'{ hci9{ hcxr4 hc8R!F#Da!@dҢ{ hc8R9{!& RR {Sa@!@aT@@AH6A@"T@6 @SA{è&SA{è&#@Cd@ Te @T`Te@@TTe@T Tc`efxeTaT@6@1@TSA{è_c@cT@D@C@cT@dB# @a!`:c|E`T{E;ՄESE. ?ֆ@?h`C @T&@Q&q T` @@# @(7!P@`@TA@!T@A 6ORs`` =D@1T&@!&!E?@"@cTSA@{Ȩ_֠P@@T`?؇ a!D@!@bB@I `@7``"A!%o4 !@B-`@|Ҿ@ 4Ҹ  {dEcx@#y@@_,`@?S@[;@ 7<};@ ;T@ )K-TC&}x7 @z&?T ?}@#z!$}T#@  T@!  ?JT  c@z!!?AT `@T@A X7 @ҿS T`E_@@Bҡ%TSA[BcC#@{̨_ֆ qT<};@$T<};@ ;T@ ;@ ;@ LT!MTC?@d T4@qM T<};@dT<};@ ;T @ C&Kxa4K`@CT@!_6@dj`Ҁ?I`TS ?#}qT(@ T$ 7@j$? T<}QKd@8fT'4`qT<};@;@T D6 _qM T<};@<B};@D ;@@@w<C}qTi@ %@JT @7@ j ?JT<} g@ ;B@ ;B@bP ; @bDcqMT<}@ $T7@z&?ATd*7#?qT<}@z&T*e@'d@8C<a!E_@"@cATcC#@{̨b}79E7@ AC&S[CҚ  {B)S[?kT@a@qT/n 7`@a@a@qT ՠ@!@aAT@a6 T RNaj@?q T 4`@@@ 7@6B<`@==R=SA[B{Ĩ_р  @94?|q`TA891>`DaB @! @ R`bA;ՀE.@?"R h`0@bb!`D!@@aT%a!E!@f @`7рm Ҭa!E R[B`b!@SAc{ĨcR\@7р`V {R@S*!k@ T`@ 5[tVB)k` T`@*t6B)d@` q`T`@[BQt`SA{Ũ_քcdab@5aRm}`@a@@# @wf@****a@[B QcC#@ƈ` R`b`@[BQcCcCo`b@4a@ QҼm@7`@bb@u6B)5dB)kTm`7`@d@h3a@ Q[B!RcC#@ab`@!R[BQab`@[BQ R`b  {C;SE.?th`e @@6@(7g@6!!PaTR0SA{¨G?C7d?SA{¨yd@a!D@b!@BSA{¨_ {R@S*!kT`@5tB)kT`@t@?| q`Tt5`@kT`@t@? q Ta@t!QaSA{¨_*"a@b!QRm7`@a@a@_| q`Tbb@Gm7`@a@a@_ qTa@!Qbb@4a@!Q R*`b R`b{R@SA[_k@T`@5c t@k`R?kTwFH@?*`b@b@AQ5Rs;*BbkT`b@5uB)kTa@!u!@?qTu5`B)k` Ta@!`!@?( q T`@u`5`@yQ`F@V@@?a@sE!QtcC!QkD[BaSA{ƨ_*`AQRl aQRl w`d@#R>ybBR@82b@BQ@ybyb@Y5a@ @9lT.a@sE!Ql 7a@`@!`!@?( qaT`vaQRAl nwd@Rx`@Q`Ty@b@z8g@}9j`"h fl7a@`@!`!@?qT`b@e{a}>`!R*abZ`b@5b@BQ`b@a@4!Qh`b@5wFy@H@? R`bҷa@!QtQ R`bȷa@sE!Q`b@ 4b@ R`b. R`bm{R@S*[!kT`@5vB)kT`@~}v@@?Pq T @`b@ 5Rk`b@@5R R}4`@b@Rc@a@!QBhtC@ @[BaSA{Ǩ_@@aa@!Q`@v5k`7v@`@~}ht@@`b@a@5 `R?k`Ta@Ru@c*!a*_k`T*!aR_k@T `R?k` T` ` a@!Qa(RMkM}`5`b@a@!Qxa`$5D}`$`@Q`R:k&`@Rbk2T`b@ 5P3@!`@Rbk@2T`b@`25ks{@3`b@*35<ҁRk03@03T{@"{7 R`bxa@!Qk`b@`4a@!Qd`b@`4a@!QvaJ`b@5x@a@a@!Qau@5@Rj@`@Rbk`T`b@5ky@`a@`b@!Qa4kDu 5`RjX`a!Ef#$!@Di ``@cCQ`_`b@a@`4W`b@ua@5 `R?kTw@eRj@wa@`b@!Qa 5wRjA! Ri@ 5`b@u@5F`b@u`5?`wb@u59a@cC!Ql`b@`b@`4a@!Qaa@`b@!Qa  |a@!Qa`b@y 5\yta@kD!Qaua!E5@DiEif@#``@cCQkD`}`b@a@!Qa9a@`b@!Qa4ե`b@@4a@!Qa`b@/a@!QcCkDcC RkD`b`b@ @@?T@!bBExa W@_DiEif@#^/a@!Q@ cCRi`za!E5@fmDiEif@#>Ri@@@#R?*Txa!@a!Eq`c c!!@cR `@Q_XhcC R`bQma@!Qana@{] R`bia@kD!QsEa`b@\a@kD!QsEaVf#a!E%7}n;7@@[a@}Z"k`"h @@:,T4c@3@cQca@!Qa`EBi@f@"`@cCQkDsE`kDsE`b@V /a@!QcCkDsE@cC RkDsE`b:{R@S*c_kT`@5cwRB)[k@Ta@R`@!w5B)ckT_?a@ QtRkTab@5Rky@h`yd@ab@Q`a5`@a@5@@g@C)8`F**]Pc@@kDcQ[BcCcSA{Ǩ_`@ab@Q`w 5zc@wab@`zs3 )3@M)93 )8B@B}3@ZM)@џ,T`F**PsE`@a@kC)e`Y.`g@*`F***OkDc@d@[BQcCd R`b:.c@dQkD҈32.3@ R`b,.dQ[B RcCkD`bSh 7`@ab@d@tB)5`RkaTab@4`@Q`j[BQcCkDkDc`b@`4c@dQd@ R[BQcC`bZfxz`{:<@n {Sa @!@AT@@B@SA{¨ @@_ T @T_`T@`T_T@T_ T`dxdT_aT 6 @ T Հ@@" @@`G@A@!T@?dBd @Ac!%c 33~@1@TSA{¨_`|ETa_{  @T @{¨_!Rab{R@S*!kT`@ 5[tVB)c*k`Ta@b@!t8B)"5kTa@!t!@?@qTv 5`@k T`@v@@q Ta@vg 7a@b@`b@!u8B) 5`5tVB)*a!E`Cc@'!@R a@[B"QcCbSA{Ĩ_g 7`@t@t@@q`T`b@t `@a@ f@*C)*!R -a@"Q@[B RcC`b{g7a@`@!`!@?@qATa@5 `R?kTR"g Rg@a!EFEiƀ&!@Bi a@!Qa Rv`bb@[BBQcC R`bx[B"QcCҔ`b@4a@!Qtawa@`b@!Qb@[BBQcC`b@@4a@"Q{b@ R[BBQcC`bsa@,a@!Q``b@"R*bb@{C@S[wh T7 c}d Tt`@ Rv`` T@@` T@@` T@@`T@ @`T@@`@T@@`"T@@`&"T@@`*&`T@ @`.*T@$@`2. T@(@`62T@,@`:6T@0@`>:@T@b@! !_Ax ,T[BSA@{Ĩ_ҟ`lD5{ `F`@1@T`C;`E.@?"_ch`B@ @c@ch@d@3B#?` @{¨_ {S[  T@`T@` T @`T@`TabҢz`"x TC;`E. ?a_bB`h`!@@h@d@!c?b[BSA{è_ssFaB@ Pg1@T P'sBsJ@Tzv@AB7# {R@S*BkT`@ 5[v@ `B)k`Tb@C`c@0qTab@v5``B)k Ta@7`@_q@Tbb@5* u@ q@T@vb@e 7b@`@A`!@?0qaTa@`kTB`ab@C@q T!5b@[BBQbSA{Ĩ_``b@5uB)kTe 7`@axa@ qTu@b@e7b@`@ab@B`C@q!T`5B@' ,+b@AQ[B R`bae7a@`@7`@_qT`b@@4b@AQ Rv`ba@[B!Q@ Rb@v`b@*b@AQ@Ҝ[B R@`b {SbBE[a@C@'bBE?aTt@T? TaT6#@a!E'@"@c!TSA[B@{Ũ_#@`-(aT AT{R@S*!k T`@ 5[uRB)'mk@Ta@!u(@Aa@u[B!Q'CmaSA{Ĩ_d 7a@`b@!t(@A 5`_ab@5b@c@@q$ T``@?q!Q BziT@ A`@ mb@'CmXBQ[BbSA{Ĩ_AQ_qT`a@?q!Q BzTA Q_q`T"|@`xb@?q!Q BzTB"64`b@4a@"Qbb@!R[BBQ'Cmabb`DA!-@X.*a@"Q`[B!R'Cmabbb@[BBQ'Cmb{R@S*!kT`@5tB)kT`@t@,q@Tt a@!QaSA{¨_*`nd7a@`@!`!@?,qTܟ`b@4a@!Q R`b{`ESB@_T @ Ts @S0 4@`E@@BTSA{è_@@0cBD4`@ TbBE@C@!TSA{èQ`@1T`  {R@S*!k T`@@ 5[u@`b@u5a@uxRc@ab@u4[Bb@BQbaRcab@a5y a@[B!QaSA{Ĩ_xaRcab@5R Ru4x@@a@J)a@"Q[B R`b1`b@ 4a@"Q<)a@"Q@@[B R@`b  {RbBE@S[cD@7*!_k`T`@5w@ a@w`b@5@5`vB)kT`@v@q`Ta@v!Q`Ea7@@BT[BSAcC{Ǩ_hc 7`@axa@qTa@w!Qa@k+O Ra@v`bǞ`b@4a@!Qa@5 `R?kTR395`b@v@`5`Rba!EkfDiREi+;@sFƀ7K3 kD+@*3@•R/;a@!Qa`b@4a@!Qaw43@a@!Qa"`b@v@5Rb`A!R A!E@"@c!T{BSC[DcEkFC_֡!P!X`x`! o@CR{@@D{[[@o@ REDRG@bT`@9@QB!lS_$qT!Q# sGqTkHT@kTo@QB_q T!\Q# `Q_Ta @9!Q"_qT aG?BTa@9!Q"_qTs G@qT@G@ @kT*+6sGW@ S@ ҍo@#Ro@RERERo@CRo@Ro@Ro@cRQB_qT!Q# Ax%`s{@#| #BB@cZsG 4Eo@R`EG@#AcGJC_"T` @9q@TG@E@@!RCFqC@`G A@9?qTBGHTE@`o@R2sG@ EA!@@KsG}W@F@A_!1@TA*s *{Z[@ATBG{@?Td@sR?`4@$G@E@  {@SkTt@ca2@?k! `@95`@`@Sr TRb4a@9b 5 @SRabSA{¨_`@e@ T`@94`  Tb@cc?kT`@95 t` Tc`@?kiT?k! `b@d@Rm`@@7!9t9S_q`T_qTRb!4aa@94R?kiTzb@d@RF`@@t7!at@Rb!5@b5@h  {@ @@95` @?T @{¨96%`@7`` @{¨_֓SsFa@ _1Ts a@a7 `ґ{S@"B$S?r`T_Tk T"@b B`06?r@ TB AUF!@*f@Z@T@(J5@""S?r@T?r T_q!T?h38@SA{Ĩ__q T_qaT@?x3x@?rT@?@T@_Tš@?x3`?š@ʡ@@@ @q! CcFEХ@*fd@`X@TD'_A!F{!J 5 ` @{¨_ {DF @e@T.@b@?AT`@d a@A @{¨_֠@7Ѡ`a@ {S@`7 `8`@LTt^@`7T`@`@6`@`@A 6`2@`@ 6`6@`@ 6`:@`@! 6`>@`@6`B@`@a6`F@`@6`@`@6`N@@O`N@@L`N@ @I`N@@F`N@`J@ `V@ BBFSA{Ĩ@X@Bh@!A@!@ ?!@!@ ?!@!@ ?!!@!@ ?ֽ!@!@ ?ֲ!a@!@ ?֧!@!@ ?֜!@!@ ?֑!A@!@ ?ֆ RQ8`@ T@7aSA{Ĩ_8sA;@E.@?[!h`6@@ Tzuzu ?ր@[B@U  {[@r@TSu @MTSAR[B{è_r T`TqSA`@R@B @{S.RM `|Ba@7!aSA{¨_ {RSSA{¨_SAR{¨^  {D@G;@@E.`?h`B0@6{b{@b{D;ST@@E.@?[h`a5T@@?֡&@!&SA[B{è_k@D!! @j`@7``d @?aT R_{D;@E.@?{h`c  @P@c@c@D{A@! @Yj{_ {@SBBED@b4@"C@B T!@@E?ATb@_T  TTRA!E@"@cATSA{è_BBE@D@TSA{èT@bRT  {SBBxFc@TSA{Ĩza!@7!`[ T`@T@@6A!` 7 5sbcx_Tbzw@_T6R&@cC&SA*[B{Ĩ_A!Fc!AAA!` 75K@&@&7!a a@*a7!aR*@4@7`s @2@`@ [BSA{Ĩ *b$Rc@{qjaT @1@T ~G @}``q)ҥR$$)Ǡ|{_@EA! @F@EA! @F  {S@@P@`@B@7рSA{¨_@?SA{¨T_qaT R__ q@TR_ {C;S[@E.?th`$@T&@*"Q&?qM Te@@? T#d@*`?BBD T&@&SA[B{Ĩ_@ 6e@d@BB,GBu`?BBD!T@B 6 qTA!F@E! @1T q Tb@@@A!DE @BuB !@ @EA! ri5e@@`Tc8*5#d@XD*`?`TcC@A65e@cCd@BB,GXDBu`?T@6@7Rd@cC!yBbte@Bn2@@@~!Ac7R@d@cC#d@XDRA!E@F!AiR@ Sda {S5 @A!|D_T@Fa@a6*SA{¨_: *a@7!a)@T@6{$@ *T@6Tb Q_qTy*qAT@F_qA!E @{¨_A!ETBBFq5 qA!EBBFk @ {¨_ qT qLT35@EqT@FsQqiTBp@D@D_BBFq   {BBES[6cAk8s4җOA@RV`` =!R@UGo9@@9 4q T Ղ@9"b87@8?q$@zaTˡ47A@9BR?qMT@8q NTqZTqWT`!X7@9q@T@9qLTqTTqTTRq`TT@9@4@9a4XQ!?q(T"?T?T!4s!fAZb5qi TQ"?4Tq0Tq@T@DA!@vgA!E@"@c#TSA[BcCkDsE{Ѩ_ր@9q`ETCcGa`S6Q B|@@9@9axa!6Q |@! š?PT{9_qTK@@$57<!}K@g@7i`q T@@Rb_q`,T_q .T_ q+T_q+T_q`+TK@@C2437,}K@k;|@;@k@C9s?q@C@{A?!@q"{B7[P?qI1TL?0T?@1Ts@q2T7@3TC@!kD@7?@k@T6[@k@RuTk@kqTXqT@K@7<c}K@b4@7<B}K@(g1T" _qTO@!v9b5q(TTqT@K@ 7<!}K@lg1 TgHqT@K@7<!}K@k;( ;@k@Sg1 @T7 @aGLqAT@K@6" _q-T<!}K@k;,-qaT@K@7<!}K@k;" _q TO@!" _q TO@!'O@!@7 & qTO@(gB55`<}Ka@H" _q TO@!h@qT< }K,6" _qL,TO@!@K7##@K@7,!}K@?k Tm#7" _q,TO@!@K@7<!}K@!!|@C9?`q T?qaTA7" _qTO@!qqc*q`TqT@b_q T_q`T_ qTK@@"7<B}K@k;;@|@k@@K@"6C qTO@"" _qTO@!GRZ yR9 G!!@B_q@T_qTK@@7,B}K@k;W|@;@k@o@ qTO@"_C q,TO@"aR@1T7[@k@RPt@Tk@@khs@"1@T7@R[@sk@;tT7@k@s@kX"7\ |2@9qT"R@K@B7,!}K {A ?qTO@"@bPhTq@T@@b_qaTK@@c47<}K@k;J@ qTO@"@bRbbR_R\@K@7,!}Kƨ2CQB|@@9@9zaa6Qa |@! š?T2#A ?q,TO@" D!!@@BQ D!!@BJ<!}K@@H@zT7 D!!@@d7 @9 4BR {S_@ T@ `@qT`AkT`@qaTa@  aT@y h#xc@cRcSA@{è_4R1 T`@c@qTqTd@~ TˠB A~BB! B}B "T"h`8x x`@q! T`@a@Gc@za@`@95{.!R`a9Qc@a@~!Tˢ _~BB|!@T@hd8 x$@9B@F_8F@_8F_8F@9! "x_8"x_8"x_8"xc@  {5@S @rT`@RqT`AKT`@R4a@R!aSA@{è_Sq`TqRB`@kT `@P1Ta@`@95 R`9@1@TtP@SA!RRSA {S[ @T@6 T@62@2@7!A`@7`6@ F5@@ T!@a@! Ta@ T@@ 6c@# @1a T[BSA{Ũ[Y`@T@A7`@1T2@a2c2@2}@ @ l{@7!5{@7Ѡ[B2@2SAcC{Ũ.7a@!1@Ta@4@1@TTc#R۞`@uncC#@`@1T` ҘSA[B{Ũ_!!D[BSA"{ŨB!@~@7!a`T@T59R`@7`@o2@2; {@2@22 z@'@!7!{?#cFS$CaT@ E.`?A;CT@3h`X6@@j`0s`@T@a6SA{¨_"@BT@7*?҇&v$ЄD @!Ѐ@! b`@7`c {B;S E.?#cEd@e@Th`T@X6@dj`A?J&!!E@"@caTSA{Ĩ_#ҹ/'  C&E{S[ckARs*O@c#_@ @@9 R?4@@9 .4;s@zs @9`-4; s@zs`@9,4; s@zs@9+4;s@{@9 +4{s@{`#q %T @ &TqmT**RO@*`@9q Tk!+T`Ok)Ta@9?qTs O?k T*C.5 k,Ta@9 Q?qAzI*T *_Izj Tk+T@(5 R!!EA"@cT{@SA[BcCkDsEC_*a@9 Q?qAz)&T 5 Tcxt#c#*@3k/)K3@/GK@k@P)-Rk TqTk!TsO?kmT D!!@>eztc{GFG@c@{@@JaR @  @7R R @G dk TR*cck/G>/GG@c@k@@@ D!O@!@Ga#s5O@ A@9?q(4?q@zA#T_-T *t~@3T}c7jt_7@c@# s D!!@r>I k-T?k T D@cc;m!!a4)Wc7c@` 4[@`@T@ "6 *k"T D@U#d;!!"`5 c-`|3k_3@k@@ RTR R ҋ R D@cc;%!-f%q&*!!` D!! @>5 c-'R D!!@@=x D!!@=o_@#R- D **!!@`_ D@5cc;!! u` D@cc;?k%ќB1 k2a!qƠ- !!Z`6cc;k!@21qa!Ơ-  *!!A`[5 c-5 c-5 c- |@lW@@;R@9`4{s@* D!!@`D)R3 * {s@{ * D@cc;jte!!!_+5 c- D@Ucc;!!`#_5c- D!!"@4= @cc@55-  @@_@!1T_{W! "@@?T@@_@7!2@2@7!@6WA{Ĩ_2@@2 р@WA{Ĩya@ F?T FT`@ 7` g C@@C @@6@0@2WA{Ĩ@7@рWA{Ĩ D!!$@<@@@7р2@@ $@ T{S @T@`7@CT@6C@cT@ 6 6 T@ 6@@@_-T @?@T_T@?T_T@?T_ @T`cxcc?T_aT RSA{Ĩ_[h@3`Tazu4[B  RSA{Ĩ_6V@66R_ֵ? TB@ |E?[BR?  A;{ E.@?!h` 0@?0{_A;{ E.`?!h` 0@"0@7!a{_{{A;S E.@?"h`[6@ Da@@cH@U0@! _0!|@B@ R`Zy9 0@ *50@7!A@@t[BSA{è_w```@Rs2a97`@e@  {[V;S E. ?j`c@0@8@@0 @ @ D?AT F@@ 1 Ta_tx) E. ?j`aB`_B@@Bh@C@ab?A@7o`@7`  E. ?j` 0@50@7!ARSA[BcC{Ĩ_@1@T@!!FAT@!!D_Th @1@T@w 1!T`_tx)@&c`"B*dR҇I@7  AR(Y@6 AR(Y $ @@@BKe   {A#@"BFaT"@@B1T"`@7`R{_"BF?T@A@A7!A D!!)@: D!!)@:"@BT@7"6!T@6R_$@!`_JT#xbBe@T@e6cT@7!!D{"!@B`*:{_ {_Sb_ @B~d@@A@ `a_!@?_TA; E.@?4h`t@b?qT` @!A@7!`@@7!A SA{¨a@!@?Tt @T@?qTa_@@!@`SSA{¨_`@`@6SA{¨ "BF T#cE"BFRBaT*_{@b0@B$@Bc,_aT@@MT$R*{_$R*_`8@@@?`4@@@?|@@_  {D;S E.`?#cEch`[@a@?8FTD@"T@ 6@ @1`TX`LTbB}Cc+p4`@7`  Fa T@@6R!!E?@"@c TSA[BcC{Ȩ_X Tk}B#ѡbxC4C?TkDkD`@7` kD#@@`?nр8R@! D!,B @@J\@7р'T @1T`kkD{S@@@CT@c6 R @1@T SA{¨_C@b@SA{¨@1T {S#cE[e @ckf@??T}abcC+3 E?@@BT[BSAcCkD{Ȩ_:}abB#3C`T9D{_S[a@3!@?TA; E.@?4h`4 @bqL Tb@v _`T` @`@ S @7Ѡ [BSA{Ĩ;q{a@3!@?`T`@vTA9qT`"@cu@@"7!AU`.@xRB@~}kTka@@k!A7CcC@ a7!9@.a7!1@q Tb_ @B@`3SA[B{Ĩ_@7!a{D;S E.?B@h` T!@ @!@Tc_T&@Q&qT@@DB`@T"@BT@b 6 &@!&SA@{Ĩ_ր?֡&@SA!&@{Ĩ_$@D@ T @T`T@ TT@T T`f҇xfTaT-C6@T$|E T[ D!`@Z`@7`ҳ!B-!@ ;P&@&Ҧ[ D@!@@CZ`@6`@[ D!@ @Z`@6!%2[ 4~{S[=cT`@`6[BSA{Ĩ_A; E.@?7h`2@`@@7 `F@`!!G!@4S,6@"B`9c @` @@  @{@CT@ 6@1T @{¨_  @{¨_A0@a!@a D!B @! :@%Z4; ?`@!!F@TT@ @a6 F!"B;@F4`@7` D!!;@Y`@@6{S(@@qT5FR@F@!ssV@@?ր@k T@RV @*@_@3TP@SA{èKs @G   {?"BFS$B T F@_1T`@T1TD; E. ?A_ch`$!@c@ch@d@S @@@!C?`SA{¨_@1@T`@T1TD; E. ?A_h``$@ @S C@с@$h@@D?{S F`@_1@T`@T1@T`D; E. ?֣c$Ch`S A_@@у@!@SAch@d@!C?`{¨_SA  R@4U  {@a@B~ !@C!a_!@?$` @@7!`@`@6 @{¨!A@!@ ? @{¨ a{S[e c@- T` @_` 4c@T`@V@4c@mT`@M 4c@ MT`@D4c@-T`@;4c@ T`@24c@R~@7mT`z`%4c@@Ne` RSA[B{Ĩ_@Rs @ ޯ@g@a H)cI)sC`` R  {SB@[a@@` kLWT@Q`qT Rb SA[B{Ĩ_ց!P!!X`x`! ֖@v@? T @"4@?T@4@?T@N4@cwR~@?7,ATcC @ 4b @BQ@ 5R@@4cRҗ @җT6@04~@@@cRVC?AT @e.4@ .4@R*l)T`@`7@@,cC@@@RҴT6@j`*4~@@@4 @`@cRҖ)T7@N&4~@@@@4 @4cRҗ@җ,T6@1@#4~@@@cR7?5T @R@-T@R"?l T@`4@RҴ?T6@L4~@@@C4@>`5R@74cRҗ @җ)T6@ 4~@@@cRV'%T @RҖ-T4@4~@@@RҖ T4@ 4~@@cRҗ@7*?(T @d4@.4@Rҷ?T6@ 4~@@@'@@4`@7 @`4@cRҗ@W@? T @RҖ?T4@d 4~@@@4cҗ @R?T4@@ˤ4@` @RҘ?MT6@;4~@@7@x 4~@@ @m@4cRҗ @w"? T@`5cCR'7@@U4~@@ @RW@T@RlT@RҴ?T6@4~@@7@@4~@@6@e4@~@@Rv?T @e4cC 7@4~@@z`4@6@@4~@7@4~@@@R? T4@4~@@~@@17@4~@@7@4~@@I6@ 4@~@6@4~@@c`5cC;cRҗ@@?T6@B`4@~@TD!!@23RF@w4 @r4cRҗ@ @? T6@4@~@6@P 4~@@ @R@?T6@d4@~@@R@?T6@`4@~@@R@?-T4@4@~@ҫ@R@?mT4@ 4@~@{kBESTA)s@@_Ҁ@ klT`@QhqTa! "!X`x`! `@qT`@!  5 RT !E_@"@ca`TSAkDsE{̨_`@4T @Q`@4t @@?mT @4@?MT@4@?-T@ `4@[uR~@?5mTz`84@[B t@@T @ @ 4@mT@ @~` 4@[UR~@]T[B`@q4t@[RҔ1,0TaA| @!xb!$Q?q 2TT @[BQ[Ru@U@?.T4@L /4@~@`@C4` @>`4`@b@qT@@PqT @PqAT!@@@ 1f@5RO`@%@4`@ 4`@b@@?Pq!Ta@@@@?q.Thq,T@T@6@@7u@7@C@-Tbx`B@_\q@T` @@4a @b @ @Pq%T_qPzaT"@"@@T@@$qKT@R@ @` =` =T @Q[Ru @ҕT4@@ 4~@@`@ 4`@5R[Ru@@?T4@@4~@`@ 4` @`5R[Ru@ҕT4@@4~@@[Ru@ҕ?T4@4~@@`@``@v`4[Ru @ҕ?T4@a4~@@`@^`4[Ru @ҕ?T4@a4~@@`@F`4` @A4`@<@5R_`@`@4` @j[Ru@ҕ?T4@$ 4~@@`@4[Ru @U@?mT4@a4~@`@4` @`4[Ru@ҕ?T4@sa4~@@,5@4~@@t`@qT`@dd5[BR`x`a5[Bc=c@ @aXb ?֓u @Rҕ?T4@@4~@@PqT@A@T@e"TPwPqaT!Q[U@?0q!T`#Xaxa 7@F7@@[c?;CG@rDTHr @S{T*qTT*qAT Tt3{@?ja6TJN`7***e !@"!! {" @7@_ T2@;@?1T7@R@xa?_`TD?@*qTTq:T*qQAzH Tqן @v1R@0T5!@hn4~@@e4 @d4@S@R@~@5MT!za4c@@BRH)I)p4@u@@cw@T @,RҠ@ ,T6!@4~@@RҀ@T5!@b4~@@Y4@5aJ@[C!Q @URҠ@T4!@G@}4~@@l4 @vK@R@~@5T!za~4@*RҠ@)T6!@X4~@@RҀ@MT5!@Al4~@c@@BRH)I)@4 @R@@~@5-T @@@R~@_5l)T@U-@ @` @@gd@_4@H)I)R b]4c@ @b A9B2b 9d`4@V"R@?!T5!@w4~@@^4 @A5aJ@[C!Q @cRҵm$T6a@`@W@"Tc@H)I)"Rm4H)I)[`4~@@@@`q %Tl4 @?yl4@!5aJ@[C!QcRҗ@ҷJT5a@`@V@߁"aBTc@H)I)R]@4H)I)" E4~@@@D4 @cRҖ?MT45@@(V4@AV @R@?-T5!@ U4~@@R@KT @URҡ@몸T4!@|@b4~@!zaT`f4@RҀ@T5!@f d4~@@ @H)I)"RFa@=4@@a@R5!@K`94~@@Tf14@[CwcD`J@KR@~@?6-Tza`74!za X4@ @5RҠ@덬T4!@ 64~@f@44@@Tf 5aJ@[C!QRҠ@T6!@p4~@z`P4@RҠ@T6!@!@q4~@cD`J@'!za`64R@~@6mT!za)4~@@$R@~@6MT!zaB4a@@`@Ҁ`"@"AT!4c@@B RD)E)N@4@ c@@BRD)E)D 5aJ@[C!Q5!@&4~@ @ Tc@ ҄H)I)BRF *4c@ #҄H) I)R!5aJ@[C!QcD@ Te5aJ@[C!QcDA@?MT@RA@|@#@"TR@H)"I)  4@R@?T5!@4~@R@-T5!@@94~@RҠ@-T6!@3W4~@R@MT5!@&;4~@@@ T@@RH)R"I)  4@`u@Ұ a@> <@@VR@?뭧T5!@<4~@c@b@c @`Ta4cE@@c` ! @aK`@ H)I)BqaJ@R[C!QaJ@[C!QaJ@[C!QaJ@R[C!QaJ@[C!QcDaJ@[C!QcDaJ@[C!QcDaJ@[C!QaJ@[C!QaJ@[C!QcDaJ@[C!QcD 6!@E@K`@ H)I)BpaJ@R[C!QcDaJ@[C!QcD 6!x!` !aJ@[C!QcDaJ@[C!QaJ@[C!QaJ@[C!QcDaJ@[C!QaJ@[C!QaJ@[C!QaJ@[C!QcD|aJ@[C!QxaJ@[C!QtaJ@[C!QpaJ@[C!QlaJ@[C!QhaJ@[C!QdaJ@[C!Q`x`$RaJ@[C!QSaJ@[C!QOA@?mT@RA@|@@jTx`aJ@[C!Q8aJ@[C!Q4aJ@[C!Q0TD!@}(aJ@R!Q&@5aJ@[C!QaJ@R[C!QaJ@[C!QaJ@[C!QaJ@[C!Q aJ@[C!Q aJ@R[C!QaJ@[C!QҼ5`J@[CQcDQRaJ@[C!QaJ@[C!Q @4@VR@T5!@4~@aJ@[C!Q@`R@~@4-`T!za4aJ@[C!QaJ@[C!QaJ@[C!QaJ@[C!QR@H)"I) U@4@vR@?͊T5!@@*4~@$RaJ@[C!QaJ@[C!QcDaJ@[C!QaJ@[C!QaJ@[C!QaJ@[C!QaJ@[C!QaJ@[C!Q|aJ@[C!QxaJ@[C!QtaJ@[C!QpaJ@[C!QlaJ@[C!QhaJ@[C!QcDcaJ@[C!Q_aJ@[C!Q[aJ@[C!QWaJ@[C!QSaJ@[C!QO@@4a@cR@7@@+q@bH)I)R^4c@@`@A93`@9q T@4c45cD+@`J@Z@R@?MT5!@ @ 4~@c`5aJ@[C!QcD+@@VR@?T5!@@4~@aJ@[C!QcD+@aJ@[C!QcD+@ @R@?-T5!@c`4~@@BRҡ@? BT4!@4~@aJ@[C!QaJ@[C!QaJ@[C!QaJ@[C!Q$D))&E)!FR!K@5aJ@[C!QcD+@aJ@[C!QcD+@@@T@H)"I) RRH4 @R@?T5!@ 4~@aJ@[C!QaJ@[C!QaJ@[C!QaJ@[C!QaJ@[C!QcD+@|5R:aJ@R[C!QcDtaJ@R[C!QcDnaJ@[C!QcDi6! E@_I`@ H)I)BenaJ@R[C!QcDU 6! aJ@[C!QMx!` !aJ@[C!QBaJ@[C!Q>aJ@[C!QcD9aJ@[C!QcD+@3{SH@aN@*`Jk =T@!Q?hqTcc@$[cXaxa##`ր@c@@"@q!TRD).@`4@qTu@B@qQBzT@! 65[BbJ@BQ RbJSA{Ũ_ց@5`J@[BQRaJ@4 @U@T @4@ T@4@-T@4vR@~@?6 Tza4@@mT @!@14@MT@!@/4@UR~@T!za!@x`.4@BR@o`4@RҀ@ T5!@c4~@@\4 @@ RҠ@T4!@N@4~@@G`4@C`5`J@~ @RҠ@T4!@5 4~@@.@4@d@RҠ@ T4!@`4~@@R4!@4~@@?T`J@[BQ<@4 @@5`J@:@Rv?JT5@4~@@!v}@4@4`@ A9L@!2 9b4[BSA{Ũ1n@;BFB^`5`J@@*BFB^5`J@@4 @5`J@!=} 4@4a@[B A92 9bJ@BQ`@@9 "7@R@@~@5,#T@@@R~@_5 #TD) ×҆E)!FR! [4@?^`4 @{4a5`J@@5Rҡ@?mT4!@j4~@!|4@|BFw҃@B@y^5`J@@BFBm^ 5`J@!|4`@T@?qL TL@@5 @74@3`5`J@Q`Jl[B` @uR~@@?jT4!@5`J@Y!F҆E)!D)R 5`J@LTD!@$`J@QE`J@[BQAa@c@8@@#Y@ @xxN@ 5B@ 4q` TTqTqTc@D)E)"R@ 4D)E)k{ 4D)E)"R4cC#@E!@F`@ D)E)Bl`J@`@z Ta@`@zc@ 6"RD)E)p4D)E)5{4D)E)BRb`5UE!`@F`@ D)E)Bk`J@cCQ#@`JE!@F`@ D)E)Bk`J@[BQ!zay4z`q4@Rq`TqaTE!@FE! @F`@ D)E)BkE!`@|FcC#@`J@E! @qF{cES@[*k*s** @? g=@@@@T@@6a@E? Tb@_@ T;@s@A57P7~@ BA9 07@T@6`@1T@1@T%7@6U77`@@6 R!E?@"@cҁ TSA[BcCkDsE{Ȩ_ۀRAA;E.@? h`0@~@@!6`р`aT`!Tw@ 29@7@@7рq TAT@1@Tm@"BR! G!7@#7@6*E!@E@g@*Bj`@`7`yRwRzA@@7рlW6E!`6E!{S[`@1ATf@T@6 @Sq TrTr T @9|qT! |qTv @cї @|qT |qAT`@1 TcC?`<$RRwT|q`TT T@a@CS?r TR 4@Sr Tr_qT R9!/`(cCSA[B{Ĩ_ qT @9r@Tr!`@ @@9 @@cC`@7Ѡ`cC_qT R@ RyBS_q@T_q@Tq T qR!5BS_qaTG! @"R#5RR?k! qQBz_{BE C@'@5E@@BҡT @{è_oG!@!{ ?@cT@6@R<TA@@3ss~ @{è_0@`@<iT&R#RCcKG`Tx`xxEaTc|@s|4@@7@@5qҀST#4!;R .@A@@3ss~@"$@f@@ˈ@B<)TcCӄC`| # @@BkT`T@@BkTT @ @Bk!Tg T@@BkATѢ` ``TBxgxgBkTK@|@!|@_R@!@`| _@<(T@#@ |_T"@&B@_aTBF@X@Bh@RBF $?T@ _@T@D6 {a[R ?{_  {ES[cks@gң @҂Ts҂5x˵T@}T"T{tG#T @{33?s}!3@`7? TT7@3}hs`@a 6T7@`_`@A 6 T`_`@a 6 T7@xs`@A 6s!TFRTzA@6Eg@@BaT[B*SAcCkDsE{ͨ_!AA@!@ ?T!"- @T@ 6C@ @tҳ?!TEg@@B TSA[BcCkDsE{ͨ]!@!@ ?֠!@!@ ?֡!@!@ ?֠!@!@ ?֡?@ @V3@6?@7@F@T7@f@ax`"@B1@T"{ ?T#7@3ն3@BT?-TCc @3#7@`B}Ӂ3@373@#;7р@U3@`5҇ 9o,2K@7`@7р`W@@7!!T4RK?@IG@GO@ECAE@@B(T[B*SAcCkDsE{Ш_(!TҔ"A92"9K@`QK@qkTOTC@qTaNT+Y-7@ I6W@"A9B2"96R`zDG@ДF7)6RДFqTT)ҁqT%TB@!Rk@kTO@@@7!a#K@G@@!7! "A92"90"A9~BlG!@kk@}T6`9@@ 7@@7687K@ g6RP3{@3@ 4w@C~;7@< Skq5Tb5X7@[s@ J@k@[@q@ T@,@@@;s@*;@A@7!A/7k|@s@77@7@@7@k@qTs@ T@;@@TB@q Ts@ 6s"A9ן3@"95BA92B9BA92B9IB@qTs@! ;[^;@[@`4;`7;@`RkB@qaTs@! 7[G7@[@ 47 77@Ysk@5@7:0K@~qTT0@6G!@3G!;@;@CG!@R;@7 Ru`@uT@`7ۀR; BA92B9@! S6@@7@`@7р`RO @7;@xb @r< SqTF@;A;GCES3@`4s@P@4C@;@@)o@qKT`@u4T@`6`@S@T[T{@.@4C@[;@@[@2c@T@7R:3@A?=R: @q 7ꀑT`7mk@9Rz2` 7@7S@7`KRB@qS@78Bs4s@р-BE!"@A>d5Rs@[k[@ 61aUۀR:ob@_TaрRGoRGOeRb_рE!$E!$E! #@=Fdw5RG>`@1T@1aT7@6`qaT hb8_qaT xbx_ xb_ {@S!ETa@E?!Tb@_TSA{¨ZLTSA{¨_ 5!D!T@ T!#R%95 {S@!ETa@E?!Tb@_TQ@RSA{¨_փ@B$@B@4Bbd6 R$P RT`5!R%H9  ?@T2 R_@SqTrTrT@@9_ֿqTY@hc8_@@hc8rTrxc_@xc{[@Sck9R@u&_@B@[BSAcCkD{Ǩ__`TQB1TZEӵ s@aTsE@BE!T"@_T33@@5@1@TBR3@*3@7BтC7@AT@TC5@sEc7c@7@6sEҶsE {ƌD@S!EAATa@E?Tb@_`T@SA{¨_HAT5 5Ё R%8 {@SB0@bBp@DR<`TSA@{è_D@?T@7!A\@SAB@&{è  {BE&@ DGaT4 5`@1@T` @{¨_45sD { @  @b@_aT Ba@? T'|D@4"igE! TK T@)Ea T T@* _DE T T@"Ea TT @@4'DTkT(@"DTT0@'DTT8@" D!TTE|BieDTbT!|b@iaAa@!1aT @{¨_Bb@ 7!!a@`    lF!@`  {_S[ @ b_ @B~d@@A@ `3a_!@?_TA;E.@?6h`@bq Tbb@ BmTt@UB4@UT @BUT@BA6aT`@aTa@!@ ?ֶSA[B@{Ĩ!Ja@3!@?Tvb@6JC@qMTb_ @B@`3SA[B@{Ĩ_  bšTcF`X@c`@cF`X@c`@_  {S["@AT@6 @@!F!@@ b@`?@7 р@!@ ?S `@T@a6@7[BSA{è_@BE?AT`@1T`SA[B{è_BF?TSA[B{èA;E.@? h`0@!@R@!F!`@DcD @!`@:`@7`@1@T+@6҄vDB @! @Җ:!E_T!F_Tb@!DC @!@B  { RS&!D?TSA{¨_SA{¨c@ R  {E[c8|@kY|@7@GW;+d@o 5s @MTZES` 7@@T@3xt 6`@ Tb@_ TC@@5@@T@<6`@w @r)T`@R1!*T_m!T@@ @3R h@RU@:6h@b@r2T?q! Bb @e#@Jr$_ Tzdh@U@76h@b@r (T?q! BHT_jTb @ @Jr_mT zdh@U@"46h@b@r`T?q! dBHCT_jTb @ @Jrzdh@U@06h@b@r&T?q! DBHT_jTb @ @Jrd_ Ts4@r +T@rTSgآ7_- T7\@;g@@$@zaT`@`a@?r`*T?r@#T~a3_T;@`zs5`@`a@?r`$T?rT~as_ Tzs$@z! T`@`a@?r"T?rT~as$@zzsTg@~_ T7@@98`@{`@ 6SAcCkDsE[B{Ȩ_`a@!@ ?SA[BcCkDsE{Ȩ_SqT qR?k!  HTG!'@\YSAcCkDsE* g@~_T7@@98`@`_T7@@98`@ z@Sg7`@rTrT`7_T7@;;@7@;x;@7@?q?@SqTR`@1 T`6@E@?T@1TSAcCkDsE{a~RLSqT qR?k! $ҟTzt@!T @RHs֚F@ _1TMa~$2Sq`T qR?k! RRSq@T qR?k! eRFRa~ sRJ`7_ T`@7_lT a@R0@Ra@cD @!`%`@2#D @@! &2a@RW)R7qR!W{@"@ s@cB@<T@ !@s~?hTR!F# @{¨_w@w?hT @{¨ T_T @{¨$ @{¨L @{¨_@T@#"}aK! @{¨y${S[* @҃ R*1`Te@`1TRRa@|"&7h%SA[B@{Ĩ_{%@ A@?kTR @{Ũ__'kT`|@C'@C@@Cv_B7|@5xS~kjT~@#7#@RUˎ@@ @@g_Bc {k!ESs@@"@wQlqTREw@@BATkD*SAsE{Ϩ_!! %!X`x`! @@ @` 1 TT[ҿ̇TB@a AxaR 1`TsT[B`#@[`@1`TA@*A@*Rj1,TT @R@m T3!@1ETsa~@@=`3@"=NA@ N'5 @Pq`%T 1 TCcc@R`#@!Rdv` 1ZEw@@BTRSAkDsE{ϨnB=d#@=@NAN@A@ N3=@@@w#@Pq#4@$@~0TPqoT 1T@@AC@@x @kwT*Ҩ1T@@a#@r3o4LR`#@a R`1ZQA@`#@!``#@*`61[BZF!@a 1T[B=A@r 1 TA @"atAR@==N`#@ N`=F1Z&@@ sEw@@BҡTSAkDsE{ϨR@=a#@[B=!`N @ N=1,T 1+Tc 1*T31)T F**#R&t1(TA @i 1&TC @R`#@R`=`b=N N=Fk1$T`#@*`1@#TF*`#@ R`]1'TC@R`#@!R`=`b=N N=FN1%T`#@*`1@$TA@2 1 #TU@QR@-QT4!@1T~@cW@p1@T[VC@c7U@@H)s@O@uA@c@"RJW1TеFB@c#@A@`@!1T3@bS-@  `$R`x7  DR`w7`C$A1vT ~ DRu7@@``#@@!@A9a 7C@S@_t7`#@@!@A9a 7@!@A9n7XB@`@B vЄF1rTRc@a R`#@dv``p7!R!o@=RAR=N`#@ N`=F1nTFR`#@R`1mT=<N<Nѡ7@7=`C<N<ND@T1iT@u5;@~@DA3`|@C@CR|`s1T1T;@~@C@3`|@C@4|`DRh1[BZcCEw@@BҡfTSAkDsE{ϨfEw@@BdTSAkDsE{Ϩ+R@=!R=Ew@@BabTSAkDsE{ϨǑ`#@`@S_1 T[V_ 1TU _1TcW1T*1T@=**=NR N= Fr1 TA@*Rg1T`#@*`h1TT @3R@M3T3!@^1@Tsa~@Ew@@BaXTSAkDsER{Ϩֽ@=[R!R=_N`#@ N`f3=1TR1T_@"R1T_@ R@L`#@`1[BZ-S@SR`@뭤Ta4!@1@T~@@=[R!R=_N`#@ N`f3=1TRM1T_@}@ REw@@BJT"RiEw@@BҁITSAkDsE{ϨНEw@@BGTSAkDsE{ϨEw@@BFTSAkDsER{ϨA@k;1{T`#@4@41zT@ @[c|@xa@@?qzTRW@933@ GTA @ 3@3x`\Tc@"R`#@R`<`b=N N=G1uTҍct;a@k V r7c@@c@,?T@7!Ab`@Tc@R`#@!R`<`b=N N#=H1oTb @8RA@?M8TA<C!@C1@mTC@@!@Ccc@`* Rdv1`T`#@*`(1@TS@sR`@͜Ta4!@1 T~@Ccc@*`#@ RtTv`1dT`#@*`1bT`#@R`R1bT`#@T@8@!Q84*`1[BZcCR@?)T5!@1kT~@ =`R!RN Nf3=n1ATL@`@.1aTA@*#Rf1`Tb#@*@`C8@cQC81TS@,`#@*L`@F1TR`4R@N!RAN=`#@ N`f3=31TB=p@="RR=N`#@ N`=F1vT[B1TBY@@=`#@"=`N@4 N=?1@kT[6? 1T5 ?1T31TF* R1T`#@*`U1T F*F@*cRp1@T@ @c W@R@-T4!@?1 PT~@@1LTXc@R`#@a Rdv`1T`#@W@8@!Q8W6`@* Rdv1@T`#@*`1T`#@*`! R1`T`#@R`aR1TsO*҃R5p1TV@R@MT4!@1T~@e#@R`R8@Q8r1T`#@*`1T1T[BcCAҡן*7Xc@R`#@dv`O1@TF"R`#@R`G1@T F"DR>6w@ B5[BcC`#@@@`@GEw@@B@ET[c@ @ @cv*`#@ R`15Ta@;@ <"=N N= Gܟ1`3Tb@DR @@< #xeN"= N#= H I`07`#@5`#@*`U[B1cCZk@bR`@~@4T!azaH1/T;@~@C@#Ҵ|@3``$R3O 473@O@`#@|@|@BR``#`R27@DR 17@ @a+@6@]0CҟLTf+@@s@*@*!RG@/ E@{<CRo.7RzΚ/Ý-7@7Ѡ`,;@`#@$|@~@C@#``R$|`aRy1T[BcCB @Bxc"x @pT #@ $R`W_ 1oTW@DRV p@fT;@`#@$|@~@C@#``R$|`ARF1 TA@)C` c@RhR1`@@T7` B@c#@A@`@!1!TbL97;@ #F|@C@~@ DR3`|` @7A@c@"R=R1@T RR@MT4!@f1T~@`#@@[BcCl7`[BcCd[BcC`[BcC\H[BcCV[BcCR?A)ҡN*7Ccc@R`#@j,v`/  1 T/F0DR  7`#@3@`R R@`1`T`#@)S@ACRw`X6g[BcCAc+Q[B* [BcC [BcC[BcC[BcC[BcC Lc*Q*c@@7!A[BcC[BcC@ Aן.[BcC[BcCocC[BcC@m(T `RAR=H1?T)B>=R&iQ1`@>T7```C=6b[BcC[BcC@7Ѡ[BcC[BcC[BcCp[BcC~ ү USAkDsE{ϨT@= `#@["=`N@v N=1bTt 1bTu1`bTs1@bTF* R1aT`#@*`91aT F*F@*cRsm1`T@ @`@`cW@aR@?m`T6!@!1sT~@[BcC)[BcC%"[B[B1Z@= a'@=cN`#@ N<N<Nh6@"@@_qT@? qAT[4@`1T 1T1TA @j1`T@ @ R"=AR=`#@N` N=Fl1T`#@*`1T**#Rm1T`#@*` RS1`T`#@R`aRJ1T`CF 1@T#R1T`#@R`a R21@TA@1 TW@wR@?T3!@1Ts`~@@= c!=[NN@@a#@A N@4<N5<N`@ 1T`CF 1T 7DREw@@B!TSAsEcCkD{Ϩc ,O" A9[B2" 9R[:[BcCO[BcCK[BcCG[BcCC[BcC?[BcC;[BcC7[BcC3[BcC/[BcC+[BcC'[BcC#[BcC#cc@*`#@ Rdv`1 Tb#@*@`C8@cQC81T@ @ R"=R=`#@N` N=F1 TU@uR@?T3!@1`Ts`~@[BcC[BcC[BcC`#@*[BcC[BcC[BcC[BcC[BcC[BcC[BcC7` [BcCO@7G7Rwl a 7`@7` `#@R`aR1AT[BcC[BcCw[BcC[BcC[BcC}f`#@R!R`1Zs`7@qT==1Tf`#@"RR`1T_[B\[BcCX Lc *N*Q[BcCM`@7`[BcCD1A @ `3xxB=a@ <N N=TFR!R1Ta@!u @wR@?-wT3!@1Ts`~@*R\`1aT-F*R1AT&[BcC [BcC;@#1Tk@a@RB@<`10T [B[B[B[B[B[B[BcC[BcC[BcC[BcC[BcC[BcC[BcC[B[BcC[BcC[BcC[BcC[BcC[B7cC[B46[B[BcC[BcC[BcC[BcC[B[BA[B@ Z7Yn[BcCz[BcCvc@+N[B*m[Bj[BcCf[BcCb[B^[BZW[BcCS[BcCO[BL[BI[BF[BC[B@[B=[B:1 Tc8Rc@a R`#@dv`1T`#@W@8@!Q8R@?T6!@1 T~@[BcC`#@@`* Rdv1T`#@*`1T`#@*`! R~1T`#@R`aRu1@TsO*҃Rj1TV@R@?-T4!@1T~@[B[BcC[BcC[BcC[BcC[BcCe#@R`R8@Q881 T`#@*`1T1aT[BcC[BcC[BcC[BcC[BcC[BcC{C =S N!@=!Q N?hqTR{ASB_NB&BXaxa""@c@{Afd@SBCfd@ 1{AZSB_a@1oT[u@cx@@TqT@qT@@?`q T@@@@ @jY 86u@@ =?hqTҀà$@6N = N=c0$ @ F$M1jTu@ Р =Rb=ARN"@ N`=F1 hTa@1gT` = {A"=RNdASB N[CcD= Fi`@=qT-@5a@q1 dT` = =N N<N<N d@qT"@C Re @A 1ZikvU@l9 t,{TB?MTTz`B@_\q zTd4qATc @3;Yr]T"@ Re @3@;@A 1ZA qT"@ Re @A 1Z7_1`ZTa@1YT` @[=@=ATa@=!@1Tc @=c@f a1[CZ[u@e@qaT@PqT!! ?aTPq Tcw@='=NcDa@=1Ta @=3@nqZT=1@TQ=qT!!!=!X`"@fR`1[CZ`@c@qVTqTfGR&R RROaa@=1LTa@1LT=c@Rf1Za@[u@1T1LTRa@q` = aR=N"@ N`=F1[CZ[v@@xTRKT5=!@z1T@~@=`@c@qKTqT` @[c@RҿNT`@ xv`l@xLUTB"@[a @c4@?q41@?Tky @YOAsNTzu==1PT="R"@R#f$`D1OT=*"@*#f$`:1@NT=R"@!R#f$`01MT="@ @@@4`@`\=1=7TfTr1Ze@ңcFcR{ASBjcFe@c"R"@[`@6?1@T51@Ta@*R\1`Ta @1T#cc@*"@ Rdv`1 T"@*`; 1`Ta@1T"@*`0 1[CZ"@&@ @@@bh7`4 @ QxrTa@=1+T=R"@aRf`1)T=CFfn1(T#R=f1Za @=1&T"@b @=_ q`TT_qBTRfR1Z[u@c1`kT` = =N N= F^diTd"@ ҡ!FR! J1`hTCBF`ZgT@`@"@@"@@c"@a @>@e7"@@! A9AM7a @ `B=R =a RN N=G> c7!Rrrb Fh|7`@7` }[CR'c@fgRFR RR_"@ @@@@r4 @ qZTa@=1T=R"@Rf`1T=CFf1TRX=`*1`T=R"@f`1Za @=1`T="R"@Rf`1 Ta@1ZcFe@cd@bRcFŋce@BRkT = =N N=V@ 51`TF"@g @NA R=1@Tv @6R@T:!@|1TZA@V@G?h@T@hqhT`q(TPq`eTȯT$qTHQq(T = =!=CN@ N= Fc@3 @@I1=T[CcD] ` = =N N<N<N"@*aR`M[CcDkE1TEKTqaTBR"RqTq@]TD*!1@"[C1v@N@_T"@`fR'1[CZ"{ASBf_ @@q T1@LT"@q=`ATfRAR 1[CZC!x`!@aG@85"@fR! R`1[CZcD8R@?T6!@!@1T~@s !{s1@T"@*`8 1[CZcDkE F1aT[CcDkE1TCx4#f$"@"RR`C1T8R61T@!R@"@ F @A1TFgNR"@!R`=1ATu@kE=F1T= 5[CcDv_qaTaR_qTD!@-=@!=R[CdRa@1T`@=@@#!R"@fe @A=1@T=f"@R!R`E1ZA@f=ЄF1=T5f*R11[CZ,@c"@f"RR-c1`-Tc@B2r@#!RR?c=1+T=@R%B5"@#f$R! R`1CTa @!xv1CT#f$"@"RR`1TC>fRR1ZRBp"@4@41$Tca@LTcD =!xb1"Tc @=cxuf\1!T"@`@s1 T#cc@* Rdv1`T"@*` 1T=BR"@a Rf`1`T=R"@!Rf`1 T"@* !xbz1T=BR"@a R#f$`1T=BR"@R#f$`w1Td @=xc!f"`\1@T="R"@R#f$`c1T=*"@AR#f$`Y1T=R"@!R#f$`O1TCw"@4@41@Ta@rfc.{ASBEGcFRa@ETa33!@1ETs3@`~@^[C`@qTfc5fc4Ӳ1 TCX4"@#f$"RRеF@ _1@T CfC@7o7Ѡ/ҥ"@f RA>1T=R"@ Rf`1TCa@! @ T !xb1T="R"@!R#f$`1TC"@`o7Ѡ/@[CҠCҠ[C@!FF@T= =!=CN@ N=c 2$ @ FF1=PT[Cfc`.FR@T@ 7!E5! SLqA T"@@@@+qQBz TQqTAg*`&@b҃ R1T@c@@_1TR@B| 4h") 6+@R!E?@"@cҡTSA[BcCkD{Ȩ_a! 4c7D`4 qA T"@@A@@?q!Q BzHTq!TA@9Ra7a@a 6""@q!ECb`?@#@TSA[BkD*cC{ȨQA!F?@ T+@W R q@Tq Tq T"@@!@@?q`T RRqT4 47 R qTqW R~TqTqAT"@AqT@"@@_q T!@97Ra6A)ҥF*ej7R<@ RR?q!a7n7@T4WR qTqwR"@Aa! K4c@8CRRyw Rw+@Q"@qTAg*R`Bc@7cc#+@7ccC./wqTAT`@1T`<@"5` R7RFG!@F)#RAi7R3+@`ۀRM{@SBE[D@7bT@"6#@BE!T" @_TӺ3@cA;ՠE.@? h`0@ @T@RҠF #!T@ 6a@!1 T@!1@Tڼ 7@ 6cCkT3@ {ҧ{BES!FC@/ңcFCT@BFE?B(E$D$B!T`@1TE/@@BTSA{ƨ_`|FB|D?$B TBE?TB`@@7t;_AT`9qT`ХХ>c B $-R{ @c@bV@bp6_7!;T 9?q Tp6_!@ @{è_`@bV@`?@bV@   9?qMT_q`{C;E.@?{`h`p{Sa@@!1T@7!RSA{¨_a@ @ 5{!ES[ck@"@?37Fs47@X_@A5;@ @@T"@@B1T"x:@5E?@@B!T[BSAcCkD{Ȩ_x:G!@;@4F"@_T!@;  {Sk?|?| A[ ~ӓ @@RqTs!!@@kTB@_qmTC @Ra`a7!B@_kLT@@RqT99C?c31RB@ A[h`6@qT`"`B$b7`Qq T(@8\A)z1@T @Rbab`*@1Tb*@@`*7R`@B|!h"6(@@8\)? kmT|7X`6[BcCsE3@&@ @ضz`cCsE3@@@@`@ @@@`@ @@@`AR@!7[BSAkD{Ǩ_RB@_qMTssEG[BcF{ S!`X@c`@`?@@`` SA{¨_pG{ @(@?qT!QR @!|#_ TAha?qT@?"|b$7!LQ?qT $7`@1TR @{¨_a@?1@T@_1T  a @c@b ` b  {ES )?K@@Ҧe1@NTk@Z a(@?qT` @@BQ_q)T?qT(@BQ_qT?qTP@@BQ_qIT? qTx@BQ_q T?q T@BQ_qT?q-T@ BQ_qT?qMT@BQ_qT?qT`R@Qq)TB_k!T c@# 6]6[cs:@ @A92@9BTZF@? <_7 љ @+@ 5{` ?qmNT@RRb6;*c ihbCQq T_ qT_qTC|cc$7_XqTU{kT4b6 hbCQqiT_ qT_qTC|cc$7_Xq@TU{k Tb6 hbCQqT_ q`T_qTC|cc$#y7_XqTU{*b6 hbCQqT_ qT_qTC|cc$#7_XqTU;kKT?qT!QR!|"@Tha!RLqAz1T0q2Tq0T@A907 @@A92@9T4@'҄@? (@qT @R F@qHT|`$.7LQ߼qhT$ƚ.7!B?k!T@%j@G 1Ts@s@f@? (@$@g?q-T#RRR @R q0TqT?kT@"*Z|q*T@sk`*q*T`~ `$-7`Qq)-T_kT@"ck`qTq Tq .TTqcTT?kT@&@9;@9C?"5R:RL @+@?1'TqMT@R$!aTQR"|@Thb_qTA|!a!$A%7@q-TQR!#!@?Lq$Zz#T?0qL!T?qT!Qa'?@@4 1Ts@s@@ !Ra:BT)@@?R(R " բ_ J@AA9D(@!2A9 C @qTQ!|' Taha?Lq$Hz*T?0q&T?q *TAA9 7A9@!A9q&TTS@`+8@!4@!;@43@a:@4a@F!@("8@5?(#@qT!?!TQR"|T!#qT`Qq(T@@qTB @ @k_1*4B @@TZKGqTpqT k+TR (R;;R?kT| bkb_qDHzDCzAT#qTR$qlT R(_kTB"ckb LqTHqTqMTqAT?@* RGO G@@O@ (@_kJTR @B|!cFihkb!TQ_qTA! qc@$@c@`k!_#k!!@6(@ RQ!@" $6@G@BW@@?#T{QqT`QkTD!`@[BcCkDsE[ck`  Tc@)*qT_kJTR#@ ck`!Q?qhT@| @҆+@?1TqT@_qT@ @_k Ttq!TR@o @7 $@@(@B2@@qATB @ @k_1*@4B @@@T; R#R R@ $@ b(@ck Xv#@)qTq AzT $@ ?`TR@A96BF@D@BT@@?y!Q?qTAA9}7A9@!A9B @'A@?qHT#|cc$#7#xqT?qTB_ATT!Q!%6 A @#A9C7#8@Bc#8T s@h@_l1T?@@@ 5}`?T" RB}І_;R%RRc*@qTa@c  "@_qDEzDDz T!?!Ts@3?~T@@T?-T3@@`T@{3s? T@ @T@{3s?T@@T@{3s?-T@@T@{3s?MT@@T@{3s?mT@@T@{3s?TRA{a?`TA{3s|@? T?wT҈@@4qT=@"{s@@?kTs@A Úas"!B{"?!Ta@!T@s@ :s@{@?T _! {A9Bx9-{@T _! {A9Bx9"{@CZTA@`@@@vaA9!2a9T*@@?R)R "_ C@AA9D(@!2A9MG @qTQ!|  Tha?Lq$Iz T?0q, T?qL TaA9a 7aA9!2a9A @  #@qTb|bB$7!?TT@n`A97`@ A9A[7@ZZC?RI9T_";@!A98+@!2!9 @*;;@J4qT"@ 5C@qhUTa|Aa!$S7B_T!QA%6 !Q?qT " @CA9c7CA9c2C9@@qTB @ @k_1*4B @@렱TZK RC @bA9U7+C@ O5qfG@C @``A92`9@+@{k }T:_@'`@v @q֢Z@@k֢! @!@k֢@@k֢ @!@k֢@@@k֢ @!@k֢@@k֢a @!@k֢@@k֢@?R@*@q TQ@|68!h`?qT |`$ 6@;@:+@*@4_k-GTb|Aha!6)(@R $R"`*@aAqMTQ|#% T h`LqDz@T0qTqlTb*@a@_qT@Q|#?T h`LQqT )@7& | hg6_klT@&Q%6s@*@A?R)R "(@@q-TQ @!|'KT@@&%7CA-A@` n@n nq` TA0@,&)7DF- NB<@ n`n@nq TAX@,&,*7DK- NBd@ n`n@n qTA@,&17DP- NB@ n`n@nqMTA@,&37DU- NB@ n`n@nqTA@,&57DZ- NB@ n`n@nqTA@,&77D_- NBA n`n@nq-TCRa@-& 77d@- Nb @ n`n@nc kT Հ(@qTQ|'_ T@h`LqIzT0q TqT8@qT @@C7Aha?qhT |`$6` @8@?qaT @@6?q`TT!K RR R*Bs+*?kTCBq?T$qTj=5 R(@*}*7 @v`kzq!7T**GO xG@*O@@7 R@* l+Qc @q .T*OW_ xO@*W@_@@@@@6(@i`A9by7#{`A92`9( }@GOX{ G@O@@?kmT?@O@BW@ O@{@H! @W@c K@CO ;7GO@@ @{@_2T?@C @! @`T`TT T T`TT#@ T"#xbTB#xb TB#xbTB#xb TB#xbTB#xb TB_ T#xb`TB#xbTB#xb@T #xbT #xb@T#xbT#xb@T#xbT_ Tw_"DT+?@ST.5+HS@{@@@7!!A  $@?kT|`k!(@ R+)?+; @A9B29| *4 @A9B29v`A92`9y @A9B29s @A9B29uU?@* RCO@ϫ*a@C@O@@261 T q @$@R@ k! T(@ R RCh oQ?QTf"@B"@B``@@?1`/T~\`7R R@|!adh 9"? A9+@!29a@xq--TAQRs@# ,"@B{"@B @A9B29 @A9B29 @A9B29! @A929$?GTaA9a 7aA9!2a9_ TI?GT R@h (@Rc@N!R@| amk`kqq *dNz&Tc@ *4-@jTkT)R m _ kT $@`@b@ @`"@b@ @ (@QZI? CT?ATx?qTqA!RAzATR@o @_ kT?q` T" Q_qT b R $@(@@O!RqOzT@7kMzT)  }~ @I@@?kmTx!!@]**RZ?k)[cks}T R_kTA@?qTA@ @!Q!|~ ha h!cB Rl R ?kTxa_kDA:T!Ras!6GOB@G@QO@ *4c-{QJk#C|~hc_1T h#{@@7!a[BcCkDsEA9@!A9 Ru@zRhCkD@} = =kDQ|@/  RK(@kTH @| !@?qmTigq TT<q`T(qaT!Q![BcCkDsE $@(@! |o@'h%_klT!A8 RH(@ R:!aA&C@O@@c*@ } Ը<[BcCkDsEa {Q@$@ X5 $@(@RZK+S+HS@@@7!!G 6B@!Q!zqAT!Q!|}ha@T i'h!oqT~{a@B~ @!@C!aa_!@?`@6 @{¨!A@!@ ?@_ {@A9Bx9 @"A9Bx"9 @A9Bx9 @"A9Bx"9`@A9Bx9 @"A9Bx"9`@A9Bx9"@ A9x 9@@AA9!xA9@"RA9B!x9@`A|}7bBF@H@?`{_bBF@H@? <  ?qT!QR!|"Tha R?Lq$@zT?0qLT"Q @"?q$šR_!Q?q'_ R_R_ {S(@qTsQR[@s~ TjsQQ_xqT?q!߷䗟!(šRjT[BSA{Ĩ_R?qHTv @@*@*qDzTR[B@ $@j3s1T[B R@R[BR?q T!QR!|"`Tha !LQ?q(4R_R_ (@qT @}@R  %@*$@$qTkTBc!T(_@(@l4 m} k-T @ im @%qT kT_kT R @e$%'@qGzTB!T*Q*k-T%0@kT6$@$R(_k1aT@(@@qT @R( $' b@ d@qlTb@!Ě_qT_qT_qTT_qTn_<qT_(q`TcT@QR|#d @_TBhc'R_LqDGz`T_0qT_qTBQ'@"$šB6 $`T"ic_qT@?C|c$@7_BQ_q)T@"TA9B7"@RG 'D|#A9B29 @@Thf_qT@?C|c$6 @@@ `T@A9C7 @ #@A92@9_D@$@TDA9J7$@ *DA92D9$TcT$@@"@TA97"@C #@A9!29_Rb {H;i)ES E.@?#=$@'=+=/=3=7=;=?="@?i``TC++@t@47 )c@`-~@7!сA`E?@@BAT@SA{Ө_7)z{D;eES[U@cA@G/E. ?֘h``@_"T@ X6@dj` @A T`@@0@@6Ҽl`EG@@BA TSA[BcC{ɨ_`@T@X6@dj`d @T`@0@ 6c$ґAb@`T'_lTB}3?x'@i@c#қz?֥c"Ҁ?BW}*'@/@"' x'@RiTb @c$929m|b @+o{S*sa@R`>"@ <"A@@<"@ <bA@@<"@ <A@@<A"@ <A@@< <!@;TRa>@jT6;@ ;@t>RT[c8 B?Ak9 _@7(@<@q- T @Rj *So@)R**wk T kqhT`~`$7`zq`Tq@Tq`QAzTsNQqhT'ӚS7ZT7@@<@qd@z-T;@C<"T[BcCkD;@SA*sE{Ȩ_;@`T _9 @7(@<@q,T**"R*2 A@k@"<@_qBzmT <!*"R*! A@k@"<@_qBz TR?qT;@4R w`D**!%@.[BcCkD{*S*qTЄ[`8kT*4****!|Sq T5[BKSA{è_q,TRq,TqT_qxScxqT_qqTQ qZ?qK[B[B R **_q, T_qT_ q T_q T_<qT" 7!" š@R_T*A_ T__lqTBpQ!҃" š_aTd_Ta_T__Dq@TT_`qT_Xq T@R_BQ_HqhT!@'!Hb8bA!  R_BQ!R" š_T*!a_!T_@RZ_BQ_ qT!'!Hb8bA! __q T_q-TR__q,TDQ!*! Ě?!TR?T_|q@RZ_@R_dqT_hq _֠@_Z__q _`R__q!xS _B_րR_BA! B C! _ _ qAR_q,THqT q TlqTT!҂<Ң  T*_PQqhTB)BH`8`"@q T4q TQ#Ď$b š_AT$q_ T!R*q TqTQ"#@ TR*AR*xQqHTB`*BH`8`"@Q#҄b š_@T!!*aÀAZ*8Q"҃\@ aTcATg!Z*qTTQ qT R_q`Tq!Z**c _T,qZ*AT7*4qTR*aR*!* |! *|  ` {b(@_qTa @$@Q q T(q@ T_qT$(@Q qT(q T_qT$P@Q q)T(q T_ qT$x@Q qT(q T_qT$@Q q)T(q T_qT$@Q qT(q T_qT$@Q q)T(q`T_qT!`R%@Q qiT(q@T!kTc@f@{_֤ Ѐ$@  Ѐ$@ _֤ Ѐ$@ ( Ѐ$@ < Ѐ$@ P Ѐ$@ d Ѐ$@ x Р$@ R$PR$R$(R$R$R$xR$R%{S@@kA9[xcs9"@ A9x 9"@@AA9!xA9@A9Bx9 @"A9Bx"9@@A9Bx9 @"A9Bx"9@A9Bx9a @"A9Bx"9A9!x9@B?9@4A9*@!29q-TsQR@s~!`Tjs?qT"|bB$6@A9B?q$T?q'T!Q?<q'T Xa4'@ @TF@@&7R R@|""&h ED_ "@8 @j3cӁA939KAk J@ R *@ B@q T @)& ˠ6A%@)?kןa8?kԀ?qՌ k ?qT-|m!%A7J TA%@)N?kןa8?k-|Ԁ?qՌ k ?qTm!%a7A)@@?k-|ןa8?kԀ?qՌ k ?qTm!%!7ʡ AT@q5[BcCkDsERSA{Ȩ_H@"@?RR'R RI)@?qTA @ -@qh`8ԀkןkՌ ?qT (-,@qh`8ԀkןkՌ  ? q T P-T@qh`8ԀkןkՌ  ? q`T x-|@qh`8ԀkןkՌ  ?qT -@qh`8ԀkןkՌ  ?qT Ȁ-@qh`8ԀkןkՌ  ?q T -@qh`8ԀkןkՌ  ?qT!`R/@,qhl8ՌkןkՎ   kAT* @!@@ik! K!Љ?kן?k)Չ?qՌ! k1aA @!@@ik! K!ЉA?kן?k)Չ?qՌ! k1?KAJ@ _qR Rj3A @!@@ik! K!ЉA?kן?k)Չ?qՌ! k1R"4_qR Rj3@[BcCkDsE1@{k(@SA@[c+/_ "@ !(@ "A@@B(@ "@ !(@ A@@B(@ A"@ !(@ A@@B(@ "@ !(@ bA@@B(@ "(@ !@ xBwbRU @t@*CR1 T`@a @kT  4c@kT " c@_kJT "c@_kT "c@_k T "c@_kjT "b@kT 4b@kT`@ 5A+@?qMTu"RRA+@9?k*TF@%4҃ Rhq @zaTDK<qlTek,T~ S* *!`29a@`*@`* 9`*@`*RSA[B{Ĩ_֟q"Bz(T_qT!(a *!`29a@`*@`* 9a@`*@`* 9u`*@`*Rcl29c@a*@`@c!a*ka!$TxS#RqhT 9Kd@`*@a a*!q T!8a@`*@!`* q( T!R9B$Rc@`*@c `*` _qT9u`*@ `*R!`?u1T`@?@a*cQc6cp29`*@`*RK2qhT#R|Sc28qhTKcCB|Sc2#8_qhT$K~S!2a8qhTv9!R K d@ e*@ `*` qIT~S!2a8qhTaK!kA:Tc*9b@`*@B`*@ 9a*@u! Ra*Ic*9a@`*@`* 9a@`*@`* 9v`*@`*R4{[@@T@e!@T @S?T @AT"D TawF!@*f@Z@T\T J 5 Ҁ ?9@SAR[B{Ĩ_wFl!1!T`7g@`?@,@SA7`𡃁R/ZR@7!@SAZˡ/SA9"/@!ҁ_9@ @@&{hE====#='=+=/=  @@@T@6D@`TcR)֗a!E@"@caT{Ψ_o$@T@6_d@T`!R@R?k,T?kT??qT?qT@!@"*a"$8_@B`*@D2Rf#d9@#\R@c*c2R%8@#DL@c*c2R%8@#,F@c*c2R%8{S @I@xb@7BbTRSA@{è_ց@`4F?AT@@@!1@T@7!a@T_ _  {  @T @{¨_a @`4` {S@V@(p6_[cbc_@@c~@@b@`_@??!TB;`E.`?Wh`w@bqT`?!T@@T@@T@j@@j@4@%k6@AT @@@T @@@T @@@@T @@ @@@TV@ 7@`@V@t@p6C;`E. ?a_bB`h`!@V@@h@e@!c?bH6H6?kDSA[BcC{ŨV@@'6x^ 6`@AD@-T"{t@@р6,TbBF@9@D@BT@!@?V@t@w7V@O7?ր@7рkDCcA@!@ ?D@T@? Toh@@TkDMhnh@@ T~Dq@qTa_`@!@[BcC`sSA{Ũ_ց@1@@7!ei 7hj@a j@ @ \?`@LTkXj@j@`@h@u@@@D?`@LTk@@@?Tu@V@H6V@`H7 ?֠@7Ѡ[BcC@a7@ ?`@ T[c[BSAcC{Ũօ@%k@kSA[BcC{Ũk `@@h@{S4@ BT@7`@SA{ƨ_"T@3"6B;`E.`?!@@h`!Ң@! @a[@ATt@͋`@Te@7BтbSA[B{ƨ`@ @As@3[ca`k_JTa@`@+{@?mTa@!1@Ta3Z9C+@SA@{ƨ`%AvRSA[BcC{ƨ@AvR`%}@a@EeC+T@7cCkDdcCkD@A"7[ @{StF a@Z@j@@?u@Z@j@@?ֵSA@{è__u@@?U{S<@ TbsH҂&ʀ@5|ܤ` Tʀ@5|֤ Tʀ2@5|ФTʀF@5|ʤ Tʀ@5|Ĥ`TʅFFi| Giʈ @|`|@| |ʥ|ʥ| Tkj`i"R Chc8?qT?q@TBa85a8@9!#c8!|cAʄ |@%|lT@ SA{è_@*c"!lH@9bb8!| Bʄ |@| $LTV@@!hb8V@@!hc8?qT  {S[v 5BBFA3, Xa@7!aa@D@ T@T@6@65SA[B{è_[A!DB;`E.`?!@Uh`@4A!DB;`E.`?!@Sh``4|CcDa @!=`@w@7`T٥@Da!@>@e!aC@7`:@ 4@!8@R_@ RB_ @_ `@B4@B@b^q{I{_{S*@BT@6"@cBT@"6[6@@ҕ T! @ @?aT@T@@?! T T@@ TT@@ TTkb+c`{yA{y T9?ATkD+@  qATT[BcC@FSA{ƨ_ qMTqTT[BcC@E 4Tq` TTBRtqT[BcCTkBRhqTTk9?KTkDBR]qKTTkYBRUqKTTky qTqT9 *SA[B@ @cCkD{ƨxBR>q T!T+@kDkDkD+@@DTcC@DT{[S@ck ^@aTt @s@t^@`T`@@V@?TH6t`V@ H6kDcC[BSA{Ǩ@`@V@?T/T7xA7@`5RSA[BcCkD{Ǩ_7 6857@V@7?7@@4+77@T@ @{@qT@ @j`7?7@5Zs@ +@t^@T7@@@?4+@  {[@"T@B 6^67A@T!/STzs?@5@s TSA@R[B{Ĩ_@!@ ?TV@@5sTzs@T@!w6_Ѡ6sT@[B{Ĩ@ ?@5SA@ {S@STF s @F@V@@?s @@7!ASA@{è{SA!E`@"@g`@q \T4Y@F+T@hD@YT@F?T@E`0T@F0Tb:@[_q-YT`@X@?T @!@0_!0T@!!ԊAxa @ T`A4 @CTaAR9~@'`@[BQ`@Eg@@B!-TSA{ͨ_ց@CcE?`T@FRR?@#T@E?@7T@T@`V9T@8T@3 @T@.T@)T@$`T"@T&@ TbҀzuaT[B`A@_TaaR*9 @{@ VTh[B@?@!TRa(T@`@R*@9l@D?PT@ E? ST@ECcD?$C T@(E?ETYt@VbA_ UT@`` R*@964:1>.B+2(@@2@6@:@>@B@F F@@@@7[B&bA_ T@` R@9R{@A5_TbA_ T@` R*V9[B_554T@` R*@9@r6Tr @ut[BbA_5T@`R@9bA_=T@` R@9@?`@[ckshc;bA?A8T_6T@`2U9@{@,4Ty4ks47@a:@&s7@@@7!32@h99#ʮ15T@xt@7!ҩt 4b@@7Ѡ v[BcCkDsEbA_/T@`R@9ya:@bA?qTT@` R*@9 @g[Bi!t`4a@@ R*"b 9L*R[BX!nt@4b@C_T!ft4b@@`R*@9{@ ,To!Ut 4b@!Ot4`@ARb9@aA @?AT!@t 4a@!:t4b@"aB!8`&a:@bA?qT@?@T_T@`R*@9 @s@6[B_T@`R*@9!t4b@!t4b@@!Ra 6[BcCkDsE!s4b@  [B!s4b@]`T@` R*@9 @[B!s4b@bA_T@`R@9bA_ T@`` R@9!s 4b@@R` @g!Ҹs4b@a:@bA?qT@T@` R*@9^ff[B@Da!`@[B R` }@`7рfT@`2U9<[Be!{s 4b@!us4b@WT@` R*@9U!hs 4b@!bs@4b@@N!Zs4b@Pj`4cRچb@4`@_T!Gs4b@@`R@9`@!R[BQcCa)!!7s@4b@L[B`RcC` @aRa 6*_ T@`2U9?b!s4b@!s4b@~!s4b@bA_T!s4b@@`` R*@9 @{@ T`@!R[BQa)bAcks_T@``R*@97 4;@2?@/!r4b@!r@4b@S[B`R` bA_T@`2U9*!r4b@!Һr 4a@`R*"b 9[BcCkDsEe T@xu`@_T@``R*@9?@G@q/[BcCt!Ҋr4b@ @Tkjih"R Յhe8_q@T_qTDb85"b8"h%8b84d?$x_qTd?$x_q`Td ?$x_ qTR ?%xkTBc d|@T_b"$h%8Bd85cd|@T_ T@@Bhe8_qT@Bhd8 T@ {S ATa9`ATaH9`ATaP9`ATaX9SA{¨_!r4`@!r4`@Xa9! r`4a@P"b 9!r@4a@H"b 9 @@`x`@_AT_@ _  _  {@ @SB@a@!˟blTc`@`SA@{è_ցq 4`@_Tc@SA@!{èg{S@ @@[V֚FcB;#s)TAxs@5@ @_ T`@"6@ &@_TF@V@@?֕@s(T[BcC#@ @&@ ?ց&@SA{ƨ@?@@ @?!T`@!6@&@?TF@V@@?y@9@b @_T@?B@/B@@?/@ ?!@!@ ?/@?/@ @/@?/@@ ?ԋBBE{A@' [@cSp@!TRR)#@4sa@* 6qTT@7Ѡ SA[BcC@EA!E'@"@cT{Ũ_@FT#@3`@#7``Њ@7ѠR@SA[BcC@F?S[cd@7ѠSA[BcC!a@hD@ 4"SA[BcC  {Sa! #r_+@3`@1`T`Qq@Da! @Ed#@J @#@@c@<(T@ !@B|?(TRA!F#_w@w?TU_T`T JTE{@@"!}cKa{¨_ ,`{RSsA!D!T@[d@@4@V4@6 @@[BSA{èSA{è_ @[BSA{è!!`@"Ё@B`.SA[B{è@cT@7@D_"@BT@b6_ { RSsA!D?TSA{¨_SAc{¨c! R!c  @BT@"6"@BT@6@_<T#@<T@c@%@B@! !|!|?(TRA!F#_w@w?TRs@D_  {S[ @@b TTb աzs"@CB6s!TWV@H6@7SA[B@{Ĩ_#!@s!@ ?ATSA[B@{Ĩg  {"@S@E@@T@6`@5R?T@E@@BTSA*@{Ĩ_ׅ*`45RA!F!#T@`@AT@@7Ѡ/%^@T@6**a! 5m4A!F!S@*S*a@7!a!  {D;[@E.?SEEh`@@'#p#@4`@@T@X6@dj`D?a@7!a@E'@@B!T[BSA@{Ũ_`@"T@_7C@Da@a6] @A!E_q@F _@?qT@BA!F!E{@@D@4a! {_a!   {W;S[@E.?j`T@` T!@ @!@_T&@ Q&?qT@%@ѡ @@@?@E.@?j`@$@@$SA[B@{Ũ_ @@@ T @_@T`T@_TT@_T T`exe_TaT'`'@ 6@_T &@Q&qT!%''@47@D!!`@6`@7``Ұ@|E_`T{SA!E@#@/A0@!@ATE@T` @TcRDFa@9!!" haB1TA!E/@"@cҡTSA{ƨ_A!G_TC#i`7g @#@MT+@T`D@->@ Ts7 @!"B@T_T_T_ T_@T_T_Tbjt89#@bjt88#@bjt88#@bjt88#@bjt88#@bjt88#@bjt88#@?Tbjt8b8#@bjt89d#@bjt8b9#@bjt8b9#@bjt8b 9#@bjt8b9#@bjt8b9#@bjt8b9#@?T@tT`ڰ@nI\ؕ` @cT@!a@^b@ |F_T`@1@T`@RT DaB @! @IFh!D@@!1AT__ _qaT D!!F@!1T__ qT!!D @1@T D__@Cd@c{BRS`?@!!DT*a@7!aqTT!!E @1@T ESA{¨_ D݁!!F @1@T F  {G,@y{_ { *{|S_ {7,@y7{_0@9  {+,@y{B_ {#,@y7{_4@9  {,@y{,K_ {[S @BRT@xtc@c1@Tcg|*b@Cb7cC4SA*[B@{Ĩ_Rr54@{SylM@6SA{¨_֋B"Y@7р`N{S5`@,@A;@E.`?4h`&@Q&q T@?ց&@!&@ T@6SA{¨_$D# @@B`g`@7``!@5a@!,@ ?SA{¨ @`8SA@{¨`g  {S@[ck@rPTrTSTq! TKR Iҕ6@94q@%TT$Qq`T@94q@TH T$QqLKT@9s4q@TT$QqL JTsT` J@ R@SrITr TsǢq T@9h38 4R!qSA[BcCkD{ƨ_ֿpq T TqTqTCT#sTpqTiTqTqHTBT#ҳqTqT|qTqTq@T|qTpqTTq`Tq()T#҈q'Tq(T|q(TSTRR`  ҬLCyLCsqT qa%T@?yx3xy5 T$ҟqTjf8pqZz T$qT(qT4qTq_ziTq Tq!Th$8 T| R*o Rl qaTx$x qTzfxpqZz!T R*Z* W#6#&RZR qTJR +I $Qq  -Ts T@y4q TiTpq` T TqTqT qTq@T|q`*)4** ##*_)_@4?k! #*_)_@4?k! #* R|S @ qHT%GR @chk8@chm8_B@ R* RQzfdx$L*JG R* R|SK@ @ cic8 C@che86 R* CR, l hGR K)zf4qT(T$Qq0`1_KTsaTjs RR.E- B*_W)_@4?k#! 9x3Y5*_J)_@4?k!  +'pq TTqTqT @*_/)_@4?k!  ҾqTҹqB00q`TqTq01 ң ҟk @| S,HәRkhT%ХGR @chl8@chs8@chk8 @chm8RkB@Bu*JG R|SP@ @$jc8lXP@jc8\TO@LPic8C@che8C@chl8C@chs8 C@(chk8 C@chm8V@ Ga! @ڿ@' @BT@"6"@BT@6@_<T#@<T@c@%@B@! !|!|?(TR!!F#_w@w?TSR; | D_  { @T@ 6 Ei`@?1TD; E.@?"_ch`3 c@ @B@ch@d@B#?` @{¨_C; E.@?"_3 ch`@ᕁR/ {a@B~  @!@C!aa_!@?@7! @{¨}{#cES[cd@/W @xb`Tzs`{3sx#cFdbRa@_T!1x"!ZB`5@@?@W@T(!!E/@"@cTSA[BcC{ƨ_֖W@7Ѡ``@7`a@`7Ѡ}}'o'@c@l@>,7!`Bl@B,7!A @U @b!T @0@ab!@TE5a!1QJ`EA6E`@v"@"qT`@26B7` `B````B#`B'`-`2`7`;SsB;``` ` `B``B``B!`'`-`2`>SsB?`` ` `B```` `$`(`,`B0`6`>SдsB`Bѱ`B`B ` ```` `'`,`4`=SsB`Bї`B`` `B```'`8`?ssB ```%}`4{`9y`>svsBs`q`o`" m`B k`i`.g`7e`?sbsB`_`]` [`Y`W`U`S`!Q`%O`)M`.K`9sHsB`E` C`A`?`B%=`-;`79`B<6sB`3` 1`B/`-`+`"")`B%'`B+%`B/#`3!`7sB`B`B`B ````` `$ `( `.`B8sB#`B``` `B%`*`0`5`<sB'```B ````B+`4`:sB+``` `````" `#`B'`*`.`3`7sB/`` `B```B``'`+`/`4`8ФsB3`ѡ``` `B````!`'`B+`/`3`B6`9`>sB7``}`{`y`w`u`s` q`B$o`(m`,k`0i`"4g`B7e`:c`>`sB;`]`B[`Y` W` U`S`Q`B"O`B*M`0K`4I`9G`=DsB?`A`B?`B=`B;`&9`+7`.5`B23`61`>.sB`+`)` '`%`B#`-!`5`8sB```B` ``B`$ `) `- `1`5`B:sB `!`(`7`:sB`B`` ``B``B&`/`B3`B7`;`?sB`B`B`` ` ```B``$`-`0`B7`=sB`ѽ``B`` `````B`B `B$`'`,`0`B4`7`;`"?sB`ѕ```` ``````#`'`*}`/{`3y`6w`;u`b?rsB`o`m`k` i`"g`e`#c`7a`;^sB#`[`Y`bW`U`" S`BQ`BO`M`BK`I`#G`'E`+C`/A`2?`6=`:;`?38sB'`5`"3`B1`B /`-`+`)`'`%%`+#`/!`3`8`=3sB+``B`` ``B `B ` `B$`(w0`+`B4`8`;3sB/```` `B`B`B `B$`B(`3`6`":`=3sB3``b`` `B `````B `%`)`B-`0`4`8`"<`B?SsB7`Ѵ`B`B` ``B`B```#`'`+`B.`B2`"6`9`=SsB;`ѐ``B``B `B```` ~`#|`'z`+x`/v`B3t`6r`:p`>SmsB?`Bj` h`f`d`b```"^`B)\`,Z`0X`4V`9T`>sQsBN`L`B J` H`F`BD`B`@`B">`&<`+:`/8`B56`:s3sB`0`.`",` *` (`&`$`"` `B%`*`.`1`5`B9`sB`B``` ``"`b``w `B$`B)`-`B1`5`8`=sB`&`)`-`2`6`<sB`B``````B` `B%`*`B0`5`9}`=zsB`Bw`u`s` q`Bo`m`k`$i`)g`,e`B5c`<`sB#`]`B [`Y`W`!U`&S`B*Q`-O`3M`B7K`;HsB'`BE`C`.A`9>sB+`;`B9`B 7`5`$3`40sB/`B-` +` )`B'`%`!#`&!`B/`5`:`>sB3``` `` ` `0 `?sB7`` ```B*`.`;sB;`B``B ` `B`B`%`B;sB?`````"`B&`)`-`1`4`>sB``` ````B `%`*`-`1`4`9`B>sB`Bѫ``B` `B`B```#`B(`-`2`:`=АsB `э`B```B ````B }`%{`(y`,w`B0u`4s`7q`=nsB`k`i` g`Be`c`"a`B_`]`![`B%Y`)VsB`BS`Q`O`(M`/K`5HsB` E`C`BA`B#?`-=`B4;`89`<6sB`3` 1`/`-`!+`%)`B)'`B4%`7#`B< sB` ```(`,`?3sB#`` ` ` ``B``` `"$`B'`b*`-`B3`B?3sB'``` ````"`%`)`B9`B=3sB+`B``B`B`B `B``B`#`'`B-`B1`7`=3sB/`ѹ``` ``B``3`6`?SsB3````B!`B*`-`0`4`7`B<`?SsB7`ы```B ` C" @!@4B7!@  Aa"!0a'aa".@#A@ ? @"@AV@7!AdpwBB3a|s!hwATSi =c# _4\#YzssѕaTAnAsBBsb T`@ @7!@sb!@ ?!TbAk3C## @t 04'@@qT q@ T@7AK@ TS`@7``o@+TB@S`d AsQ````B`5!Rm O` 7@/W7?@s+W?F I+TKbmOW@@Y{EW/@@BTSA[BcC{ƨ_ִIxtupO@"x`A@!1@TA@ATA6o^oToJo@o6o,o @ `@ @ 7!a oiKE^@VV`11I`@a @Gw@VT {R@S#?k (T`b@`'5cwRB)kk!&Tb$7`@ab@tB)gA#5-7"`@Rbk`!Tab@ 5t@tjab@`@A5[6Rs 6ak`T`b@ 5`B)kTa@!`!@?0qT`@tQ`l`@ab@Q`[BsEwA5z-Rռ `b@w5o-b@cCAQkDaSA{Ǩ_ 7a@`@!`!@?0q!T `V-@a@ Q` T{<at@kT`b@5`B)k Ta@!`!@?0qT`:-a@<t@ Q`{9ak`T`b@@5`B)kTa@!`!@?0qATȼ7a@`@!`!@?0qT`7a@`@!`!@?0qT` -a@t@ Q`{<|bt@`@;x<]tb@5a@) ҟ-T ա@{`$x ~@LTlb@RBQb=ab@5`@a@%7@tC)iUf@*g@**!R[BsEb@Xb@AQ@sE[BP`b@4,[B RcCkDsE`bGQ`/ R`b`@ab@Q`'`@Q`#ab@a@cC!QkD-a@ RcC!QkD`b%`@wB)ga@!Qk R`b R`b`b@4Dw`@a@%[C)`@f@*g@**!R[Bb@a@[B!QcCkDsE!Raba@cC!QkD!Rabtb@AQ[B RcCkD`b  {S @@@!p@ ?ր[ @cT?TR`@"!F Ta@`@!1Tat@v@w7! @7р `_ [BcCSA{ƨ_k^R+||@~}Ӛ5brw 9w9[[+@ @a@kD ?T@Bh [BcC ҂~ +@+@w Ybr+|^ә:R+ g~Җ@7 [BcCkDҩ+@NmLmZB@a@?!T`@1@T``@@t@v6@7@7[BcC{*Z[BcCvm[BcCkDomm[BcCf  @A@7!AaR_{lR{_@_ "@BT@B6{B-! !@{_{S@!E[c##@7_q-0T@(5`@@C<@!0TT@* @-7d@,@1T @`rA9`4u*@U`bA905b6@R`fA9q@r@T @a@?T0_cDC@/D@T@1@T9@7р!J T`F@` @!D_ Tԋ 7@7р(a@`J@uJJ T* 5`N@d@TR!F#!E7@"@c TSA[BcC#@{Ǩ_ ^5v| ~@h}@}Y5`psvv5V`rA9 @5 U} @VW` @bF@"Pa@`FQ@7`F@a@tFI74d@FCA+%`@!7!"lF %}av5v|`pu^59R@?9@7ѠT@@T@6 @a@\DaB @!@@7р@vk$RART!F!c BB*@7!сUafA9`bA9?qqb6@d@FBc`>@>lB`N@@N7!!k'`bA9RafA9?q4$RҡRw@ 6k @a@Da!%@F(CA+~@7!a{k( ~r*@7!ѡamkqTATd@bb@a@@!@ԬDA!@̬DA! @Ĭ!F}_Jku[FkCk$RART`fA97Rqm`fA9q @!@#@_ T!BR!@9cF!!" bhaB1!T_"@ b7@ {k{__bh!_ {_S@"_A@c~@!@b!Aa_!@?@@ 7!@!@ ?ց@ ?ր@7рSA{¨_@`SA{¨j  "Q_@qTBB@'#|~A!!yhaAhx?1aT_{A6R {_a__kHTYD{a@!8"{_ {@S!T@a6@`@S`_`@rTrT`SA@{Ĩ_`RAdC5@@!RaDa!=@@Be@ҟ`@b@aD!=B @@ {T@H6@A{_DaB @! >@uDaB @!>@l {[TKSc@kcs @):TvV@`^~)`@y9C9A@?8q=T.@>T@G@e {`@@,qTa!+!X`x`! `@f@@T)7T_8 @+ +j@?'G I@Rxgx R` @y`x @yj$GzBT@9@+c@?B@RG Rx`x  `x`x@@yjGz!J!5c^@@.@cc^2Tw[BSAcCkDsE{Ǩ_`@T_8(q!T.@@TA@@Z#xaT@9@@?kAT.@TA@@Z#xa`@`5c^@`@`4A@`?L6TB @A3xN @dV@A@h5?4T@@@{`qKTcK`N@ &@zjHT@@A[`?@q@.T@@@?k,T`Z@xNTdV@(@B@cc^ R)`@B A@Z EA@6@R ``@k?T|}bR@k>TaX!.@TA@@Z#xa*@4`@ 5`@35c^@4xe)T@93r*@{~3@ 4T@Z .@aTAG@@xa`N@`b@ &@zj:T@@94@@@q8T4qiT`K|ZTdV@Z`@c*@bRc^: $)5@@a*?@ "Tx5@@@{`q@T`N@`b@ &@z*Tc^@@ @1T`Z@|ITdV@B@c*@@Rc^$)B `@C@" 5Z  T@9@3~3@@4T@Z .@TAG@@xaҌT`aKbb@ !x`b?i~TdV@B@c*@Rc^$)B `@C@" 5Z `b@0@aK@Bx$_T@_@%뤨A:aT@T`N@& 7}MTdV@aR@@aKcc^!?-TdV@@@h#aK@`@c c^@!?I*TdV@@c*@BR@c^$)Z3: 5<c37vV@c^@c@cc^~)*TR  Ф WdV@!Q?<qTbBP,BXaxa""@A`b@@c @@`NA@4`@!T@@Z .@T@44MA`b@tN` 4?c^@`b@`@ 7` `^3@{` A@@ TT@9 @kT`Z@x ]TdV@B@c*@Rc^E@ @absc^@@ @@a@@ab@T`@A\ c^@c c^4@74` `^@t7`Jc4˔~}!?c^@cc^ @@`N@aZ@@|@! @`b?XTdV@`@c*@bRc^` @Tc^@i7TdV@@c*@"R@c^ (`@Z3: ",5lA`b@@ @`N@@Z _A`b@T@1 @A3|"`N, TdV@Thuc^@h5xb7`R@Ba"B|}?_h#c bR@T@9@ @?kAT9cK;`K}cTdV@aR@m?`^@`^ `Z@}RTaR@_?c^@cc^`@T*@4`@@4` @Tn|@47dV@c^@T`b@}4F^|@47`@dV@@Tc^@R|@7dV@c^@TG|@T7dV@c^@TA@ 7 ` `^@@A @`@_@!$A:T@T`N@aK& "7}(TdV@aR@>aK`@cc^!ڂ?) TaV@B cc^!@P@Z3: 5|@A|܂A@x@~Ӛ .@ Tkte@Zxaa6 @x`NT@Z .@`TAG@e@xa`R@4a4˔~}>`^@`^ 4g@@@@?JT`KT@ caV@Z3L@!c^`@: 5NҲ|@7`@c^@A@~Ӛ .@aTۑ@5kte@Zxa|@t7dV@c^@ ToZҋ|@ԍ7c^@҄|@7dV@c^@`T!@@a@xS?k-TcR@.bb``_B@ATT@Z 533@5AG@@xa]|@7dV@c^@TA`b@@6*@@6 @`NT@Z .@@*TAG@e@xa"7`R@Ba"B|}>r`R@a4˔~} >`^@`^3&3@|@7dV@c^@T;T@9@3{5K@@}TB @A3x3{}A@3@?`V@h5{T@@T @{`q@mT.@nT@AG@xa@@j6 @@`N`@b@xT)T_8?qTG?|qa@zT@9_qTG_|qb@z!J`@b@@tTi'T_8?q'TG?|qa@z"&T@9_q%TG_|qb@z?kw4RR!J@@\@c^@c c^4v@A`b@ab`@6 @@z`N@ @@_@ A:alT @lT`Z@"i TdV@@@h#aK@`@c c^@!? TdV@@c*@R@c^$)Z3: 5b7`R@Ba"B|}9=c^@U|@g7dV@c^@@T`R@a4˔~}%=c^@cc^3w3@f44!3q3@g44`@tTc^@ -|@b7dV@c^@`T1"|@`7dV@c^@|@_7dV@`@c^@3G3@5AG@@xa|@]7dV@c^@Tfc^@A3eO)4|@Z7dV@c^@TbT@Z .@TAG@@xa`@a@ VTT<_8@_8F|qxbx@zT3<@@9@93@_|qxax@zk@Y4R`@g@QThTRTRk@W4R_8*|q@z`@?TQTc^@s`@PT@9(qPTc^@k@9?(qAT~RR@9*˛|q@z)KT@9@@3g3@`J5.@ TA@@Z#xaHT@9@?qTB4GAa83]y3@`\5c^@:FT@9@@?k!T2`@a@ETTB<_8@_8F|qxbx@zbT35<@@9@93@_|qxax@zJAB4)RAT@9A33@U5c^@B@T@97Xg*@9cTgc@7@?k>TT.@T3J3@u5A@@Z#xaRJ@@a@xS?k;TaR@#b `C@:T4GT9T@9?qHTa8@9_qHTb8_k8T@@a@xS?k7TaR@8b4`X@6T"T"6T@97{*@9c{c@7@k4T)4T@93{A@3@?kT2T@9@@3g3@51T@9qT!4G `8A@?kaTI0T@93{A@3@?k!Tz /T@9(q.T.@TAG@@xaTh,T@9qT!4G `8A@?k`T\I+T@9@@33@@5Sx@aK@Bx$_*TTdV@@c*@R@c^ (`@Z3: ",5`Kx T@ caV@ZT@@@a@xS?k#TbR@Aa@`?A@"TbTb"T@9@9k!T`N@ @`b& _q@T!?TdV@`@c*@Rc^\}TdV@aR@:aKcc^|@47dV@c^@T|@7dV@c^@T|@t7c^@|@7dV@c^@T|@?@ 5T}a@@@?TTaK` IT caV@Z#@ a@@@?냏T`N@aK`bb@& _@z *T!?T caV@Z#X@ҫ|@7c^@Ҥ|@7dV@c^@.Tn`R@Ba"B|}u:c^@`@롒T*@4`@4` @Tc^@4|c33@ 4*@4`@5`@@4` @&TdV@A@? HTh5*`@a%T`K}CTdV@aR@?:c^@cc^#Y|@7dV@c^@T@@a@xS?kTaR@8b4`X@aTc^@$T@Z .@ zTAG@@xa4A @@Z3xa3a3@4AG@@xa&<}HTdV@aR@9aKcc^[|@t7dV@c^@T|@7c^@N{SK!?T?4 #aV@tTFB@*P@D@aTAsM@Ra SA{¨_}K`?R{S T TFSA{è_! @@!!9a`@@1@T`F@@1@T@@A@(D҆!f@! Ě Ě.`| T@<A"=rAc? TIP@ i`ˀ)yh )! Ě Ě?T@ o=DA!@@7рҬ8a   {[ TS_@ Ta T@@`? T`_BЃ_T`@t`j#T`_BД_T`@`j4MT`ҖAT`@`j6T`ҔT`@`j4T 9TSA[B{Ĩ_9V8lT8A@9[B{Ĩ^=8@T_  {[@S@@ T@1 TMTcИbRҠ@  @@!p@?T @@#@D% _*T @ @1T{s{3s@A6TcC_ [BSA{Ĩ_ ?@7р *@5cC !`"@ 7B"B|`9[`c`T@  @@!p@ ?z3sf`cCshD@4sjD3 T@  @@!p@ ? ss@`4LMLTDA!c@cA!SA[BcC{ĨJ@7!DA!c@cA!` {!ES@#@_qT@!5`@|9@B<@_aTW @E@@BҡTSA{è_ր@6`N@`vA9`~99D!! @UDA!%@MFA`@@T@7DAB @!`-@@7рҾ_@Na7!_р _  {`@c!ES[kB<@#@7@_"TT@a!@!!7 73t>@ @ @uB@1@T@r`Tr`T`Bӄb"@cSajA9`nA9c` YyB T9@7!сA E7@@BҁT[BSAcCkD{Ǩ_րdBajA9b"@cS`nA993@+TSJ@ x~ 7@ @7Ѡ T@7р `>@>_+@BwkqTT`>@>~_B`N@ F@ _1TҔ_,TC~@7`@7`F@7`^+8 @N7!^5>_<_:_n+@^v ~` 7@7Ѡ @bxN@ @7!ѡA @$T+@/^pMe*@7!сa^qTTD!!@!F^|^҉Iҙp^s+TBҍ@7Ѡ``^+@҂Z^| cc={cE;ЄE[abSE.@?ֶh`@'-f`7@4Cca@7!aE'@@BT[BSA{Ũ_8^AДD {Ss|@[cqT4AR9@SA[BcC{Ǩ_Ӛ4 q!T`@y(qiTcT` ӚT`@a4qT qT@?4q T@@s[@r TW@@9 TkzZ뚂? T*3k=k@3@Z T<*j Tc7j|87@kc@`T!@9?4qTT?(qT?4qT@9 Ӛ?(qT@y?4qTT?(qT?4qT@yiT?(qT?4qT@ Ӛr@BW*= sE Ӛs*=kDsE ӚkDsE}T kD ӚsE_  {@c@k @S% @DDQyqTTR7Tx@ T7@BB,[BX`x`"@?I T7 6R@9:RbD@_$qTT4_ q!T`@*@44?T[BSAcCkD{Ǩ_T_@qT`@kTc"_XqT`@kbTc2_Tq`T_(qT`"@9*d"!R! @ EӀx`?jTc@E"`xb?jTcZRZ5[B` @kTz5 @q TBT@9(qaT˴3@T@9*L`@5 @qhT"T@9kT3@T@9*6`4T@9kT"@!4GT@9qHT `8_kT3@T@9tkT_qT+{@kT` @kT+@5f*tkTa @kTc2+@K"@!4GT@9qHT `8_kTZR:3@T@9tkAT DqiTR_{ *A!.!H`8`! *ɓ~q@z @{¨_qT|GHs8qq(T|GHs8* @{¨m* @{¨q T RqTGs CqTGs~BqTR*g*q*qq(TG~qs@zqHTG~qs@zqT"4@~qXsx@z*)q4@~qXsx@zq(TGsBӖ** @{¨*R~q@zGs} CӃ{SkdAT @[c8q T8A)` 4!?@ TqTQ@5u x787"R]@qT@xr@T3/Ts RNIST[BcC3@SAkD{Ȩ_[BcCa@9p*R4 0@Ns!T[BcC3@@ 6srB)*_TTsE[BcC _l Tҁx`?q T_aT`H; T r@9@TTT `TT TT`@8kT`@8k`T`@8kT`@8kT`@8k@T`@8kT`@8kT#`@8kT@@9SkT@@9S kT@ @9SkT@@9SkT@@9SkT@@9SkT?T`@9skT?T5ҟxu`@9!kTj{s?T[BcCsEiA ҵecR_T ?X7?@[BcCsER@q(T3/T`@9kTs?aT[BcCsE3@;s/?ITN` 43@[B cCsE+ RT3/8cCҕ [BRZsN[BcCsE3@{S5@ba@@!1!T@7!&@@LT!F @1aTR&SA@{è_zZa@&7!ApZ a@@ @@5{_ "_A@c~$@!@b!Aa_!@?@&6oa@ @{¨!@$@`!A?Z { $@@&6 @{¨o!A,Z  { $@@&6 @{¨o!AZ  CE{CS[c@Gd) T_`CTW@!T`V@H6`A@@lEO````````2=@?#T|طBF@H@?`R /Z&c@J@5?qT6 7@?6Ж g@?!Иc )VB|@@c1"`b T@wv1 T_ V;E. ?ւ_Bj`B@A! @h@@B ?R@7!сA E E @!F1`Tu @1ATE.@?j`bB@@ch@d@aa_!@!c?b7ѠEG@@B!T{ASB[CcDC_x g@c)V!|@@`!c1`ҡT ՠ@wv1T_ e&c`"B*dR93@6;Y5DA!?@`R@VR`@`S@7р $YDAb@!>@6@} DA!@7@GDAb@! >@"e@R`fR%RXy@T@@/b/@/w@/@7!! T T@@b@w@7!с!TXl X/Nl/@X/@@t @u 1T .X@{SE D@`@1@T`@S1TA;E.`?C_!h`c@@@!@!h@$@T cA ? SA{¨_ր  {S@@E.`?A;CT@5h` X6@@j`d Ҁ?q `@!T` @@@ 7!@!@ ?`@@ 6@7р@ BRSq`4lT@SA{è_hD@4` @@ 7р`@ @7!4@@!@ ?@`@XtXҒ`hD@t4t @!AW`@ {@F;SE.`?h` @H6&@@u@Q&qT%@ @(7`@?ց&@!&SA@{Ũ_ր&@@Q&qT!%'C'@@4Ҡ?ց&@!&a @{S T@[ H6 A a@tb@a 5 @!Ra /V@`ZbBF@D@BT@@?֟V @`a @@ !`qTA;E.@? h`0@a @[B SA{è_ւ @a@_@[BSAqT[BSAFDA! @ƘSA[BDC" @a>@f@} DC" @a >@\@SAAD! @ҽ{_S[@ab_` @B~@@A `_@?#@`@a6V@֚FF@V@@?֟VF@R@ V@@?֟R` @@ 7!A@ ?֠@7ѠSA[B{è_!@!@ ?`@ `QVSA[B{èV@A@7!AaR_{VR{_{a@B~ @!@C!aa_!@?@7!`@@7!! @{¨i@!@ ?@!@ ?{BES[cFA@/BC&q-T+@]@*A6q TTn|ϝ|Ґa@7!a@7рrVB;E. ?֡@@h`0@7!ѡ@!@ ?F!E/@"@cҡTSA[BcC{ƨ_@ 7!ѡa4ϝ#Pa@#@68V 5#@`@7`@@@7Ѡ(V$VD!@Ҿ#0!ѡV  {S"![c @)k,T@@QhqT ՠ"k`*C:l7`@ 6&kB/l`7`@7`*k@B!l7`@6.kBl@7`@7`@[BQcCSA{Ĩ_A!1!X`x`! r@ b@_! TҬ[ `V@ p6C;E. ?ց_B`h`!@@h@d@!?b@S`@1TCk1T`@6 @!F @1T Ck1T`@7``}UA&@c@ @Bk1T`@7`@@B@?`@!QV V[BcCA~@4.Ck1T`@7` @#`Crk1T`@7`i@@CUQ`U=U/` UTD! @wF=Un@~`@"C6k1 T`@7`* @*@??J*T @"xbq-T-T q.T 0T$q0TA@B1@Tb@@x!!Av~@c@ @B6"Ah~`a`@1T`+!F @1T``TT?BM~ @ q T,Tq .TӚA`@1@T`JCj1T`@7`@+ @uNCB@+~@i "Cj1`T`@7`)@Y JCj1`T`@7` Q@HzC B`@1T`@}@@6Cj1T`@7` @%rBtj1T`@7`@^CA}@VBWj1@T`@7` @rB{TSSA}@@C1j1T`@7`` @ CU^@} @q`TӢA`@1@T`JCj1T`@7`@ @c@ C4@`@1T`@`}@@C Bi1T`@7`  @C @CSҡ> VCi1`T`@7``@c@ BxSuS@@B1 T qTq!T.A@B1T@@B1 T6A@B1`TqTA@B1`T@@B1T{qTA@B1Ts@@B1Tm@@B1 TgB`@1T`.S+S @e@`@1@T`!S @<S@|@BSi1T`@7` @c = Bu6@| @C4i1T`@7``# @Fs`@1@T`jB i1`T`@7`@V BE*Bw| @Aq|`@CMAe|^@`|@@Ch1T`@7`@ phBh1 T`@7`@~Bf@4|@r@Bh1T`@7` @c@ VBh1 T`@7` @cCVR&B{ @l~A{`@Fs`@1@T`BA{@(Cwh1@T`@7` @CFA{@YRRRR @ R:@{ @BDh1T`@7` @C3h1T`@7`@>@{ @A{QQCQvQQQ@  b{kY@S[c<@ ?T @TT T@S}Bhs?` @Z`h3@S}Bhs? @Z`h3?`T բ@SBxz?"@bx:z@Bxs?@bx3@Bxz?@bx:z @Bxz?@`x:z?T[BSAcCkD{Ũ_֢@Bhz?֠@`h::Ұ@7р`TQ`<{!Ec"@g|@G @$R[CB|-eaR_9r 7X5k#s# S3R7G94G@1T@1T57@BҋP 7 'Q*a@7!aa@!@ ?\ 7BtP 7 Q*a@7!aa@!@ ?|7@C@6@?R7р P4R9Zr7 HSA[BkDsE!Eg@"@cҡTcC{ͨ_Eg@@B@TS[ks*PSAkDsEң +C@bQ?@`Q[BmTEg@@BҡTcC@{ͨ;VcC@{ͨ;V{SO[QFf @ T@}dh`T? T`_@T?`T_T$? T^TџT`xdaT[B Ro|[BSA{è_Rc@^;QLT 7@7?P[B  {A;E.@? 3h``:@ @{¨_F=`:`>`:@{ 8@ @{¨_4=`:`,`:@q{@STKj `(҇L 6b@9_4qTTB$QB_q€䀌Tc _! T?q@aTRRxY@?r`T?r!C RC$849mTa@9cG?pqh$Tz RT ?$qT?(qT?4qT$Qxq) TIy$D! @c@Bhd8D8@ha8 9 Ta@9?pq$TzT RD$89MB$QB_q€䀌,Tb@9c_4q TTB$QB_q€䀌Tc_ Tb@9_4qTT_pq`T TBQB_|qҢ0$_pq@TTBQB_|qҢ0$_q@T_q` TBQB_|q"11_qT_qTBQB_|q"11B9c!TT9SA@{è_BDBD_pqTT_qT_qTBQB_|q"11RRByKRByˍRBy$Қ$҉nTRF$ҏ$~! ?T R7R`4  & " @1GA!;@wҪ{!Ec@"@GW S[#j|@ Cb @$RR9_BB?ip`7MT@b# N 7b@B7Bba@!@ ?`TB?N7 {tx8)T9T!R7p 7ءE!EG@"@caTSA[BcC#@{ɨ_9!!~ORk@T@5@q !TBBA`QBqR@!H8EzTH8Tc@`q R@A@z!T#5?(q`T"R1Ts@`@{ @S?qTrTrTu@9q T{R@q@T@1@T*R=`T@@kTND1@T@@`q*s`@6C@`@A6G@`@6BFO@@D@BT@@?E@@BT{A*SB[CcDkEsF_`a@!@ ?!@!@ ?!@!@ ?b'D!!<@Վ#@BF TE@@BT{A[CSBB`@@9v`@9sD!!=@y1T@5b@F_ TC4~@@ RE1T9{4˔~@O?qTJ+*BrTra`@:`@@7BE@C@ T{ARSBBR[CA?TK5@5flTT*1q<R"D!!>@L<*ӳ*DD!!?@>.S`G!!@ @4$q*a@7!aa@!@ ? cks&{SBE[!@ck7SG@73?r@T?r@TyԢR) 0?MT`qTj`8?q T?q Tjs8?qH T?qH TRRqTje8_q T!!$š 7_q`T53@-TqTja8qTqRcR!j`TR3`/|@1TETqaTj`8_q#T_|qTTj`8_q(T_q#T3@˿'TTqa+Tj`80 @@5 R!E7@"@caTSA[BcCkD{Ǩ_?xqaTe *`r'R3_T#R?xqTeRˁ3Tje8_qT!Rˁ 3Tje8 qTzexqT!!$7zex qTz`x?qT?q(Tzsxj?xqTzsxf q!TzaxqT3? TzexqaT!Rˁ 3T q@Tze[zeqhT!!$!63?TzeqTzeJz`?qT?qhTzs4za?xqTzs.R)@ R32?TqT qTzsx qTz`x_q T_|q T @4DA!@RV TN0@qTqiTbQ!! š"@Ba? T!D @A!R8^%z`_q@T_|q`TTz`_q`Tz` 3`Tz`_|qAT4qT!DdQ @xqiTA!``R 3`Tz`x_|qTTz`x_q`Tz`x @_|qTz`x 3Tj`8_|qTZ|@1T/@DA!@@/R R 3 TqTj`8_q!Ty|qT R R @|q!To**!PҘ@AD!C @@`@`7`JR @_|q`T qATz`x qTz`x0 qTz`x_qTz`xz`_qTz`z`0  {S@@'S?rT?r TjTq! Ths8d @+ !@?Gӄx`x !xdx @!R(@y7dSA{¨_$0@9i_ -TqThi8h A+ !@?Gy`x` x`x@ @y7 R0@9DRs @R_TqThs8i )A+ *A?!G!yaxA yax!(@y6(0@9𒩙!!|ɛ A,Ts_TqTxix |Sa !@+ A?!xkx y`xqTxsx|Sa !@+ Є@?!xfx x`xqTxsx*|Sh A+! )A?yjx! !yaxxik)TRxsk TRxs?kTRD!!@?@TRwBE{C@?(q`TC"R1 T @!E@"@cT{¨_Cҥv#{`7[@T@66S @c*k*+@C?@qTRh:T A|@!!ӠbQRK !" q!T z4 Y 9RUS7@#S"Sq4T44?r8Tt bQR(Ңzd R RB ÚE ?$q( T!cK8cxѥ$Ӛ +Te T/4BqA.T$RR#8"8 ,TSAR[BcCkD+@{Ǩ_k T  $qHT8cK$Ӛ )T cK(q$Ӛb1B "8 'T4?qsRsTz4x @q TR?1 +TF @!@$@"@CSqTc"5&@R8\zdB ÚE ?$q)T!\8 @qT!A!?mT@R9 T @`Q  q Ta~@5 @qT!A!LTe@R94Bq!T"q RB R!R99!A!?*TXQb!R R Rze Ěxc) K?)qc$Ӛg1 8_-Tkǟ5TqT#5!@!$ѴR"Z4Bq T"q RA RB R?) TR"Y @ /#5!@!$R"xz4Bq T"q RA RBRxx TR"xy_r"!!_r"!!Qb#R R Rzg! ƚxi K?)qh1$Ӛ Tkǟ4RQb#R R Rzg! ƚxi K?)qh1$Ӛ y_TkǟH4Rh55TѿTR895`_r&"[BaR ;kǟb4k TR89D R"q RRB$#8"8@cqT5@!?5@!X?r!!5G!!@sSA[BcCkD+@tRA@33@?r!!1  5F0@bwB1AT@B_#B1aTCcc@R"_{ *qTTq T|QqhTR`@ R@"@ _@@Tq@T   R @{è_@b7"_B1T@b!@" 7` @]@ 4 @ RR+@ *@"@ _@TфE{CS[#[F @/ ҆59Ҡ@~d&qTq`T_q@ T@Ҕ_T@e*@SҎ`@T@@W@!!_kB ?Tc Aa@$dc@a@e@b"@c!!!!E/@"@cT{ASB[C#@_!@@!@?rT!S?q` T?q T_kB *Ҥ@?T@_qT(T_q@Tb@a@c @@$c@k !b9 Ҕ@`_q!R@@9~@td&qT_qRR!B_qRB c Aa_qRB R_kB "Ab!a  уE{CS[c@WO @[@@@9aSv4qTac?!ğ%PЁ񄠟~EW@@BT{ASB[CcD_RS@95ksw )s{*6{ӁkePЛc CKa @MT G)C@ 3ˁji84?qaTa?!ğ%PӁ񄠟,kEsF*{{È {ӄe'Pӛ{˟񄠟X`@ TkEsF)**'H( Gs {#@@q@ T{Ĩ_S[cf!@R@!a@ca@d6SA[BcC{Ĩ_a@@!a@CS_rT_rTqTSA[BcCR{Ĩa"@qTq@TR%T DR%T $x!@@!aR*6a@@!Ra@rATSq@TqRRR{CS!@[ck*@s@@`@Td@b @bd&@c@@ @e*@ T`&@ 5@c@Cd@$d"@Db@bR{ASB[CcDkEsF_@@*?\a@@`@B?@aT@c@9*?C@?@B@*@\a@@R@@ҵ[aC@@@[@a"@c@9G@*Tkk@*#kc8qTCc@D!!`@5@@@[4Gc@@*T?Dk@*kc8C?@c@@@b @@*@[` @@B^ {_@y{ C_ {W@y{F_ { B@7E`@5E @{¨WG  {A;E.@? h`{_  {SҟTs}fTsb@R'!`SA{¨_Ҟ`8  {R@S*!k`T`@5[w@`b@w`5vB)kT`@v@qT@v[Ba@!QaSA{Ĩ_e7`@axa@qTwa@[B!Q@`b@4a@!Q Rv`ba@[B!Q@{R@S*!k`T`@5[w@@*`b@w`5vB)kT`@v@XqT@v[Ba@!QaSA{Ĩ_7`@axa@XqTwa@[B!Q@~`b@4a@!Q Rv`ba@[B!Q@ {R@S#[?kT`b@`5u@ ?cwb@5`B)?k Ta@!`!@?0qTa@uT]AcCa@!Q[BaSA{Ũ_`|uB)*k Ta@!`!@?0qT6ҡ@}j`"h ~@7T`ak[cu@X*6a@kTa@!`!@?0q`TkD`D _T`@z8*}@7`@x 7`@ZA}-cl7`@@ R`ba@cC!QkDs@ R`ba@cC!Q R`by6 R`ba@!Q}a@!Qya@cC!QtkD  {R@S#[?k`T`b@ 5u@Q>`b@ 5+ cw@* b w@* #b x@wҙ*?`Tx@z76w`b@ 5a@8 MT@@T@@ T@ @`TaR`Ң@}!j`Ch |@!,Te@cCa@!Q[BaSA{Ũ_uY@a@!Qx#@Vw9!}ubcC#@#@?@ R`bJa@cC!QcC3@ R`b?a@cC!Qm R`b5a@!Q  {R@S#[?kT`b@5v@ҩ=@tb@5cZ*x@T* +b x@I* kb z@xҙ:*?Tz@z85a@x@!}Ӕjah!~@4,T?cC`@Q`SA[B{Ũ_a@vu? R`b`@cCQa@zekDlTU9!}a  R`b`@Q`@QkDD@_ >!!>?T!pEa_ >!!>!"A !ABEb_ { `BG9@5hEEi R`B9 @{¨_     գcE{|@$R`@c#'!E@"@caT{Ĩ_֩{   #= =` XGa?| !@*`c=`ZbŒ<@ @{¨_{!ES#"@G#c@K@?qT5EG@@BҁTSA{ɨ 7!EG@"@Tj`@ *SA{ɨ_C{SE@Y`@5`@5c @@@4 @_t@T5 t@5`|B @tEA@BҡT{@SAC_"@@t@  {6R  /o= #`*hGa2`aa=d ``Zb‹A 5RS[ksAA u5RB !@/SS@ 5 R?Ca!!S> 4S@!084dЄ3S ?| ?@!R* @=!`/4dЄ3@R7!0SS@@@5#6~+A@7/A7D@qT?@5t7A?A!RE@+G@q/S#cdc 5|;RC @@SA[BkDsE3@@R7@GS a`!5_| %R_@* b`B 6?|#RA  S#cd@c| @4CSAkD@@SAkDGA@5@RGS#cdc1|;RC -6S "R?|a!7C gkA!1|@5;A@7qdAzTs?A1Tk ToqTlC6 R7 R;"@ @_  {Sx#W@SA{è_ {a!- !F" {_ ՠF _{SEc @@/@ 4@}[I#+Ҡ7 @u}huKDs h5B'@lTT[BD~~E/@@BҡTSAcC{ƨ_[#@#@T`1![B!_|!@#RB [B @b?|B1#RB @# 6`@8{ERcE Ra@|@@5!E@"@cҁT @{è_֠Sc5{SsFc[aK?qT`"J1T`"J@5SAcC[B*{Ũ*ONO@`" OO@qTqTASA*[BcC{Ũ_OO@SAcC[B{Ũ2R(T~ӌ"Rb@9*B4B87s!#8R?!є!!BRC 5"ts˓`8!  բBE{C@gR ! S1 5R@944`.@c@AB =#! =a@`4s"R"9TsqT@RSA!Eg@"@c!T{ͨ_a!`7 5SSA RSA R@{ХES[ck@?ҟqTqAT9RqT T`~!` dTVR@!E?@"@cTSA[BcCkD{Ȩ_sR!T~s! ;7R7@?hT_" _q"DzT4`@8 @BRsEsEAT!vs`8sE s{ AT @{¨_֠Tbza!C qBDz)T {ES[@O_1@T 1@Tc&1@Td*uB4`.cuBkS"!@1 R``@WqA:VzATcCkD`"@qK TT`&@7`*@`7!/\`&@a!`9~~~EO@@BTSA[B{ʨ_qT&&q T$qT`qT!@n{@4@@ccCkD!/*`&@a! 9L`*@`6*ck R`* R`" R`."{Sa@?T ~SA{¨_xt {c@S[ TSA[BcC{Ĩ_`@RxvBV`5zx4`5_{{_@95  @9B"4G)5GR|@qyf@z`T?jaT_ T#if8R8@85 R9_@8'R5 R_T8_!TR_{+cwFS[@k5Дb.b@T6x`@?q`T$@4! 14!`1`4!1`4"bvq T*q@T*2@q T*SA[BcCkD+@{ƨ_@5`.`@T"!{aa`b@5 R!@1a`L4Eba!;@ REba! <@ R`L 4cE`B@;!c@ R@4sBR`@@`44`L4cE`9!c@`.@4`@aE!@:"@B_ Ra @@1`a4B`.A`@ T`@${ad!A` Rb} Rbz`@x@@ 4cE a!:_`@n Rl{SjTs~ j@SA{è_  @q_{5`<R'@! Gq{_@94R  {!ES"@/@;@5,;@5@@!F4;@5@~~E/@@BҁTSA{ƨ_@@`bB3RSC|C @cCkD@C {{?3RkDC@cC  @SR_|C ?C`"R1SkD @3Rs@cC S{C|{c=CS!b!B|*Cs?C{@`$ERbؓRcrr|Sh!8!?`aT SМ{C{>|C3RC A;ՠE.@? h`7@c@ @S4@cCKW$E|М{#{?|3RBGМ{cC|#{?3RB;C3@35A 5cC|B*@4@*cCK  { 0 =`"XG #G| R` `j`cbZaŒ<` @{¨_{S!E["@/=@a"@2@`= @c` Ac =` =@`:@J@e:d"cJ;@5@ab;@5@a;@5@aB;@5j@`j``7`7B`B`7`7@2Aa"`2;@5@aB;@5@ab;@5@a;@5@a;@5@ax;@ 5@aq;@@5@aj;@` 5E6=*@baB`6=@c];@ 5.@abV;@ 5v@aO;@ 5z@aH;@ 5@Aa"`?;@5@aB8;@ 5@ab1;@@5~@a*;@`5AA`cb@`t`7 AA~~a `E/@@BҡTSA[B{ƨ_PbB1?|#RB @  { 0@2`@`@`@```B`}`@2{`@x`@u`@r`@o`@l`@i`@f`*@c*`.@`.`v@]v`z@Zz`@W`@T`@Q`~@N~` @{¨H{S!E@#@'Ң[@}#`@ xsy`z3s@?T'C[BR!E'@"@cTSA{Ũ_[[B{BEksKA@@`5`@qT`;@`C@`Ta`7C /Ssk@c2347qTa`7FC;a.1bk@a@)c@_1@TW?1@T[1@T_1@Ts7@CsAWA[A_A9AQ+As{5#yC[O43Ay5A@`AAa`C85`k@  7q Tg@aH?MT@Р`.SG"R"`@1 `HS@?1?@,T@5a@`.`@a;a@!;aC@?MTbG@!`:Sx``4`@ `<`@8`@8`.5`@ AQ+AS5`C@JTcG@u W @7`@`@@`IS` AGQ+A5` @CC5Р?@`@`5MSA5LSA5`@5NSA5uSA5 SSR_| ` _@/G@SC@?@S@+@@5Р@wL| @\65!:l`#@"7` @a! `4!`<3` @a! .! =-`'@!7`+@"7` A7`3@!OacbcB@SAUkA+5`A 4@+AAQ5a@`#@m5@7`'@@7`+@7`@7`+@;@vCKm5@l5SA r5`/@ acB7SA@p5`w@ @m`{@@?` @a!`A`w@aSA?5`{@;@K@5R  !  5B7aSA@<5aC@?- T`@`aB9AQ+A 5`@7`k@qaT@R`k[BSR| 7@;;O@9;@SA cC@@K@E@@BTkDsE{ۨ_`{@@`/@@q`Tq@TqiT R\R&-*CC?S| @/+d#^'^A!`7 4 5B8`B@1kA@SAU4@[B*@ R `8` @a!!@? ` A@6R` a*!!;` R`#` @a! l! > j` @a!@S`h!>`g! !X`x`! ֠`. `@ `7S[c? RE ,5SA q@zT` `@@`@D1R3Rj`@@. ~R@b"0 G`w3d!!SR R_|O3K@jgi 5SA q@zT` q4D@@Ed R`/aa#*bB; aC*bB 6 a*bB@ 1 a*bB , G@*bB & @5C@*bB  @ 5?@*bB  @5` @a! D ` @a! ? `#@acbc B (SAUkA` 5`@accbc B SAUkA5`@acbc@ B SAUkA5a@` @6a! ` @a!| @ R`a!` @4 BRI @@B@9_qAITS BcB c |0C %R@*RSo@+ R`K R`;!Ra`q@fSA`5@@*[BU@kADaccSA 4U*@kA+[B@@0 AR 8@95@94`w@ `{@\S3R`R?| A!1+/[B@@ R IT `3S !D!1|0C R@ RSo@`w@`{@@94`w@``{@v`accSAV4@*UkA`{@ @TaccSAY4@*UkAaccSA4v@[BSKA@@#O#OSD1| RK@B B1#R?|@`G@!@1@$ y5`@1T` @1T`@1T`@1T`@1T`@1@T`@1T`@1T`@1 T`A1@ T`@1 T`@1@ T`@1 T`@1!sTTF@q`@@K@Z R`7E@`G@q` F@`@E@`DF@`D@`E@`,F@`F@`F@q`F@q`D@q`G@q`6 R`#BSABSA&SD"1| R3R@/CC?accSA5`{@`w@@UkA`SU@kAZqTa!`S RCSRC?SS@| @/! R`k=qB 64B4dSAv4SU@kAB9$dSAr4cbcB[3ASKA5[@uo:?S_ BC@k@SA@UkAS5?@S@ "[BX??@@?@?@dSAs5@Q@UkA|~D`@`!`K`  R`+f@4SR) 5SA7`'rf5SA7`'!R*`'Sd!!`  R``@`RS)RSR,8 BRc*c` DR;)@R@suBR` *Cc` @@Rl`8 !9?@v ?@4!9p ?@@5a?h3A?@SKAN4@CC?G@?B@c@SA@?@kAUL4@[`@`W`@`SQO!99 ?@@4cE!@@c@?S\R*m ?@C RC(@1SAM4@CUCkA? R`  R`_`4[SA ~4 R`+DK`@`  BE{RC@|E@@BaT{¨_){BES[A@7ҁ@?T~~E7@@BҡTSA[B{Ǩ_ @#@BxuAK@@a5@`{!ES@"@@?qTD@7@@@~@~~~E@@BҁTSA{è_aB B1?|#RBc`b   {RcESd@/T@_R E/@@BҁTSA{ƨ_@@@?qR{cES[*cd@/aZ#''@w TF*1Tqqq@zTq@zTTT.q`T R5!E/@"@cTSA[BcC{ƨ_*1 Tqqq @zT R4@ q`DzxS@qTR@q@@qqq @zaT!R*1 Tqqq@zT@qqq@zaTs5 R@ _ւBE{ RC@cn 5ACR7!E @@"@caT{è_   {ХES`@G*T @T@Bs|9@5R!E@"@cҡTSA{è_֠6GA!`@1n@4   c,{c!ES@"@' 4!@[R4q@T@_@R`hT~ӷs~~cRj3h4[BR!E'`"@cT{@ SAcCc,_[B[B@_@ R[F{c@{¨_ c,˂BE{S@@k@@?TVuEH@BT{@SA @c,_ e @Cs Ú@`"_B  {v`5{_{@   {ЄES[҂@?ҿT~~E?@@BҡTSA[B{Ȩ_bxuc'`[@C'@b5@` {S[@cTaҁV@@!}/@# y}T@j9#@~V~SA[BcC{Ũ_B@ B1?|#RB  #B}ӛB@ B`  {ЄE @@'5}?}E'@@B!T @{Ũ_B@@9b4IW  { sF`"J1T`"J @{¨_`"  ՃcF{BEcKS[D@7#5/#@E7@@BTSA[B@{Ǩ_B B1?|#RB   Ձ!E{R"@@9a4CDR!q @BE @"@cAT{¨_րE@@B@T{¨|  {SbcE[*B@d@W)`@'`@.`@,`@*`@(`A7A?qLTt5B!`@"~~EW@@Bҡ TSA[B{˨_A;ՀE.@?c h``/k/0A!t>`17 @7 2 ˅ J7@(E?6TBAB!24A! R@14WA!@04A!/4W-A! .4A! -4BAB@!`,4A!~ ,4A!bR`+4A! R*4A!`l)4A!ƶ )4A!R`(4A! R'4A!`R&4A!"Rڶ &4BFA! =@%5BFA!`=`$5A!Қ#4sA!b@"4A+B4{#`@z-$a@=`7b@7Bb%{B4_q"b-!a@=7@7@#BFA!=76M!.=7M@7!a)S `@`%6^"7@7р #cCkD+@ck+R `T!`O 5 R@c#C@O@5cC@c#7@O@A5cC@`c#B*@O@5cC@`c#@O@5cC@`c#B@O@a5cC@`c#"@O@5cCsB1@@k?@@O@cC!`59A"R!|B t@#!R_ @#1!RkD_  @7   ) @7  @7р`(((h`@7`(+@@7@7р@}#!R@7 +@((L)@7р@#`!R({((@7р @`ҧ}#!RkD_+@ c@ }@7р@# !R(cCkD+@(`((+@( {SE[b@@7_1TE` @1T!Gq `@1T!F `@1T!@E a@?1TDF`@1TBD@`@1TBE@`@1TB,F@`@1TBF@`A1TBFq@b@_1TF_q`@1TcDq``@1TcGq``@1TcTFq``@#R 5Fd@d5`B@c:@Rb@ b>@ F`*RES7~~E7@@BTSA[B{Ǩ_B44LF"R@D"R@LFBR@DBR@EBR@`@B B1?|#RB {cE b@*E@@BҁT @{è_֎^'@*7`@kTa R*'{ ss`A5 R``E @ {¨CBcB A" @{¨_  { shA 5)RE-GFCBA !`!c!B! ` @@{¨_{)E=C=#='=+=/=3=7=$@/'C+ )@ !E/@"@caT{Ѩ_ {wS?hT`@`ts8SA{Ĩ_ S@ _{ES[*@ҟkTTk c.@4c*Rs|5*c{TcCkDsER!E@"@cTSA[B{Ш_#5@qAzT,qTqTV49R4cCkDsE7*57@9c.cCsE?v4sF`A 6@R$*7aAA 7vA*BT` ˵TkDR*w44D@cCkDsEcCsE@R$s*7**T@qT*kD@?LqiTkDT˵T*kDDA! "@}c;`A/*4cC`O`5=`v<(`7dGA!"@gkDZ*PkDUlFA!@#@NkDKcks#;@`@?!T?@`@?TvAcC6l  {SsB4sBa@5 RSA{¨_Rs"}}_ {SEa@@/}}E/@@BҁTSA{ƨ_R`R2`@@B` B@$?|#RA {C;E. ?cAxh`!%SZ 7[sF!R`@v@w@`waB!H@atY`@[BSAcC{Ĩ_J ҡ- `JҁТ!0`@Q sBsJ@`T [BԾ[B`@z= [B[B!lFBB%!@f`@j-   {)E=C=#='=+=/=3=7=$@/'C+ )@ !E/@"@caT{Ѩ_8E{@OS@42@[EAISA[BR!EO@"@cT{ʨ_cx2@2b@@9@5~v2@E@`?`7@W5SAR`@ 9@T@ 7 5@7!aS[cksN%L%J%H%F%SA[BcC$AI7+IJ`k #9Fs9`.@`.$K`*C@ +*C@@7!! qkTTC>C @7! @7р $$$$$`2@x2$SAR[BcC]$$$$a2@`.@Q`.A!@?Z$$$$kDsE5`.@Q`.Ca.@C!a.W$kDsER$ {SEd*@@5FbBt2H@! Tqcbedb b"be d bjc u`"`B`AcnABF@c@`"  ?0"?H"|?`"?x"|?" ThRcj `vAp arABH@?&yT`vAbbA&@!R< 9EC,a*A@BT{@SA@ _`AR*h`AaA!g  chfba=ob>m>q den>l"?kb?j?i?a%o'm+ !p`">n)ld ke jf# ig-c #h@LA !&p_  "@#@4`CB{`"@4`CBq`"@4`CBp`" @4`CBv`!@4`C!u`c5}}_5#R@ B?|B&A _`C!x`  {$S [c2@  @!R#^D"vARs$`@7zA2cdBR"Rt `)a)e2dc6bzvr~@w&y5h #@SA[BcC{Ũ_9R$!A !'Fp  {  ` @0@ % @{¨# @{¨_{ + `F `Ja@!2a @{¨_ ՀF{A4@ґ{|@_@ {S@0@"``5`@2`SA{¨_@!xA !`(o  {@qZ{_{A;SE.@?4h`?h sb@E.`?3h 6`@2`SA{¨_ր@x  {[@S@`Fb @@?qmT?qATu @B` R& ~~SA[B{Ĩ_a6B B@+?|#RB A5@@_ !@T@@5??@4?V?@5B??@5?L?@5??@5BA` !)eoA` !)_oA` !*YoA` !*So{S@5`ұ5tF`@g5@`c5`"sBSA{¨_A!+0oA!-*oA!-$oA!`,o  {S[Ac3@"@RB5@xF*A 4+'#@'@?!T@Tb@q6@rs*s*s* @s*SA[BcC{Ũ_qR {S@;`E@ @ &5tҙ j)ҕ n@)  *7"[vbAе=  +zt%7AT@4!".,B! "2,!!6,B ! !:, ! >,B ! ky!B,!  $!7B   r7@7l@7h7@4 B $$7@B  |!huT 7 !TuFҠ@%z6!BTcszu@7!A !BTC9&@L5@4 B@ $@7wF  @!TB@ g1T`DABH@!<4B@ 5 S6`G  `  uF DB B <@'@  `@'`D ҃@ @d|'`D ҃@ @dr'`DE ҃@ @d h'@@@xa!?Tt`Gt"=  @@`<& @ `` ;@  @ 7@4~Ri'?_)@1@Tf)j`7@A!=N47`E@D*@f$7A! =;4@7@7р@;@A!`= @ D*A!=%4*@7!сV7A!=2* A! >4*@7!сa7A!`> *A!>4*@7!с7A!?*`A!@?3*@7!с67 h&@?3*@7!сA7Ҁa5@?3*@7!с7 -A@! U*A!@3*@7!с!7 -0&A!`3*@6v7~Ґ5`A!3*@7!с367&A!3*@7!с7@ %`!-t3*@7!сA783`A!@d3*@7!с7*A!`U3*@7!с71+A!F3*@7!с676֢@4b"70>` 52eҀ55``H5@%"5!@4& L4 *4.A!3@*7!74 A! 2*@7!сa7  C@f%@=> 7@7р B/?5@7!a6A!`2*@7!7%ҙ @xczz4%`{:Z_AT`DA!*a@7!aa֔A!2*@7!X7@@%A!`2*@7!87 -%A!u2*@6x76"!@4B@ " 7b=`R4O4L4@$E4;@!0@!A!K2*@7!؉7 `@@$ 72*A@7!A7@`$A!&2*A@7!Ab7 ?27Ҁa4 ?2*@7!A7@$A!@1*@7!z7+@7!a ~A!1*@7!AX}78'@4Bҏ!7;@@<@{+y7!1*@7!!xVy7`5A$xA!1*@7!u8w7B,vA! 1*@7!rXu7!@4! .B@P! 7sA!`1*@7!!o8r7 qA!1*@7!nXp7ҦoA!o1*@7!jXn7;@0@j7@A?@!@ - h7@4~Rb$7@g6@7 A!`%e57@!B !<%d5* d!'%*@7!abb5@79R #{z|@"3@a%d@*N6A`5Z_GTA"3!% _5 37@A!%*@![6]5 37@A!%*@aZ68\5@27@A!@%*@W6Z527@A!%*@!X68Y5A7@!0*A@7!ATUX7;@@4~R` X@ # P%bBF!0 O7bBFA! 0@N7bBDA!@ 0`M7bBEA! 0L7bBFA! 0K7bB|DA! 0J7bBFA! 0I7bB8EA! 0I7bB|FA!@ 0 H7bBEA!` 0@G7bB7bB|E!!@5B0=7bBPFA! ;0<7bBEA! 40;7bBEA!#-0;7bBGA! &0 :7bBFA!@ 0@97bBE!-0`87bBDA! 077bB4F!`, 067bBxFA!057bBGA! /47EbBE?qccFA! U/`27@`46AA! +`27$1@1@T KcAJ)J`Dҡ)4`|E܍ҡ)4)@@ 5J *3@^J@) *9!7TJ7@[' B!H@=C@cRg "Rks <Jljh)$$ "@B@/ !59B? !TbBEC;a!xG`E.?B@ch`@!@y@+9 A90@ - @7"@A! V/5wDAccE!`@bK/5@ccF! bB/5@P$o@@7 @A!4@!1@TaF   4;@@vEv5U~7qTl@@1@Tu5Vb! @%(@7!a x ;@ na@7!a @7` p 7bgq7?@BAB!^r@7!a`@@6cCkDsE|C ?@ @K@[B@G@`E@@BҁTSA{ܨ_քd@[cks`@7 @7@o3@5еB4 RB r |[FҚ3@5е6 RGEC)3@5е6 R@7Ѡ`u.3@5еb5 RwѠeY!_D7@\[!V#!P)!J;G7@@77@ 3@5еB3? RbC@1.+j(%"R>@7`5еB33@?cC| RC@C gkkD@K@sE@@@7@@7@;@7 @7 @7р@7@7B @f@7`!Aa1`@7`@w@7i@7xa@7pY@7hQ@7`I@7XA@7P95е28JGD3*>;83!с./m33&V3 3 73333 33333335Д3G5 Rbb73"R`?|!!1WK@C [[B@G@cCkDsE@7р`G@[BcCkDsE?|"П@B<#R @H@! !9kD_|"RC CgkC@?@K@ S7 H@}!!8_|"RC gkcCkDsE~"R?|!!;C K@@G@u 'i5еB2C?|!RC gk5е1!!@:"R@?|!!1C G@"ЁB:#R?|@? RkD|5Д4?C '!!@9u!!1o!!8{[v֚Fca!E@"@OATfƀEGReDKQW^d k s z   ~{xusqoČV\jcˌfԌcی`]ZWTQN  K  H  E " B ) ?0<89?6F3M0.,*j%q!x        ɍ ύՍ܍#*18?F M T [ c k qx~-4қ;Îʎю؎ގ  |  y  v  s  p mjg d&a_][B̏ӏVڏHROOVL]IdFkCq@w=~:  7  4  1  .  +(%"ŏjry    % , 3 : A HOV\b%Ȑ ϐ ֐ ܐ   ,҇Ƒ3:A}GzNwVt]qcnkk r h x e  b  _  \YVSPMKIG̑T\BcՑ>ޑ;852/,) &  #    &  , 29?G Mjpv|     Ē ʒђגޒҸ!'.6< B H N T [ bhow~~|zx%+s1olifcœ`̓]ӓZٓW ߓ T  Q  N  K  H*@FC @=:75318,ǔ>(D%J"QW]dkq w ~      ͔S[aԔ۔     $ * 07>ELgҢnu{    }  z  wƕt͕qӕnٕkhfdb].@ZWTQN"K(H.E4B;? A < G 9 N 6 U 3 \ 0c-i*p'v$|!#  Ɩ͖ Ӗ ږ     *17>EKRY`f l r x   =CҌI×ɗϗ֗ݗ|yvsp  m  j  g  d  a^$[*X1U7RPNLPҘؘGޘVC\@b=i:p7w4}1.+  (  %  "    Ř̘   jpv# ) 0 7 = D JPW^d|ҽ   Ù ə Й י ݙ}xtq"n(k/h6e<bC_I\ O Y U V [ S a P g MoJvG}DA><:8(.35/,)&Ś#̚ Қٚ          !;ś˛AHNU\bipv |     қRXҩ^؛ޛ     & - ~3{:x@uFrLomkiedl`s]yZWTQNKH  E  B  ?  < Ü 9ʜ6М3֜0ݜ-*(&$} $ + 18 > D J Q W ]cipvȝ ϝ ՝ ܝ   @#Rŋ̋Ӌ |*y  v ڋ sqsTliqaT@TA! (M@5 %R=#%( #=h`xa B@aTSA`4~~@EO@@BҡT[BcC{ʨ_SaSAu"Rc?|!!C7;C`SA{S[c#dY9DXG ? =`=?` OA!(GB@>CcXF!@0C!atvy&[BSAcC#@{Ũ_֘d@ ?{a@!g[a~S(`ay<iT4ҔT@T"@} ?Rz@ @   T@#@ezb%az"b@ezaecz!B@a@!}ejaecj! @&@ ?ִRSA[B{è_BBFB@aT R_`C/6{q{_A!G!@a4_ {CRbR`T{_  {S4q [c*&B#ub xu@8xuvNraT TsD |}4|@uq5&B74k Cwb`xw`xwsT v RSA[BcC#@{Ũ_k wb`xw`RB4 !AubӀ&xu HD H&Bb4A &B"AALD`x5 @L&B }k!R!AwbӠ&xw HD HA &B ALDax7AL&B!|}Kk! "T@H7A!F!J!5!_"@B1T"{@!{¨_A!F{!J 5 ` @{¨_ {SA[Fc5@ E*uAPw vV`[BSAcC{Ĩ_A!F@Q% J@5 `̦4_8h   {[UеFS T@@ `7"LB "" `VabAa@Ycac"ҟBPB`AS7SA[B@{Ĩ_a@@!!P!`A?TY!@F@@APg!1T@H@_AP'{S@E[ckv@@7y@X{F?AT_  @7BѢb @5?Tu@%AT`V@`6@t_a@\`V@`7 7 RA!E7@"@c!TSA[BcCkD{Ǩ_E UеFҘҡ- g@$G@a7!с/ +> b y{x"@@T@@65 `4Tu@ +@+ @D!"@! @(q@7р  +@@D!B @!@q @7р`@D!!@q  @1T^ҘҠ @7рR|  Ru{StB7` 17`B 07` `07` 07` /7`B#~ @/7`B'{ .7`-x .7`2u .7`7r -7B7;n @-7tB;`i ,7`f @,7` c +7` ` +7`B] +7`Z *7`BW `*7`T *7`B!Q )7`'N @)7`-K (7`2H (7`>E (7stB?@ '7 = '7 : &7B7 `&74 &71 %7. @%7 + $7$( $7(% $7," #7B0 `#76 #7> "7tBB "7B !7B  @!7 7 7 7 7 `7'7,74@7=7sB`B@7`B7`7`  7`B7``7`7`'7`8@7`?7sB `@7`7`%7`4 7`97`>`7tB7`77" 7B @77.77 7?7tB 77 `777@77!7% 7)7.`79|7tBw`7 t7q 7n@ 7B%k 7-h 77e 7B[7B7`V@7`S7`P7`M 7`J7`G`7`D7` A7`B$>@7`(;7`,87`05 7`"427`B7/`7`:,7`>)7tB;$7B!7@7 7 7 77B"`7B* 70 74@797=7tB?7B7B 7B7&`7+7.7B2@767>7tB77  77B`7-7578@7tB7@7B7 7 7B7$`7)7-71@757B:7tB !7(77 7:7B`B 7`7` `7`7`B7`~@7`B&{7`/x7`B3u 7`B7r7`;o`7`?l73tBBg`7Bd7a7 ^@7 [7X7U 7BR7O`7$L7-I70F@7B7C7=@73tB;787B5 727 /`7,7)7&@7#7B 7B  7B$7'`7,707B4@77 7;7"? 74ГB`7` 7`7``7` 7`7`@7`7`7` 7`#7`'`7`*7`/7`3@7`67`;7`b? 73tB7 77 `7"77#@777;7TB#`ѫ7`7`b 7`7`" `7`B7`B7`@7`B7`7`# 7`'7`+`7`/7`27`6~@7`:{7`?x7TB'`s7`"p7`Bm 7`B j7`g`7`d7`a7`^@7`%[7`+X7`/U 7`3R7`8O`7`=L7StB+G`7BD7A7 >@7;7B7`7B4717B$.@7(0*7`+'`7$7`B4!7`8@7`;7StB/@777  7B 7B`7B 7B$7B(@73767": 7=7tB3` 7`b7``7` 7`B 7`@7`7`7` 7`B 7`%`7`)7`B-7`0@7`47`87`"< 7`B?7stB7ѵ 7B7B`7 77B@7B77 7#7'`7+7B.7B2@7"6797= 7stB;р7} 7Bz7w`7B t7Bq7n@7k7h7 e 7#b7'_`7+\7/Y7B3V@76S7:P7>M 7stB?BH7 E 7B7?`7<797"6@7B)37,070- 74*79'`7>$7`B 7tB7B 7 @77B7  7 7B"`7&7+7/@7B5~7:~7tB}7}7" }7 |7 `|7|7{7@{7z7B%z7* z7.y71`y75y7B9x7<@x7`B w7tB Bѽ w7Bv7 `v7B v7u7@u7t7Bt7 t7#s7'`s7+s7/r74@r77q7B<q7tBыp7p7B p7o7 `o7|o7yn7v@n7sm7b#pm7&m m7+jl7.g`l7B3dl7:ak7>^@k7tBBYj7V@j7Si7 Pi7M i7"Jh7bG`h7Dh7 ?`g7<g7`B$9f7`B)6@f7`-3e7`B10e7`5- e7`8*d7`='`d7`B&"c7sB`)@c7`-b7`2b7`6 b7`<a7tBB  a7 `7``7`7_7@_7B^7 ^7B% ^7*]7B0`]75]79\7=@\7B@[7B` [7`Z7` `Z7`BZ7`Y7`@Y7`$X7`)X7`, X7`B5W7`<`W7B#`ѺV7`B `V7`V7`U7`!@U7`&T7`B*T7`- T7`3S7`B7`S7`;S7sB'`Bї`R7`R7`.Q7`9@Q7tB+щP7B@P7B O7O7$} O74zN7B/`Bu N7` rM7` o`M7`BlM7`iL7`!f@L7`&cK7`B/`K7`5] K7`:ZJ7`>W`J7B3`RI7`O`I7` LI7`IH7`F@H7`CG7`0@G7`?= G7sB7`8F7` 5 F7`2E7`/`E7`B*,E7`.)D7`;&@D7tB;B!C7@C7B B7 B7B B7BA7%`A7B; A7tB?`@7@7?7@?7">7B&>7) >7-=71`=74=7><7B`<7`;7` @;7`:7`:7` :7`B 97`%`97`*97`-87`1@87`477`977`B> 77ГB`BѸ67` 67`B57` `57`B57`B47`@47`37`#37`B( 37`-27`2`27`:27`=17B `ь17`B07`@07`/7`B /7`} /7`z.7`w`.7`B t.7`%q-7`(n@-7`,k,7`B0h,7`4e ,7`7b+7`=_`+74B`Z*7`W`*7` T*7`BQ)7`N@)7`"K(7`BH(7`E (7`!B'7`B%?`'7`)<'73sB`B7`&7`4&7`1%7`(.@%7`/+$7`5($73tB ##7 #7B #7B#"7-`"7B4"78!7<@!73tB  7 @ 777! 7%7B)`7B4777B<@7StB 7@77(7, 7?7StB# 77 `7 77B@777 7"$7B'`7b*7-7B3@7B?7StB'Ѧ@77 7 77`7"7%7)@7B97B=7StB+Bу77B} 7Bz7B w`7Bt7q 7Bn@ 7#k 7'h 7B-e 7B1b 77_` 7=\ 7tB/`W` 7`T 7`Q 7` N@ 7`K7`BH7`E 7`3B7`6?`7`?<7tB3`7`7`47`17`B!.@7`B*+7`-(7`0% 7`4"7`7`7`B<7`?7ssB7`7`7`@7`B 7` |SA{¨_ { @7`@@7`2@7QR @{¨_  {S`[@ @Tbbx`A@aaTAT@@ @ @1@Tt T@ @1Ta T@ @1!Ta @T@ @1Ta`T@ @1!TaTbcbz`A@!1Tbx !T[BSA{Ĩ_cwT}b TAx`!@z     A @a@1@T4~ RMTz`zC@?JTA 5 @zczcB@B|@`,TcT!7zbzb@d|@e ?#T @ATz"BLTxbBATA T[BcCT`xa!@TdxbBaTma@ D!T@@6!@!bf`@7`[Bm`@7`6_ҽ[BcCY DB @! @>f[BO[BcCHi!!|C[B4@!T@a6A{@R b{_ a@B~!@C!a_!@?_  @9qlT@h8_<qlT@xx_|qmT@xa_@x_{SS`@935A PSA"{¨_*XA"PB`@"T@bp7R_{"@ " 4F?T R @{¨_!! _TT@`4a@R`_@?@CT@cp7R_B@b R_#c _TT@q_{@?q{_   @9qlTbh!8_<qlTbx!x_|qmTbx!_bx!_$@*R}ф@ڢK  {  HFb@@ @{¨_  {  Db@@ @{¨_  {   @{¨_"s  {SR@y(4SA{¨_s`@9qs@94{S(?(qTa@84?qaT 5`SA{¨_`@9(q!T_ T@7r T_B;{@E.`?@h`!@@!!!`A?3{_ { `@@7b@ Fj` @{¨_ D!(@@B{ST@Y@*7!сaa@7!aSA*@{è_`V@`7C;@E.@?֢@ch`@b@`A`@7`@7р`@7`@}zwtp  {@S!!E[c#@/Ah@A #@C Fd@T+@U@+@ E/@@BAT[BSAcC{ƨ_ր@1 T3@@'@a+@a @`44 DB @!*@+dst@1@T`@7`{ TESgu `! ta^@SA{è_ր@1`T{  Fa@!1@Ta @{¨_  @#@_Tb @$ @cJrT{@rTr$@rTr$!!cBb|q{_R_!@@ R_@7BB_֔$R {s\ @Sck[3@4Gqh1TqT#q`TCB@Z,-7@-;@xn@'47@j(4;@f@*4@@C7|@GR@`7`@m.a@T!b@!!|E@@4q`&Tq'TB@A@%z)@C9<( : *`@@6 @@?8 T @D&T@@#@6C@99{F$@T@ *6@!@'T #` @|@?k*T@dC?@!a@F 2WC@@1@T@@ + ## 1;ST+7@[1@TB'u@@4?qTT Qq)T |~!@jx!y1Tk!B? qT@4@F@~@{=?T@!Ѣ#7@3@k?@ 7@ G?aT@@@Tk@@ 'T@@ +&T@@ +T#[@a @-`6֚Fp@*7!ѡA73@5s@R``R`@7`@ SA[BcCkDsE{ɨ_ @T@6 @1@T   @6@H @3x66֚FkaB" IpC@ @?A@B@ҜC \@B@ Fc@B@1@҄ @N5 @ lF!+@V?Ң@T@6@1Tu D!0@@?ҋ!!D @ @@!7a|@4 Fc@B3@!M6u D!3@al D!5@?dYBK|@<|9?9|AT@`@@Կ7 D!6@?OK D@@! ;a<@Bxbz61@ F!B@<@M%@7@ _\ D!+@> D@@!:da D@@!8[a` @qT @K? T D!.@ҝ> D!@/@Ғ> D!-@҇> D!0@}>  {(`&@ T @{¨_ye'@55 D!=@Z>{c`@S[ҟTSA[BcC{Ĩ_{ta@!T@6xaV@AP6S4L`5 D! @$> Db@!`?@` 6 D!?@>T@`7aH6R!xTR_ {A{R{ D!@={_ D!@= F@A_!1T_A {S!!E[c@@"@'QaV@ `7#@]@˄ !@4"B4Fr!}Eƀ#cP.@jihe.x c^ab`Z7#@f*R7!!E'@"@cTSA[BcC{Ũ_ lF@!@+`v҄`?_T|bhbb_"@B"  {"S@afT| !`R(R @hgcT@|b}g|B`T@h%SA{è_@b{$ЄES[c@'^` !,@7`@@ 6Q !,} 7`@ 6E !@-q@ 7`@`6L#b?T @`|@h`T #@B @ s1T#@!-K7#@@7!R!!E'@"@cTSA[BcC{Ũ_NU#@@7!!`GE`>`8`@7`0 #cFc@aT RmD;{* E.?րh`@ A 0@4 F @{¨@Ws`@b @!Q   @{¨_tAtAB #A@!1TA{ { Fa@@_TA; E.`? h`@!A! 0 @<qT"@b 3  @{¨_!@ @{¨A@{SAs0[``Ғ.6֪E`@@ -5@ ,6@҅`,@`@+5@*6`z+@`@`*5@'6`o)@`@)5@%6d@(6>D`@@`'5@`#6 W&@`@&5@@!6@L@%"BG`@B@x`$5@6 ?#"BPD`@B@k"5@6 2""BF`@B@^ !5@ 6 %` "BG`@B@Q5@6 "BG`@B@D5@`6@  "BG`@B@7@5@6"BG`@B@*5@6"BG`@B@5@@6@"BHG`@B@`5@ 66֎F`@@5@ 6 @`@`5@6`ҿ"BD`@B@5@6 Ҳ"B$G`@B@ 5@6~~SA[B{è_֠-B1?|#RB р@р@р р`ррр@wрdрQр >р+р`{рuрoрiр cр]рWрQ-B~  {S"BF@@1!T4F"BF%F 3J @6SA{è_nB`!сA@{S*W`[*u@q4`&@`T; E. ?֔@|`@Ta"@ 5a@5[BSA{è_RX@5 D! @\[B@7р[Bb@RHe@ 6[B {S @``@65F!R `F`CCC@tSA{è_ ` ?q$CzaT R_$lE{@*~R!BHq{_  {S a@7!aSA{¨_q{S XE@/5 SA{¨_`@7``U  { E`O<(@@f(@9 4a&@9 G h@MT}#ib#a@hb!1Ta@!1TBaT@SA{è_֡@!1TBT`&@9)g)! &!)AՏ @9"$@9d(@9A !q`B ƚB!Ě _!!D{ * @kT E@k!T Dj @{¨_  !{Sfya@7!aaSA{¨_;  {S!@ E@ E?Tb@_`T @T`T@4@1@T E@@BaT@SA{Ĩ_֡@  E?T!!F!A1`Q@a7!ѡZAT( ҵ {{_-_ -_ {))E=C=#='=+=/=3=7=R#@/'+ )`@ !!E/@"@caT{Ҩ_V {#cES*a@'T@T`@ T*R!!E'@"@cTSA{Ũ_*- F{[#Sc*kY``*@{3sT@@9?kT5SAcCkD[B{Ũ_SAcCkD@7 D!@h6SAcCkD*c*#@7SAcCkD**SAcCkDSAcCkD_ _{ gV`҆ `&҂  g`I``y `@&u ``"q `&m ` g`*4`.@d @`2 ` `6 @{¨_`@7``{S# SA{¨s` D@@!XSA{¨_A;{ E.@? h`@ @`!A!3T@ @b@Q "T!!Eh @ @{¨_` @@{¨܍{  `!!FҀR"! 5bA`PR>` @{¨_`@7``@4_{@@S*T @x5a SAR@{è_q7`@x5@SA{è{I;*JE==#= E.?C'=+=/=3=7=RE@/'C/ ) i`@ !!E/@"@caT{Ѩ_ּ{%ES@G["@@94`@ 5c`S/@@ TҖ/@?mT`@@7B?mT`@@7B?mT` @@7B? mT`@@7BB?mT`@@7BB ?mT`zu@7B ? TT EG@@BT[BSA{ɨ_c`V/@S/@P/@b@@@T@6C@B`8A/@ EG@@BҁTSA[B{ɨ#./@'/@!!EG@"@cҁTSA{ɨ4[{@CR`{è_{S`@T@X6@dj`D?SA{¨C@SA{¨v$ {SU@_TU@SA@{Ĩ L@5SA{Ĩ_ #Ғ!5@  DT @TD[ @1@T _{"@ E_T" @_T @{èaR@T @{è_  e|hdd _֤$T@ A$TEӥ  {S8D@@'5SA{¨_`@7``b{@ @?t`  @{¨_`@7``JC;{ E.@?`h`{@#Ry"@@_TB"B_{S@؅cW0@ [`@u`@€u`@xƀu `@q@uq`@h@uq `"@_@u"q `&@V @u&q `*@MҀu* `.@Fu.`2@?րu2`6@8@ Ru65|@`:@.u:`>@E%@`B@?qFv>֋vB`F@vF`J@A`N@?qvJ uNr@`R@[BRtRSAcC{Ĩ_[B@  A;{ E.@?S h`scEs4@d@҂B@4B@ 7O````RQ?qTQ!|@&`E@@BҡTSA{Ө_DW!F @1@T F`@7``8  {B;S E.?@h`@`A@B54@b`B*SAR{¨ISA{¨@Q@SA{¨@~`{a!8  4a!7*@R5 @{¨_ R_a!@4a!4a!`4a! 4a!`q R`RRRR {S!E[ht8%@'5** AT**`5CE#@E'@@BT[BSA{Ũ_֝1T 1T?D!@@2EC@B! `@7``D!@1 {S7RY7`@6@*SA{è_` T{?D@@T@S8@d@$SA{¨f5{¨_֠4@a@"0@bB@"!E!@aTSA{¨;@ PSA PSASA  B~ cE{d@/[!XES4C; E. ?wh` @`7`@ TAT!@5F!RC5C$C @@? C7C@aSAR[B@!E/@"@c!T{ƨ_! 4`@ ` F @@? T`@TƀE#uBOB7 ,E&@@#\;c' 4k@@@j @%@eB@?@E. ?րk`0@@`D@7Ѡ`DcB E@:[ҁI(@7!ѡa87@Ҳ@7!сa7@?6@7@JcCkDsEl`{t@!T@B6A;E.@? h`0@@!;R`V@aj}`V4`V@a|`VV@AT@C6@!1!*T ~` 6`@@4`~"@`J@@B&@`N@ E`NEjbAC@LT4@4.!|E D:е~E@BT@(7n;;@!j@:@@G _LTRR{`@<@!`COC@_LTD 1*T@7!a;@ @@ @;T;@c@`?@@7@`Y@1@Tg@;y;@@7Bтb&@@ 7@@!R{RR_MT;@`xwC@`T@@16Ci24C@qҁsC@@5ҁm`5@!F_T;j"6;@C@`xaK<5 5K@3 K@@O@Ax$CqkTTO@OC@Cq`A  @=  GR9 :!7@!G_T@  g #7 @7 @Z?G@<&5bҀxaTG@B\5@{@45h@!TO ҁQ  <6`ҁK@4@{@D@!(@AO;@6@!뀮T7@`?cCkDsEEw@@BҡT[BSA{Ϩ_@4`~G@@<5<RS_Tcks@!F_ATi0a 6qҁ4f{@4{5{@! ;D!@.@N`@7`C{@45h@@{@{@"45h@{@{@*ZD! /@N@7@;@{@4[4b5<RD!,@,Lc@0!@! @@7Ѡ`ѠK@~ҁG5K@"ҁB@5K@0ҁ=5DK@! ,@N@6J!FC!M7k@D!`'@+k@@7!cCkDsE;D!`+@+;@\ @@7 BlDB @!-@VNd\F`J3cCkDsEDb @!`)@DN;@9{@ 44*.D! *@+;@,D!*@+;@$cCkDsE  {E====#='=+=/= cR @') !E@"@caT{Ϩ_  @BT@6@*`LD{@!1A+R{_{E*@S @ K@9q@T@a!E@"@cҁTSA{è_֠J@3@!{SAZSA{è_@!G_`TR` 7@7Ѡ@R@7Ѡ @l@Rg {D;E.?{h`I{SS@ HT@@?`@ @T@6 T@7 7@SA{Ĩ_C 4@@?`@ @T@B7cD @!`@6M@7р` B@5 {S[F_TB @!1@T"@ @B1@T" @@RSA[B{Ũ_A;E.@? h`@@[Z c@6@ 4t&@6@@907FkZ@J@UK_km T2@~@5 @{@ 4y '@@!F_T@`@T@6FTcCkD`@A7 @lF!@*cCcCkDҠclF @!`@LcCkDlF!@)cCkDlF!@)cCkDlF!@)cCkDlF!@@)cCzlF!@)rb_  {S4@E@ҀV@6@4`@1@T`E@@BT@SA{Ĩ_4@1T!F!7@t@T@6`@T5D!@@p){  @T@6 @$Ta Ac@ @{è!F!@ 4 @{è`{ES[cks@G7 {@  A_-TxtaT`@1@T`|c{t` @1@T``@7``@@`?a@7!a EG@@BҁT[BSAcCkDsE{ɨ_@_T`@7` @7@@EG@@BTSA[BcCkDsE7@{ɨT@6 R _eDB@7!сAQ`@`6ҳJG {"@@ T@`64@{@w%@ @D@A@!T@?dB @ @c 3! 9K{_ @D@C@cT@dB% @ @c 3!` &K @D@A@!T@?dB@c 3!@ @K{  @` @`@a@ @{¨!@ {E;E.?{h`"F_{ @~R?T{_!TA@RAD! @-(D!@%( {Sa@7!aaSA{¨_l{S[****a@7!a[BSA@{Ĩ_v{  @{¨7  {ES[c**@/@*t@P7*[UU!E/@"@AT[BSAcC{ƨ_#` A;E.@?!h`7$@R!R!K )WK?klT@? qT @ @C@!sBW1T@7`S@cQSk TdU#@T?qT?qT# @@ @Cc0+S@!QSҡ sA @Cc0`!sB1T@7 @c5!C?qT @j @C#c@ ![B1 T@7 @!wCD*! @IS@cQҝTD! @&|T;{SҜ@B}dB"# aw` `SA{¨_~SA{¨~a@!4@{ES[c*@?! @`7kqt@ X7*`~`!@6y4z~EuE:+R@9G4(q`T& 5 R3@~9#'a4a~E `Jq T+@zv @uV1u u@Tv* @R@ P7*U6SkDE?@@BҡT[BSAcC{Ȩ_֏@*` @R` ~u'R`b@uV1u uTv}*7@!` 4a~E%`+@@vb*Rk++@R`zkDҩ%+Pa}kDҙ{I; JE==#=E.?C'=+=/=3=7=D@/'C/ ) i`@!E/@"@caT{Ѩ_> {p ! /OBRO#XGA O%@,@$X( \` ( =(|====Ă=!!!ܐ={_  {S[*X1``@94R*(q?jaT4qTRe 8b@9B5qJzaT ?9AT[BSA@{Ĩ_!ҟ9RBg@R 9`@94sR4qT@R#R  {S S*a@7!a*SA{¨_  {S[?!Ra 1T*qT? RSA[B{Ĩ_?*q T?*?@ R?qT?*`bE@ С'Q@`b E" @9_{C;BESc[E. ?vh`@@GQ?qT5 @ A9 5  @7!C@  !*@7!ѡv5`@7`@7р` R!EG@"@cҡTSA[B{ɨ_c#  !F @1@T Fc@#@7cC#@@7рcCR!`*!@7!!A@7X5cC#@t4cC#@   E _{[!Fc~~*~W5Sc` tG@a@@4sG@YrTG@`4sa@aE@a@4sSA@R[BcC{Ũ_sa@x`5x@b@`@#y@qb!@97VB֢9@ac`4BT@x@7R9@94?qRSA#@K!R9|@5`@SA#@tSSAR#@HSA RSAR#@ {cBESJ[@@756kTjs8q@TqIT?jTja8qhTB(6qT@@(@6kD@R 4RE7@@BҡT[B*SAcC{Ǩ_@ (7sZdT>*4skDa@9R`?q$BzT@8?q$IzTG"@9CQ_|qcb`AzB@@zT!k!T!O cҷjs8w4~q@ T~@hw8j38s2T*'"8 4! Қ`4!@s44!``4!҄4!b~4! x5`TOcEAR q5kDekDdR'e4 ? 4kDcVE!@dEkDJwE!` `@ $IxSX7a7`7P7ap7_2a6 B@_q,T2w6 R_2AW62g62_  {S*[*c*#3FӀGӡ  ua:'` ҵa@ @ ! `: =`<!R ayx>w"J*.R )vjFJSA[BcC#@{Ũ_`@@g`@ecSA[BcC#@{Ũlz[ {S!@`@a@ @(E?TSA{¨_BFB@TSA{¨Db@!@@D@7р Ga@RZҕ{S>@?qTSA{è_րf@`@6@@@\Q?qKzTF!ESA{èc!@Rrl@a@ @9qIzT @9!E@F@4@ҁ@CQ5c_kT#x`(QR_jT 4qT @8qJzT`R`@!ESAR{è!@c`>l@!RA$ }@@@@qJz`T@@4@?q@T Qq T!EBi !@CiMm{@!ERc!@l@@@?,qTB@4em@~E@sF5@wD?qBc@@cRk@i!ERc!@k@_{cE `@733H3@@7!A+@E7@@BT @{Ǩ_N{a!@4<@$@!S!"#R8_q!T@R#?k-T`b@,5t@[cwb@W+5RT-*tB@a@lT`@Ғa@"R!Q[BcCaSA{Ũ__q T_q! T@R#?k@T`b@@'5[u@p.R R'-a@za@[B!Qa@R*!kT`b@ 5t@ [*`R?kT`@kT`@cvB)"R,@`@ ` `@a@!Qa9 cCBRa@_dq@TҦha@!Qah`b@5v@-7`@cab@vB)4cCb@BQ*tbҩb@ R`bBQ`b@v 5@`b@v@5R,`@a@ d@*bC)*3`@ tb@BQ`cCcC R`bYhfa@uvda@"Q R[B`bbK`#a:@|!!@`:@b@hy~ #@Da@"Q +@R#?kAT'h`b@ 5R[u@b,@`@RbkaTh`b@5v@cm``b@v5l`b@v5l`b@v5R=,``b@v5R6,`b@v 5aR/,@`b@v@5la@@v`b@!Qa@5R, aR, QR,@b@}a@"Q R[BcC`bba@t`@Q`Ҵg`b@v5R+`"@aRBz!~@7T#@b@BQcCһ R`b/a@uҴa@u!QaR+`R+e`R+aR+`Y" @a@a@cC!QuaR+R+`:aa@"QiR+aR+`#@>cCucCua@cC R*u`bb`Rk+aRg+``@z  R`bcCa@7`@l a@)  { @b@c@Cc! @7 @{¨_cE"`!c@fD!@`@6` @ @@AC!1T@@_A  {S[6@F567`@1@T`@7р@@SA[B{Ĩ_K@7р@@@{@[SUA@ E_!T @2@1@T`!XE 4[BSA{è_ր2@u`4`@7`@ @I!,E!@CC 52@@s!lFB/!@;ҷ@@  {w @*T!F`7 @{¨_D!`0@  A;{E.@?!h`{ @!@{  @7 @{¨_`@7``u  {  @M@ @{¨_`@{S$@@a6v- SA{¨_J`2@`@`!LDB`7!@!; {C;SE.@?[BEvh`C@?Ҕ/@a>@ +7Ud8a@7!aa@!@ ?E?@@BT[BSA{Ȩ_  BF{ A@!XET@ @{¨_o@5c` @a@ @{¨eC @!}@dhaB1@T@`h!B6_Bт{ S@!F!@1@TG) @@@1@T@@ @b 1@T @`@a1T@@@c1T@ @b1@T @a@`@a"BF`&@@1T!Fb~V~aBR$@SA{è_@@!1T @1T @!1T@`Ҽ D;{*E.`?րh`@\9c5{_{*2 { B) kT`@cxc@`@kTc @Rd@ Ra@dA @{è_'#)@'@6!Rab@CQ_qmTR_{@q{_ {SДF[@b!@5@@ 5?"@T@T@52@4` @bE@ 5uB@` @b RSA[B@{Ĩ_|H 5u @0@B_4!`YG@7ѠTS|`1!0'` @uH4`1!`0'{@ Sa@4!RaA Y)kLTB!RC@)B`џkLTA4RaN! ĚkTAR @{¨_{S*@*!E#@!2*R{B*` @!2E@@BҡTSA{Ĩ_S  {SEn@@/E@[Ҁ@n@@ T`@7``8[BE/@@BҁTSA{ƨ_[ @xv@1@T#Bħ`@a7!&wE/@@B!TSA[B{ƨ02Ёc3!@3s !E/@"@c T/@7@{S*@[*zb@a@R!t"@ $SA[B{è_  {S*A4[**c**z\)RcCT)[BSA{Ĩ_D!3@[BcCD!4@ @@c~B@dB@#@B@B` __q*DCzBB"*T')&)#@TB B#"_֧B {S@? 5`@SA@{èSA@{è_{S @ ` @`SA@{è(@@mT`@@`?֠4SA@{è_  {S*[**c*"z`RX)cCP)[BSA{Ĩ_D!@[BcC  D@F@4! T%@FT!@GT Ra_R_ @`R_@aT_%@C@~@c@cC~"@aB@B"{S!@!<@ ?TSA{¨SA{¨_  {D;SE.?֔h`[V@P@` @@(7`@?ց&@!&SA[B@{Ĩ_{ES[cks@Oҟ-.T9@G!@?A,Tz@@@T@*6uC3|3@&ҟ T|  @ @@@1 TX%!T֚F3Rw;7?@%BSg?@@7!AC!\ 4B;E. ?@h`4TbSKD @T@6a@F?TaT@7р@!EO@@BTSA[BcCkDsE{ʨ_֣zs`@T@6szF`@֚F @1@TS 7@RT@7b @? T"D!@; @7 ҩ֚F7?@F3W?@3@@7!a3@ @T@6\33@` T @33@ 7@7 3s3@@1@T`@`7Ѡ%]! m.6U@7@kW3c@3@7!с^3@z`}A@!1@TA@"h#H@7`I@72D@S4@@! c @R;B *ED! @D! @D!` @3J3@7sD!` @n@6lF! @ ;   @8@@_R_  {$ @9 сaT{_#EcTca{E;[E.?֠h`Sc@#? T"RT? T[BSAcC#@{Ũ_֡@9@6@7р D@!cEB @TRw գR#?!{#%RcAc} cc@cڄKЅu  @R{¨L @{¨_@! _T{ C``V@ p6D;E.@?"_#@рh`B@@h@@B$? @{¨_  cE{CS[d@?#` @bHT#c` @t@TFT@!1`Tҁt l`@6 vh`@Wwd`@a`@^:+UaT!FC!ԥ7+@aT@+@6a@`D+@?T`@tAcDR!E?@"@c!T{ASB[C_4 R`:a@`D?T!F!@*7!сa6`:@5G@"<40<TT `@@!1Tv@ `Tw@Tx @FT@!1ATFTATT `@ `@kFx @A T T[ F`@ҽ`@UU@cD@4҄ #RRR`jt ң`@8 `@@!1T3v@TFcDQ`@`@`@:+UT@1@T+I@1@T+GѠ"ucw@Fx @!T56<cD{S[S Fd@T @s@T@T@!F:@?qd@T@F^@6!`D`4@`@aa@SA[B{Ĩ_F!A@!F@"@B1T"@@@!1aT_ָ_{S*[*** zu`X)!RP )[B@SA{Ĩ_D!@@[B@  {I;JE==#=E.?C'=+=/=3=7=D@/'/ ) i`@!E/@"@caT{Ҩ_& {  j`@3 @{¨_{ '@~`@|`@z`@x`@va@ @{¨!@ {R@S*[!k@T`b@5u@ `R*?k T `b@a@"Q`5cRk9 `?k T`b@5!R!`@vQ`wfcCkDb@BQ*ub!Q[BaSA{Ũ_!Ry!`a@!Qa?Tv@z7xb@5a@@8,T:a@cC!QkDa@}j`"h 9!}V a@ ] R`b/mb@BQ]`b@@5v@!QҸ\a@ R`bmb@cCBQkD  {"@_T!@@"@B1TaF{_D! @y7"{cESd@"#ҡb 4@` @A@!1@TAb a @|!E@"@cҡTSA@{Ĩ_%b A35 CR{@[C_k!Tb@5ScNB)kk`T@@xB)a 5QR spjb@(5B R_`b@!'5R @b@G&5B,aRK b@$5@@ى$x@@ @ȸG@ҡ@ *C( sG@SCAQcEkF{B[DC_s; Rbb@5!R` QR\ sKp@ b@ 5B Rb@A5RC Sb@G!5B,aR`b@5@@@rx@@ @aG@*@ #B@R9@AQsGҏsGҢ@; Rb> 7@@b@sB)"5A4@SC!QcEkFvsGb@@!Qo@ RSC!QcEkFbf@5@R_kT!Rb@4@BQA4[@SCAQcEkFJx[b@4@BQQR oZb@5Rb@5R@RkaTS[b@5@aR,@@b@BQa5aR@R~RR1 5b@@sGSC RcEkFsGb@SC!QcEkFsG@BQBQ!Dd@c R!@]@BQ@BQ`b@ R*b~ {=#= @'=E+=/=3=7=;=S[!U@@7A6t @C*/ )/4Tt7"!@ @"T R!E7@"@cTSA[B@{Ѩ_"_qmT*6*;D!@R  {?T? R$C T{_D@c-(!55RD@c@-'!!5RB-&!@5RB@Ơ-%!@5R{R@S#?k T`b@ 5[uRB)k T`7`@ab@tB)5NEab@a5`@a@C)@'f@**b@[BAQ@aSA{Ĩ_@/b@AQa@[B!Q@[B R@`bb@ua@[B!Q@a@ R[B!Q@`b`@uB)a@!QY{R!E@S$@GA_k@TR?(4?@`@Q`EG@@BaTSA{ɨ_[v@cR*k*?@Rq5`@vakT`b@5y@R`b@y5ma@bb@!Qab 5b@_kMT*?a@`b@!Qya 5!Qw[BcCkDam@sY@  XU!! ` T7F7@R|bh 8@  {S@*[**c*#P` RX)cCP)[B#@SA{Ũ_֠D!>@[BcC#@ {R@S*!k`T`b@ 5c x@`R?kTk `@Rbk T`b@` 5[+{@7` ub@ 5:ҁR Ao_@T{@z4a@{:z~@5T@c}ӵjch#yc@cQcӥa@!QaR `b@[BkD+@a@`5cC!QaSA{ƨ_ZA}Ӆa@kD!Qax[BkD+@!Q.Ha@C R`bOXa@[B!Q+@aa@!QaHH`b@4a@!Qa  { @T@`6#@@@c1@T#AR{_֠D!@{A; E.@? h`f@@T@G 6`^ 7`@!1@T @{¨_A` @@GH7v` A@ @`T `A @@`T `G!@{SSt@oyҟTSA{¨_c@@cxac@Cx!!  {S[T@@`PyT@@Bxc"#csTSA[B{è_֤@" @xa!d" {R@s#?k4Tc@55SkOB)[kaT `27@c@sB)45!R @@,5SA"Q[BkDsE{Ȩ_3Rs c@!5@Rk.TRc@e @P[ @ @_k$T"@@'@?kA$T@@^%@\c@*!Qb"5R?k@!TB)k T@{B)aR9 @@!Qc@5AR- `@@ot C)@38 `@T[3@****G cC@T 7@c@{B)4@cC!Q|@yB)s3R3`@@=t3@C) @@aT @@?PqT@@!T@a63ks?M<3@?@k@s@` @T @@PqAT@** 3 3@@@^ @h@G@o%*F@TqQAzTECDi`@E,B Jw@"Q@cC b@3@****ARO@%Q@**73@@x@*7@*** ma@:dD)9cC@@SABQ[BcCkD@:dD)SA R[BcCkDc**** 3s3@%@"QcC R*c@!Qksw3@k@s@m@ RcC!QcEc@4.cCEB|@DEi@@I@"Qc@5 R?k T@!R R  !E ƀ!@CCiB{I@!Q}@ RSABQ[BkDcxEYEc@4@!Qf@BQj@@SABQ[BkDaSA"Q[BkD[Ec@4@BQ*Lc@5!R R  !E@c@5!R aR  !Ec@5!R AR  !Ec@@5!R a! R( 5c@5!R @1!0R 5c@5!Rv 1`Ro !PR 5c@ 5!Rb @ 1 R[ c@ 4`5!RT 1RM c@45!RF v1@R? c@45!R8 `h1R1 c@`5Bc@5BR/`4@"Q RcN!E"Rc!@^G@BQ`!Ec`"R!@MG`@"Q@"R!Ec c@@Rk T@R! R 5c@5R@X` @c@!Q|EBc@5!@"g5c@:Bc@ 5aR 1BRR`5c@{ "R!Ec } "R!Ec "R!Ec]Dc@4@!QA!Ec"R!@F`@FQQ*!Ec` "R!@FL@!Qc@"R*c{D;[V@cE.@?֘h`S~5Ѡ"@`?'@!'a@7!aaSA[BcC{Ĩ_ր @MT"{S[Bck@ BQ*qT*R!@?k TE*"3@9_k TkERo#@Rq@TRrqTk T0C@*DqdVz"T4_@51 #T#@q` JzT"3@9_kTqT*v4q**4W*T @ q$T@ @p@`0 ?_BB_B$@))T BB RSA[BcCkD{Ũ_s +@?+ = =@@pC@ B_B$@p))T BB RRkT@@?BB@B))T!3@9s#@***qT @ qlT@ SAcp[BkDc`cC0 {Ũ *4q T`Q!@xr@T5:qT*qT7RG4 @4*~SV5{"@*R_q?qc jT*@ @"p@B`_0 ?BB@B@@!\@@BB ) )`a5+K5* B*J5SRt 7@ !ApkB`!XK qT! *SA[BcCkD{Ũ! z*q`TRCBB@R))!J5#@* K5ZGD@@B@ 7@@7р@7р`@@p4~* D4!@ ;**@ @p@B`BB_$@0 ?_))T  {Sst@tMTd@@҂xaB@bx!!aTSA{¨_SA{¨s{S3@@#pCqTs|@ `RE@6̳ aR `5"@ڐ RSA@{è_hTqTc|@ sP`EaT@֔` R5c|@ sP`EaEaE8`cE@`E` R`ERRB {!4S**[**c*ZY!RX)cCP)SA[B{Ĩ_֠D!@SA[BcC{c,1!F{ _ {R@S#?kT`b@@5t@aR ta@!QaSA{¨_sva@!QA {ES@#u4@qd @T!E@"@cTSA{è_R,4D;ՠE. ?#Rh`@  {R@S#?k T`b@ 5Ru@aR}`@uab@5!5aRs`@Tu@QaSA{è_%A`@@Q`@5aRk`TaRWRSaRORKRG!ERc!@C@`@Q`!@ R4`@`@Q@QҼ@ab@a4b@BQubb@ab@BQb@BQ`ab@ R*`b{R@S#?kT`b@@5t@R@ima@!QaSA{¨_ta@!Q@{BES#@@@ҢB ETE@@BaTD;ՠE. ?SA#Rh`@{èR!F!7@@!7!E@@BTSA"R{èXE@@B@TSA{è_{S*@[@0@raTU<@556F;E. ?h`@pCc@RT4@!kPSzSzKT4k!TqRR@9SA*[B{Ĩ_@ @w5R@@4_#@@BFaTB;{E.`?@h`@BA@^4C {_  {S`*[**c*#*ҀW ARX)cCP)[B#@SA{Ũ_֠D!`@[BcC#@{#@eLd@ x@1exa @Td =`aH@c`<`aBy9_k*T!K`""Q BRB}Ē @{¨_{[ES@@'ڰXE TV@7R#A%4qT4(qT R$ R$4hR!E`y'@@BATSA[B{Ũ_։T,q T4q`Ta@yC R Rc9! R# 0qa!< Q,S*qT qT#@A@F@@4@7 <?(T Ra9e`yhR`@9 6@V@#@` 7@H T ! RA`whRa9@ @@(@9q!T!FՍ!#!T#<HTB;ՠE. ?ց@@h`@:4 Ra9`hRdy^A 6TB;ՠE. ?@h`@"@4A R` xF!T'R#DA4q`T q!T#@Rb9a`hR`j` R@@m#@@U@G?T!R$rT*4B;ՠE.`?@h`@pC`a RAa9`hRu9Ri@#@ARu$r T*4B;ՠE.`?@h`@pCa  RuAa9`hR{R@S#?k T`b@`5[uRB)ckT`@uB)$RR4a@[B"QcCbSA{Ǩ_7`@ab@tB)4b@[BBQcC`b@ub@@5@`R_kTk5`@Rbk T`b@ 5s{@` xb@ 5<ҁRAv5 T{@"{4a@{ p@8T`@!}"kah!Ic@cQca@!Qa Rc`b@ 5`@a@k` f@*C)*!R0@kDsEa@7}M7@` R`b'Na@sE!QakD!Quapa@!Qa=a@=`b@@4a@u!Qa[BBQcC\b@BQX=?b@ R[BBQcC`bNa@"QkDsECb@[BBQcCkDsE?[B RcCkDsE`b8a@kDsEu {S*[c5H@RB\F?a T@V@ @6@@V@6 RSA[BcC{Ũ_@RaN@RE?TRFaT`@@@q b@HF_@T!ERR_`DT! 44R|E`RTR75@RRB;?Bq$BaT#܍ҹ9F!lA;E.@?Ս h`!@`Ai!T[#@ RS @zT#@@G?!T#@R{R@S#?kT`b@5[tVB)kaT@7`@a@bb@uB)!55PR@`b@t5PR9 a@t.cԝaR, `cC`@a@ej@`@# @1g@****KcC#@a@[B"QbSA{Ũ_c aRL ab@5`@a@2jg@*ŘC)* cCa@<a@"QcCcC[B RcC`ba@"5 `R?kTPRcw@``R!ERc&!@> a@cC!Qab@ R[BBQ`b[B"QҚZa@!QcCbb@cC R*`b {R@S#?kT`b@5`@t@@5PR$ a@t!QaSA{è_bB,aR`ja@;`@Rbk@TPRaR@RRR5a@@!Q`b@ta4!Qa@!Q;`b@4a@!Q!DФ@c`R!@>a@@!Qaa@!Q@`b@@"R*bb{S**[** RRT)L )SA[B@{Ĩ_{R@S#?k T`b@ 5[tVB)k T`@ctB)7pcb@5aR cb@t 5.d@ [BQcCaSA{Ũ_pcb@5`@Rbk@ TaR#y@pcb@d@ypcb@5d@ QaC 5`@a@h@g@*ŘC)*  #@d@7`@ab@uB)5c;a@[B!Qa@ R[B!Q`ba@!Qa@[B!QcC:cb@4`@Q`td@Q #@ғ[BQcC#@[B RcC#@`b#@#@ RQ*`bdv  {RScDTSA{¨_@6@4@"@SA{¨!a*a@SAB{¨  {S**[**RaRT)L)SA[B@{Ĩ_{S@*[**c*# Q RX)cCP )[B#@SA{Ũ_րD!@V[BcC#@ T@a6R_փcD{ @!`@{_{R@S#?kT`b@5`@t@5!ORt a@t!QaSA{è_bB,aR`a@`@RbkT!ORVaRQ@RMRRO5a@@!Q`b@ta@4!Qa@!Q99`b@@4a@!Q!DФ@c R!@m<a@@!Qaa@!Q@`b@@"R*bb{ES[k@O@U( Tc~uT a@9?pqT87s8TC?K@?@T߰cCEO@@B!T[BSAkD{ʨ_`A8 Tc9a@9 7cs<6`@7`cCsITa96scCaP@SorTf@d @Z\ҠP;JTo@G *;@GG@@7cCsEҾcCsErf`!`#@!@yCAyb9a@9b7t`@@y@yrs`@񄠟P7``sEXsET{S**[**c#PaR T)L)SA[BcC#@{Ũ_{[S*4*c**#*aPRSA`)X)cC#@[B{Ũ_րD!@SAcC#@D! @SAD! @SA @ {:b@A@?ATC@A!.R`T{_B_A@!T@6A@A_րDB @!"@/D!`!@|@A@#S?rTRD#4@95B@!S _R$SqTqaTR4DR5D@4D{@SSAb@B1@Tbb@ E_aT`@1@T`@7`@SA{è_8`!,E!@1`4!lFB#!@' qaT#h"8_qaT#x"x_#x"_  {S`a@7!aaSA{¨_B;{E.`?S@h`n @7!сSEa@7!aaeSA{¨__R{@Sbk T`b@` 5cxRB)[k T`@a@xB) 5QRKkab@a5`@Rbk Tz@R ab@5Rc@tab@cQcA5aR ' `@a@eC)@RAb@ * * kFc@[DaQcE{BaSC_ab@c@za@!Q_7n ab@a@[D!QcEkFkFxc@``Rk Tt@QR wK 0ab@ 4t5QRz iK "ab@! 4b@BQxb4a@[D!QcEkFxc@7`b@4c@kFcQxc&c@aQkFҜ[D RcEkF`b7`@b@ab@tB)4c@!4[DaQcE҉a@ R[D!QcE`b`Q!RkF*xab`c@x6ab@A4Aab@!5Rab@Aab@5aR@RRR 5ab@!EcRc&!@D9c@cQcC!D@Rc`$!@59@b@BQ`ab@y R*`bu {!TE* 4@!F@_{_֢@!GE_D@ TqR`%   { xa@ @{¨!@{S[cC`2@a @F8ACsBa@ץ`4`@@? !`F 4SAcC[B~R{Ĩ@a@qSA[BcC{Ĩ_9@!1@TF@{S[c^`*e@7 @`@#ATx@XTa!@5jC~h =5 @<7 @E5#@SA[BcC{Ũ_a! x5nC` @`?1T’@7`#@%,o#@L#@ {еFS!RC~C`C @@?C4+~@SA{è_֔@"C@4@$a{C;SE.?ch`c*x@Q! @ [ *e 4@&@RR#BC@4 qT@5A@ RB@Tq TqaTB@7R`4?T9 p!XE4t"@'5@5@6[B#@SAcC{Ũ_Ѡ[B#@A4F@`T6#@Ҡ@7Ѡ  [B@,T*@.@2@`4D!,@#@D!+@#@ ? D!*@l#@D! (@#@D!)@#@aD!`&@tD! )@k#@#@Y@B@PD!'@[#@{ @@ 7!A/a@ @{¨!@{k+@ S**[**cLART)L )SA[BcCkD{Ũ_ {S**[** KART)L )SA[B{è_ց!XE{S4  SA{¨SAR{¨_ց!XE{4@{_0{S``@ @`b@R=s&@c@4`xqTa@ ?59sBT@RSA{è_qTD!/@@D!.@@@,D@D!-@@{S 7@[*ckmK!RS@SAkDcC@[BD[@Hc@L{Ũ_րD!0@SA[BcCkDD!@1@SA {g@ 6 @{¨!A1{¨_ { S*3@[*ck K aRS@kDcCP)SA[BH[@L{Ũ_րD!2@uSA[BcCkD{S|@!2@7`@7`RSA{¨_`@7``ܩةR {!XESӿ`4@SA@{èD!3@+SA@{è_ց!D3@p!@5 1D!3@C;{E.@?`h`{@A {R@[#?kTb@5k+@`@һkD!Q+@[B{ƨ_֠@RkTb@ 5@cb@58S@z3sRr@aT} `@d*@c}jc$h#~@6,Tʦ@cQ$SAcC@2@!Q RbB@cC!Q@cC!Q RbB@SA!QcC@!Q2 {Sda@*7!a!@*SA{è_@@{R@S#?kT`b@@5t@aR@`b@t@5|b@AQaSA{è_tPt `@һIb@T@@{ @ @{¨Ŷb{S@ T@ Tt SA{¨__Iu=f { S /@[**c*kDARS@SAkDX)cCH[BL{Ũ_րDa!@?@SA[BcCkDDa!?@ SA  {S*[**c* ҆D`RX)cCP )[BSA{Ĩ_րD!@[BcC  {BESA@a`T"@@4@5@!E@"@c!TSA{è_ր@5@ @T@ 5 `40}"@4,@7!a+@8`4`@7` {S@  @ @_T@[a@@ bd(@9e$@9c @ Śd 4@?j T@U @`@t@`!a@`T@Ұ@1AT@1@T[BSA{è_@A!1aT@!1@T@!1@T@!6`@6_[B`â!`lFa!@&@ 7р[B@! @? T@u@ҝ[B`lFa! @`[B_T@"e$@9_8B ŚBP$cdv@`! @a4_@@ 4 @`6a@u[B"Q@bSA{Ĩ_!`@Rbk T`b@@5aR1%\@d@`@Qa@bmOg@*C)*@ a@]7`@ab@tB)4b@[BBQ@b@BQb@ R[BBQ@`b!a@u!Qa[BQ@a@"Q[B R@`b{S**[** %9aRT)L )SA[B{è_{S**[** 9RT)L )SA[B{è_{S*[**c*8`!RX)cCP)[BSA{Ĩ_`Da!+@Y[BcC # `@ {S*[**c*8 LX)cCP)SA[B{Ĩ_`Da! ,@,SA[BcC{S*ҭ8`SA{¨_  { $s}`ƒ38 @{¨_  @CSDSqT4_rha8_qT$4_rxax_4_rxa_@xa@xax@ha8{S5SA{¨_ց@|@R 3d@R"?jTc@cxa!f@&5c@BC@R?*TD@xa!@qR_{Sa@}Ra@cwRa@rR@a@[lR`a@gR`@8@\cCX|[BSA{Ĩ_[BcC{Sa4@ @T@GRR!_jTc@cxbBe@%4c@!SA{¨_ {[ccES @ckBse@O_ T`}  "_*T!{b#@c1@T#z"B#CB<7K@4G@@@BT@!1aT7@ x@{@A!E#@'AT@a6cA!Eq@F A!E'@"@caT{Ũ_4jaB-!@@> @b@#@@lF{A@!?{_ּ"@ {S!@!Q?qT[`@ @ cT`@ xa@XqT[BcC RSA{ƨ_@ A!?4+ @kR[a@*T`:@@ A!?j4a! j@4a!`j4a!j4a!j`4a! j4a!`j 4a!j5@ 2Za@@@[B= kD=N+@ NB<a!j@4A!$j4a!@j*@E@a4a! H)B[BRcCkD+@@2a!` H)B {S**[**c #i0R T)L )SA[BcC#@{Ũ_@@@?dq`T_@@?PqaT@A!E@__D;{`E.?րh`SR$@`@KT)qaT`@74c @kTSA R{Ĩ_ր4q T qT`@@5SARw@[R7@? T6@4@~@@D*a!@ SAR[B@SAR[B@  {@ES@HTT@`A!Fq!^4@A!E@"@cҁTSA{è_h@DA!@={` 1#Ҋ 5  {D;ST@[@E.@?֖h`| 5|`@a"`?&@!&SA[B{è_ {S@[RT@?L Tu@RҕT4@ 4~@@` @@t@RT@?Tt@RT@?T`@s@RSa@?T RSA[B@{Ĩ_`4@ 4a@~@5@4@~@5@> 4@~@65R05R5@'@4@~@{SB_T@TSA@{è@@`C"ʼ5SA@{è_C@7@ RC_{q{_ R_{ @"@@E_T" @_T @{èIBTB@@1T @{è_@X {S@[t4`@o4v @RV@?lT`@fq@SA[B{Ĩ_7@U4@~@@R{E;S@E.?DЄE[h`c#@@/` @@Cf T T+@AR@c1@T[f@E/@@BTSA[BcC#@{ƨ_X@1TBg^X  {S@dq@T qTSA R{Ĩ_`@@'@@7Bт"@@SA{Ĩ`@`@@_TxbB@\qATBRb@  { !@@E@/ T@6BxraT#A9@E?qA!FA!E/@"@cҁT @{ƨ_fZaB-!@@t{S@qaT`@[`4s@RғT`4@)@4~@`@[B RSA{è_[BR{R@S*!kT`b@5c w@`R?k T[`@Rbk T`b@5u@Ҭ xb@ 5k:R3a@uG @?8LTc@cQcXsa@!QaR`b@[BkDa@5cC!QaSA{ƨ_+_Tu@z99+@@}j`"h ZA}+@Ɖ R`b%a@kD!Q+@a[B!Qaw R`b%a@kD!Qa[BkDa@ R`b%a@!Qaa@p`b@4a@!Qa!QҪ\{S @`b4 @SA{¨@DA!@SA{¨_R{@!T@6?* R!4{_@!€R@R@DA!"@>R  {RA!E@S[$@'A_k`T`b@!5R#r`5tB)kT`@cab@tB)5* `b@t5* ab@t`@5aRk TuB)kT`@uB)8)bRGa@#!Qa#@*R`@cCQ`@E'@@B TSA[B{Ũ_R") !R`4`@a@[B@*g@*EC)bRG#֞`@!RcCQab`!R AR!R4`@a@0B g@*C)*bR#ce 7`@ab@uB)4a@!Qt#a`b@4a@ R`b!QcCQ}M`b@u 5R`b@u@5R@Nab@5R@ab@uA5!R>ab@!5AR`@a@A f@*C)*aRkYa@!Q R`b`@cCQ6`@!RabQx`@#@Q`C Rl'`@Qf`@a@Af@*C)*aR6{A@@E@ (@94 RA!E@"@caT{è_ցdCc қ4@@T@ 7R{`@ R`!T@!"|@@PqT @{¨_&"c@Ra"T!@B$@@!1@T F|@$  @{ T@`@ @{¨{A@DG@5 R{¨_S7RSA`@7`SARSAR{R@S#?kT`b@5t@Rab@t5R a@!QaSA{¨_tta@!Q { @[T@@6@FSRCۂ5b~|3sjb!RSA|@[B{è@?ZaB-!@@o[B{è_{S**[** *RT)L )SA[B@{Ĩ_{ @3`@1@T` @{¨_@lFA!@`{["@SAT@X6A@aja!W@@!!%`5?փ&@[Bc@&SA{ĨSA[B{ĨSA[B@{Ĩ_ {S [ҿftpvS`@1@T`A;@E.@?ֶ" h`$@RA!FK ) !RRRRBR*4@@ qT@Ra@04a~@@3s?T 4J@k T ҽ ҹ Ҡ @*a@7!aa@7!сa@7!aw4@SA[B{Ĩ_ 4 qaT@ˣ`5hmq`Tq!T@R҂@3s_Ta@Ԝ@4a~@b"`@7`l@@D*A! @l@lFA!`@`@7`@@7р {EES[a`@'v@d@@E'@@cҁT[BSA{Ũc#@A?{@E'@@BaTcCSA[B{ŨXcEbA!E'@"@c@T=bSA[BcC{Ũ_{B;S@E. ?֡! Uh`F`@T@a6-a@6@SA{è_!a!CcDA @!@ `@/`@7`` {S[*c*k**+*՘`@7J@@u t:1aT`"A9uBA9x`"9v@*v~)aB9{j )yb )6>D@5@@B5`"A9Np`"9uB9Vt`r`r`a@ a@?@ Ta @@`7@ 7@>@V@aV`@7`qT q Tu@ *|SSA[BcCkD+@{ƨ_ R`F`@ RqT`@7` @!1@T`>@7Ѡ3Rrm`@7` eR  ՠ@4`&{e*1T{`|@$ښ{_ {[@S&B4vH( A!`7(`E7@7!сB4))} 1`7BBlF!!B@`7*!`7   @ aLa@eA!*|SA[B@{Ĩ_ր@7р`{S /SA{¨?6SA{¨_{*S@*bP7c@***SA@{Ĩn<@)) F)G)6SAR@{Ĩ_{R  @_@ @{¨_  $R {  @{è6ܭqkT@T @1@T @{è_   {BBES[@C@wh#@u cl@c B@4A!4FcpSBf#ХP.S`@RNR R R*R RR'R2W#[3k;{CKS[cks*Հg7@@Ew@@BT[BSA{Ϩ_`@7р@ @ $Rw  @CAs AbҠ9g@a@C_@b{S**[**&RT)L)SA[B@{Ĩ_{S**SA{¨_{S @[B@V7a@>4a@94` @`@a@045 RSA[B{è_ 5J@QJR@5@} 54u$H)&I)ܐA!FbR!z`5  {"@S_T RSA{è_R`z`@~@_5,T@M4b@_ցJ@@!QJ  {S!@a24a@-@4a@(4g @g@ RSA{¨_@@RC) @$@ߢ4@ @A92 @9@@RC) @$@Ѣ4@ @A92 @9R{S @T RSA{è_R@Rgz`@C) @$@4a@~@?5,T@@_ ՠ@4*5{@S@9A7[v@k@sT@@B?3qcTğ4i@D)(U@E)Q(UR4@a@$q T q T(q T,qR@R@ L5@Rc@RdK)fL)\ 4@7рb@A@A9!2A@9@ 4a@ @A9x @9 @RҀ@T4R@~@4T7 y 4a@ A9@3 9}$Lz Tq[BcCkDsESA{ƨ_ց6!@a 4~@ RR`Rb@!zaA@A9!2A@9@O4a@#@A9"T@cx#@9B"T@D4a@ @ T@Q TR`@L T@@ 515`J@Q[BcCkDsE`JR`J@Q@EA!@N`@ D)E)BT `J@Q`JR@4b@ R[BA A9cC!2kDsEA 9p A92 9Y[BRcCkDsE@7р[BRcCkDsEa@ A92 9ga<!@`4@{SG =TGA!7@A! @7 @A!@ |SA{¨_{I)E=C=#='=+=/=3=7="@/'+ )@@A!E/@"@caT{Ҩ_֟]  A;{@E.@? h` @ @{¨_@lFA! @  ՠ@4 ,͊{STVE@1TBBTEA!!j7@1!TBBTEa!`7TG@1aTBBGa!T@7TE@1TBBEa! H*R7SA{¨_ր@7р@ED@7р`@G:@7р@TE, {S**[** $RT)L )SA[B@{Ĩ_{S8*`5@6*SA{¨_р@ {CBBES[#CcA@7"A!!']` 4+@@Ah@! '@A!F_@ T"@c7'@XWEXT@@?'@a+@a @!1T! `a@/@A3@ E7@@BaT[BSAcC{Ǩ_ֳ `T@`3@`@1@T`\ @a@3' DB @!*@Ҙ! `a {S@@T`7`@ @ _` RSA{¨_R{ E @AC!!"ҾqZ!!E@"@cҁT @{è_5\@!Q5 {S!@a4a @t@Rҁ@3s?Ta@) 4b~@ RSA@{è_֣@dD)BRfE)5RJ@QJR  {S @@|sTSAR{¨_րzs { a @ @?A{¨_{[@S5@6S?r`T?rq!T@9*~q@z T3*4s T[BSA{è_ qT@@@y{+,<@9{_ {#,@y{$I_ {"@  E_T" @_T @{è F@T @{è_  { m`R"@ @{¨_d@@@c@4c#c`6 R@k R  { FC@T@@#@c1@T#AR{_@AR%U{"@  E_T" @_@T'@ @{è_@!T {S4qT(qT*1`T*P*SA{¨_ @`RB RB  {@{_ {SU@_TSA@{Ĩ@#@5SA{Ĩ_##Ҡ5@{S!!D?TSA@{è_@SA{è^ {"@B1@T"q!!F{ _{*@SB0@*bBd*@SA{èho@?"BDTSA@{è_@7B{@S!!E#@'A0@" @"4!@5++@5~~ E'@@BҁTSA{Ũ_cZ@`R?6Ba9B&?|#RBc`b B9B`&{S[ @c EBk3sF@Az@ N4#!R;VU@P5!R?97 @AB-! 2`AyE5@sX6.F SYU5A@!33uTy@*7!aRQ79P5Ta*"@@R?|Z[`!aZ[@R[`ZO`")=>5 @B z V7`/@ߎ*@T4`+@BB@=?zS7`/@#BB=7zO7A{`7@(gW@`7!'Zq`?@asg`@g@3a?yT`7@tC`Z3@oCY F"BE!!DD F_9 @y<7T@҄`= Ҁ``=b?@T!5&@`f5*@g599OF @ @W`Y5@ @q@vT@?<~q @yC W*%N`EDR?{p@?F`V@7р m D@V*%N`ED#R `l@`L`;@7рr E@V*%w@`ED`#RBh! Nx@`I|`@7`@nE =`e7@` d7 @7 `c  }_A@!?3s^3@1`@\T7`[ ;}@7!|~sqX: 1!! =_ "R o#k@;@";B1?|#RC @@ } @`52@@@S֪@@aR.w*@7!с4B;B?|#RsEC @!@Z^:~a @*!!<_ "R ko7@sE@;@l +}+! !44r!@7!!!@7 } +"R`;? !!5k# osE@;@8}T2@!R,! !@:/_ "R }";B >;@@@7!}s"R"3?s:B9?  :? @:>"3?s:B9?  :? @:>"3?s";B9?  :? @:>"3?sb;B9?  :~? @:>"Sw?s B9p?  :k? @:>"3d?s;B9]?  :X? @:>"R? ;B@T@`72@#72?| ( 6";B>0 @,D`C@ !@4*@ =!Ea`=X6";B? 6y @B<?Ta@!xu? <@> - -*|@ @. /!|!7` ? | !!)B; $R ko R}C 4A!`6>sE#{{k{{Shw[{uA!*@6t7n@tA!v*@66s7 arA! i*@A}6q7TqA!` \*@z6o7G`oA! O*@x6Vn7:mA! B*@!v6l7@9 lA!@ 5*@s6k7" j!!4(*@z6vi7&hA! *@w6g7*@gA! *@Au66f7.eA! *@r6d72dA!@ *@u6b76ߐ`bA! *@r6Va7:Ґ`A! ڎ*@g6_7JŐ _A! ͎*@Ae6^7*@bu@]!!@=*@7!ѡ`[7.@ _c[!!=*@7!ѡ\Y72@X!!F @1ZT5F!!` @*X6VW7@`Y!!F @1aYT5F!! @*a[6U7jpT!! x*@Af6vS7R!! k*@7!ѡ!evQ7BP!!@ [*@7!ѡcvO7N!!K*@7!ѡ!bvM7@@b!!F @1AbT5F!! 6@*Aa66K7@a!!F @1aT5F!! $@*`6H72`H!! *@`6VG7]F!!@ *@7!ѡ^VE7@_!!F @1_T5F!!@*^6C7@^!!F @1^T5F!!`;@*]6@7@^!!F @1^T5F!!э@*]6>7@]!!F @1]T5F!! @*\6V<7@]!!F @1]T5F!!:@*\6:7@\!!F @1\T5F!!;@*[677@\!!F @1\T5F!!:@*[657@[!!F @1[T5F!! ;w@*Z6V37b2!! j*@Y617U 1!!`]*@Y607H/!!P*@AX6v.7;-!!C*@W6,7€.@,!! 6*@V66+7ƀ!*!!`)*@V6)7ʀ)!!*@AU6'7΀`'!!*@T6V&7Ҁ%!!@*@S6$7ր $!!`*@S6#7ڀ"!!*@AR6v!7ހӎ !!ی*@Q67‹Ǝ@!!@Ό*@P667v@@Qv`!!*@7!ѡP7z@Pd !!*@7!ѡO7 !!*@N67@@O!!F @1AOT5Fa!)@*AN67@N!!F @1NT5Fa!@/y@*M67@@N!!!`j*@7!ѡMV7R!!Z*@L67~@M!!K*@7!ѡALv 73 !!`;*@!K6 7&@ !!.*@aJ66 7t !!!*@7!ѡAI67 !!@*@!H67!!*@aG67`!!*@F6V7 !!@*@7!сEU7[BSA{è_`@ 7`` w[B!ѡAw6 *u@ 5w!!F @1@T 5Fw!!F @1@T 5F!ѡwV6!ѡw!ѡAw!ѡ!w^!ѡwK!ѡaw8!ѡw%!ѡw!ѡAw!ѡ}w[B҇!ѡwe!ѡ}wR!ѡAww?!ѡqw,!ѡAkwg!ѡewT!ѡ_wv6d[w6`Wwv6\Sw6Xߣ`S !ѡEwv6JѣE !ѡ!7w6<!ѡ0w65,w661, !ѡw6#  !ѡaw66 !ѡw6  !ѡav66 !ѡv6r  !ѡav66d !ѡv6V  $!ѡav66!ѡ!v6!ѡv6!ѡvv6!ѡav66!ѡ!v6!ѡv6!ѡvv6!ѡav66!ѡ!}v6!ѡvv6{!ѡovv6t!ѡahv66m!ѡ!av6f!!F @1@T 5FsTv6Y!!F @1@T 5FxGv66L!ѡ!@v6E̢`@ !ѡ2vv672 !ѡ!$v6)!!F @1T5F vv6!ѡav66!!F @1@T 5Fvֳ6!ѡu6!ѡuV6uֶ6!ѡu6!ѡuV6!ѡAu6u6{S@[`Ҁ@u}-T@shuR@ h5@7`uSA[B{è_{  \G"a@`@1@T`a@b @{¨_  { s@u @{¨b {$R"BFSARI1 Tb@_qaTc@7RSA{è_b4_q`T_ qTa@6:H`@v raT Ru@2RҢ@3s_ Ta@Q7a~@ D!!@@d"@R` Rئ1T@@{%ES[c}*k*@/ $@w _<$``"@!1T@u1b` ?T@A@!xuy7@6`@RR @w`a@"@A97"@A9`A 7cAR @Rc@`b`xa`a`"@ !!`&@7@7Ѡ"@@@!1AT` c @6@"64&@@ T @7} _^!@q` T` @QqT @aAJ @ @ < S@a 6 q@T @AQqIT@6֚F1 TQd@+6+@aAC!+@*`"@*c`RR1Z!!E/@"@cATSA[BcCkD{ƨ_aA @1T+!ѡ^t6֚Fd6֚FSa@Z!Ft T`A@!1`T !.N4tj&@ @_ ftG t@7@7`tG tG 6֚F)a@ {SЄ@a@7!aas4@1@TSA{¨_d` ,E!!@@C{#cES[d@ҢA@9A47@@L [a@*7!aq!!E@"@cҡTSA[B{Ĩ_!!F @1AT3sFMsR {S@|@Zc*a@!6qSA@{è_R!ass {S F@B1!T5F?*@A6qSA@{è_@@`4R!ѡFs{#cES*[6a@'N"BFqjT E'@@B!T[B*SA{Ũ_cY7 #@fZ@q7!cCLcLcCOZcCrcC@ C@BB@?T*!|b4R@K|@BT_ G{!@!K{__{cESBd@'_T@T@#"@E_AT" @_Tt TAT#@!1@T!E'@"@cҁTSA@{Ũ_#@sFL@TL C"S5@!T@a6@_{R {_ {@!T@6@"@? T@ |{_UR l_T"C`B_ T#xbcxxCaTD!@G!!@G!!`@{S@4`@ RSA@{è_q {S[*`!D?TSA[B{è_*[BSA{è^P{!ES @'3`@T@6a @ ]a @T #@@c1T@dh*J!5@E'@@BATSA{Ũ_ր@h*J!K@b7BqR{ Y!F" @T @ @{¨_R {S` Ú#aRSA@{è_R@`@7Ѡa@?IT `Rq{"SdC{BE[$@c4@E@gҀ<$Cfb2@@ Q? @<T@BQb2=:<=}W/Tf=!_9Ts`@=T'= L4T`bCdAJ K?`7T`'T|@kK@W@@!@cH`?|@ 3T5?X TT)?9 #TTK@W@ן!@|k.TҙK"} _a"[@W@"˟T->@TW@K@@`)TK} _O@ZKT>`T?FlT|kDRVsEt~@Eg@@Bҁ"T[BSAcC{ͨ_#=_  TH}B `b6`@bAG@;!CK@3 3@O@C! K}ӀK`Tkz@C@K@@!@cH`?|@ T7< TT+ T_TZC@_ן3@Z@z&`TJ}4 WIK#CYѿ TK@ ;@!@?c?@ y`TJb}# W` HC # TT FlTZzҕ!!˟kDsEIkD}W@KB@"h5sE7!cO!c[kD#cJ~C@@ h4!O[!['`@G5O;!G[C@B@"h4@TG@!@h4[@!@h5 6sE 6ksIkDsEkDsEkD|@`e<<kDRR{S[c*@<Ta@c@SA [BcC{Ĩ| šڛvCӴCX4`` @@ TRbsb~bK-Tbz`B ؚA"tz !^x4 aSA[BcC{Ĩb @"!}K SA[BcC{Ĩ_ {[AxdckHS?|@K TT3TsҚs T[BSAcCkD{Ũ_xHzx`?|@T`TZ4T!{tH`?|@ TT4sҚ!H!@`?|@aT T3 {ckY HS@xx[?|@ TTZ3T {sH`?|@a+TT3sҚsx T[BSAcCkD{Ũ_֘Hzx`?|@T`T4 T@H`?|@KTT4˔Қ#Rc@%A@7!Ay_ {S}@[D@ v}7}Ӂ aF`@SA[B@{Ĩ_֡@SA@![B{ĨQF@cT@6"@BT@B6D_  "@@D $D@@E DC_"@C B@#@# "_{ST@_!T`@u|@TTESA{è_ @`5F #ҿ@5{S}[A@v}d@! }Ӏ I`@SA[B@{Ĩ_֡@SA@![B{ĨI  {"@SE@'@0@@`!E!@RwTE'@@BҡTSA{ŨU4` @cG_!T4`7` @@-TTCu@!E'@"@cTSA{Ũ_ҐX@tGD!B @!'@~@c@@#@ @}a %@@c1@Tx"B!T@ @_)T @xa@!1AT__E{@!F!P{_{S @T@! 6@[ 7`@[@S5Sk Tcx @ @T?r@ T?rr@ Tr`ssTq Tc@9*$RX[BcC*SA{Ĩ_[BRcCkaTqTj[kT[BcC qTҁx**[BcCcD! @!(`@[BRcj[BcC w@ qTc@s@c@y*qTbqHTq TqT*qTdb<RkTqTc_Ycc{S @'m(g` @ `_qd@Tr TT@.@qlT, @!@ 1@T!!@cF!vcDR 1T@3Rzasm1T@a~@!3TRSA@'Cm{Ũ_R`@`@==jrT=@ R R=`bN N=D1ATOn n=O`bR Rn  nfН1T  {C ?<,TbT@9k`T`_Ta@9?kT` _Ta @9?kT`_)Ta@9?k@T`_iTa@9?kT`_Ta@9?kT`_T@9?kT_aT @{¨_*G`  {SR[ҁ@?T3@@?4qT(T?(q@ TT?$q Ts`~@?Hq`THT?@q T?DqT @`4SA[B{Ĩ_?,q@T @rT@rT R?LqT @R@6?T@@ @rT~@Rҽ @R@6 T@@ @rT~@@rT@raT@rT@@rT@r`T R R@ R @VR@5?mT@@@zrT~@@{BES!8C@'K4@,3>`5#@җR@hE'@@BҡTSA{Ũ_'E@D!!,@{S@T@ 6w @[T~:f,[B@SA{Ĩ_ ET[B@hD!=@e[B@[B@HR`  @ @!dS?@qT?qaT4rD 8T0@BT@@ҀTTT `TT TT@9#hc8x#chc8x#chc8x#chc8x#chc8x#chc8x#c`Thc8`x#ch`8x hc8x#hc8x# hc8x#hc8x#hc8x#hc8x#T_A@!D!g|ch</o#//!oocT'|Ӏ$zӡ_Thg8h$`"@9bT"@9b`T" @9b  T"@9b`T"@9bT"@9b`T"@9bT" @9b  `T"$@9b$$T"(@9b((`T",@9b,,T"0@9b00`T"4@9b44T 8@9`8_5@B~DB@\5@Tax`xx rarc cE{d@C !E@"@caT{¨_C ? T@c4qTqT@q TRgd@d4d@qTf$D*T?` T!?T#@qT!!B!A_֟qTfqTT@@?qT e@qTR`G@Tci@?q TfGTj@_qTc  T*$D?*fi5c@qd@zT?q TR#D!ѻ@?qT *$D`Td_qTTd_q`TcTd@qTqT*d@qATd@qT&`c*BE{C@!8T4 @Rc @, @!E@"@caT{è_ :Cl @@A0@!@bD{@!6B @G{_{*@ LTS_T@SrTr*ST @{¨_@ssRP@?<T@!@! |p{@ARCB}!K!{_  {A <-T[A` @{¨_`_8kTT` {~`{4{_{S!@E@/ T@@ 6[ @}c`kbC9FcR!EjTzs` T@!T@! 6tz3` @q+@sM T~ӱc TztATT`@ 5bCztffXe[BcCkDE/@@B!TSA{ƨ_6e+[ckDBD!8@D!9@[BcCkDD! 9@ TzsseE/@@BTSA[B{ƨkecCkD[BұE/@@BҁTSA[BcCkD{ƨk {S[q TR qTSA*[B{è_! R`46Rc7! ` 46Rc@8{S!<@;@ a@6SA{¨_!ag  {S[AA?@bAT!?)TT@T `~ӡ_?qTsRj `~BRSA[B@{Ĩ_wBsBR{S@[*c**`@#*҈R`@`@@@a>@****@:q`@@*a@7!aaqSA[BcC#@{Ũ_ROg {BES!8C@'8} 4#@a!`D@UdE'@@B TSA{Ũ_d/R[Bb!@?ATҟH Tj48dAR=`@427g>N[B!Bza(qMz`T?!!o@7@7Ѡ@![@`@7``g[B`@7`fvg`@7`fҬf`@7``F!`:@[Bp[Bof`@7`NA[BbJA_f҇f {S@@@ q`TqTqT Rq`TSA{¨_E!@;@`@ D)E)BRE!@=@xE!<@pE!;@h  {ES@'! >R7Bl@$hT"R.BsM@ =RRp 7@E'@@BҡTSA{Ũ_@@@?@R {*cE FRRa@B:T@qBE @"@cҁT @{è_?a5{cFKqLTS"J[*1`T"J5*[BSA*cC{ƨ`*^q`TqTASA*[BcC{ƨ__u*_@" cC*{ƨ`Rk?V4L@⏛_ Tazy# ?qHT!h9897Rk`kDh:8RkDw4qTv4LT@>kD!c  D {FcFS_DC@TWA[a@7!aASA{¨_@@1 T@Ee {S4@[T4@ @$RR T@1 T!`.^@5dB)fC)RƂ*@6[B*SA{Ĩ_`@@qaT@63R!AeE!>c@t^B)xNC)l@d**@7cCR3RdRdcC  {C;[E.?uh`ScN>@qTT4*@! ?Mw*?/oa@7!aҨ;@7!сadSa@e`@7`SA[BcC{Ĩ_*!o`@-j 4dd*R`?n{S@ @*SA#R{ès  `{! e? 4! ?`?*@R5 @{¨_ R_! T?@4!`;O?4!?J?4!E? 4!@?q R`RRRR {cESd@7#@c1@T#a@? T @#Cc5B;E. ?3@@h`@"@BT@B6A0@BDB@_!Tz@@?@ a6TDE 5@=dE7@@BAT@SA{Ǩ_Sw=`@5@%d"da@+?!T@+?!TV`{S[**a@?@q TT?qT?q $T?qATky @c9#7@` @qq?kA T*+;C**jTa{ss1TcCkD+@` @c@LTcC1@T` = q*=N!"@ N`=F1ZSA[B{Ǩ_` @qTqs @ **!{w1TkTcCRkD+@"@4@41 T+"@*`41cCZkD+@1T"@k4@Z4_1 Ta@1T+b@ AxaBRa R1T` =# "@b=`N N=FBRR1@T` =# "@b=`N N=F*?1@Ta @` =#xb! N"= N= Fy*AR1T` =# "@b=`N N=Fx1TTb@ Axa^1Ta @` =#xw! {"=N N= FS1T` =# Ѐ"@qb=N!*` N=FP1T"@`@s1 Tccc@* Rxdv>1T"@*`1T`= R!R=N"@ N`=F*1@T"@4"@*R*` R1TcC#"@c`@ 1T 1 Ta@*R1@Ta @**1`Tccc@*"@ Rdv`1T"@*`O1Ta@**1 T"@*`B1cCZcCcCkDE{C@@ TB!`qZ!E@"@cҁT{A_ <R  {[6@cS @#9FYTEa@@T@1@Td.YAT TB3@7@@1Tu&@1@T`@vt*9bRSA[BcC#@{ƨ_2vE4!D!@Wk`6TFu@1@Te2a{[c7@S @tkA+` +TkD+@RSA[BcC{Ǩ_֡@zss9x`jbQ_qT*q$@zaT =! q"=NsBsq N=5-[BSA$ @cCkD+@ F{Ǩs{ cEa@d@/#@TR!E/@"@cҁT @{ƨ_C;#@+T @Z4@@!1@T#C5CD!@4@@7!a'a@?Pq`T R_@BFF?cF$@BE?$B*_  {S!@{@4a@ RSA{¨_{@5J@R!QJ  {C;E.@?{`h`{SBxF[c@aTaT5RSA*[B{Ĩ_2@`@ [BSA{Ĩ[C @7``T`@T@@7!Fb!H! 5Rb@&@&7!ѡa`ga@*7!a`s @! @5sbcx_Tbzw*4&@cC&@7Ѡ`{`R  {*q T(TqaTERa!!@> @"ea R`B*1Z{_ֿ$q T(qT @"R`R1Z qT)TqaTRqR @R`Rڑ1Z @"R @RReR@@_@!1T_@A`@A0@!(@MD{@!B @2{_  {cE@d@_<(TE@@!T!@B@{¨ | s!F!3?c C @!E@"@c@T9{¨_{S[ck**#s@ LTs{:BmT xh@\qATR{TBTzt`@\q T )B1 TM)|5B{T-T{t21!TsE s@"@*`A 4 R5sE1ZSA[BcCkD{Ǩ_t@҂z`bA@?PqT!T )FZM)`ҁzh"@C@c1@TCx(T_qs@?j!THq T"@**`k1TC§k@ 7@7Ѡ@ "@*`"R1`Ts@@5R*1sEZsr"@*`"R )ՐM)1@T<Rs5"@B *` )ƐM)1`Ta@ )1M)T"@*`"R )M)1 T<Rs@ 4"@R`R1sEZqk_k@k@k@7!ѡk^k@@`7Ѡ^RCF@7@7Ѡ ^RC"@**` )l1@TM)<R "@R`R`1Z,sER)@ctAc8M9C5_RӀ {S!E[ck @"@g҂@@ @@k1/T1/TsB@cF@J@{N@W/GG@}@K~@|`# |`;K@#K*T@}@~@|`|`c1(T@1:T @@19T@`O@5!F!17Tc@B@c@@@ 1`6T`.@cCq=TBF@4@.@a"@@"@7@@"6@ `"@61 2T*11T`"@@$@~ T@JT @ `/7@? T@`.7@ ? T@`-7@? T@`,7@ TB!xw@+7| !R054= ;@=N N= F3@17@7Ѡ1@@ 5s:1TEg@@B T[BcCkDSADRsES@{ͨJ@@ @ @ @c`@*҃RpOAv1"T@T@!7a"@ 8@Q 8@"@1!TC@c@$|@?@`"@#|`G@`$|` R1T;@~;-@@1TGG@`"@c@~@BR`~`~`a R@7`"@c@~@`~`R~`R7c"@RⳀbF037@7р@`"@5C@@c@$|@?@`"@#|`G@`$|`aR1TsEEg@@B TSA[BcCkD{ͨ_@TGG@`"@c@|@R``~`AR;K;@1K@T}@|@`~`K[x;K@[@@T;@ 7S@)c@R1@T7^ 7;@@a TC@|@|@c?@@|`G@|`1`T RPs6Ҋ7\sE!R@`"@}@|@``BR~`a R81T@R@`7р\sEm\`/@4\/sEb\KC@`c@$|@@"?@#|`G@$|`a R1TsEMMGGG@`"@c@@R`~`~`RK_7_@K@ aT`"@|@@`~`"R~`R6BF@`7ѠA\>\r\ {S!@+1Ta@&1`Ta @d1Ta@1 Ta@Z1ZSA{¨_  { Z'a@ @{¨!@a{[6@TR[B{è_S3@azu11T!TSASAR_  { $@@&6`*@@*7!`.@@.7!`2@@ @{¨Vq![@27!A[[[{ @T@@6G'G `@1@T` H @{¨_!R   aR_{S[6@a@Tzu1TRSA[B{è_  {St@[ck@Tt@t@s{@R`~@3TsESA[BcCkD{Ǩ_R~@!5 Tza٘1 T@a@ #@`A"@ R݌1@ T6z{`z` #@"@@@!<@ pz*@6?1T 7@s 2F @ @Y@7!ѡa[ Cm7`@7` #@*`R1TsEZBтoZo@`@7`sE[sE@7рZsExҏZsEq{ X @[ @{¨m  c,BE{!8SC@/ #p@ 4'@ҏ` [G"CR9X "d1T/[BAE/`@BT{@SA c,_[4S@qTR4@447~өA7WA@qTD! @ӛ4[BAAqTD! @Û@ҰҰA!@  c,cE{[a@"R7 S1yA!TSA!EH"@cT{@ [Bc,_S4@Tj38L@@?T75VASA3@3RNA3SAR{RRS@cD!T@c@t4@!6"@b@"SA@{èSA@{è_!Y`@@BSA@{è¹ {S!@?TRSA{Ĩ_[b @cA@)1 T`@T[BcCb@A@1@TXRA`@ Ta8"@A@ @1AT[BcCR_bR_{S @[@'@!<@'@C'Ρ1T@'@`6@@7`@\qT1T@RSA[B@{Ũ_a@'ٖ1!T1aTAY'@'@"@"R R`Њ1T  {SD~sTPSA@{è_D!@SA@  {BES!8C@Wn 4@$5;@sE! F? @qsV`@1TEW@@BTSA{˨_2`sE  {"RS1**@*SA{¨_I2R @h9@QqT}@h9R,)X0_c T !AW  { @zS**[*Td@1T$4RSA[B{Ĩ_*+o1`T@qdD5!b.!AA4b435!*Q35b. R!R2`7xS52_k@T*AR265b.AqjT*!R2@654 !R|2`641@$q@TdqMzTD@r*!Ri26b.*!Rb2 6{ERE @|@@5!E@"@cҁT @{è_2Sa{CS[ck*1T3@Ҷ `xTMTB@{f@\qTATTmTBA{ty1 T!T; "@b" `aR}3@1Z{ASB[CcDkE_B!x`!@?q` A T @@?\qA T@O1@T BRTY{s @ D T5"@R`! RK1T!@51T"@"R`R=1Ts4R@R@4_ Ta@!@1`T~@91!T3@dA01T"@T5"@ן`R13@Z R*GR&R R{1T3@@`xTYsd01T4"@"R`Rو1T3@`"RRψ1T  {ES[cks7@?3qTR9RlT`~D>7@;bTj*57@!T;@z VR!E?@"@cTSA[BcCkDsE{Ȩ_ֿqT@qTRR0;RR4FR7"@9; z!47@`MT @9 _qT$@9_qAT"@9EqT;@! SS7 B; 7@z%>84qР! &&F %  d@ OI@D=?"T%@9qT? @T)D&!(Tŀ_ggxph NpӧxӁnbnDn!N(!%N'T=)?T%@9qT|qTqT& T TRIBd_ֿqIT T @9Qq T )  qiT R  T&@9' @9Q @9q(Tq TqRHzhTQqTQq TRdS膿r0 I )   @9' @9QqTq@TqRFzTQqhTR &r) 0   @9Q?q(T|q(Tq xS|qHT@Rq xS`RmT!@9&QqhT?<qTqT T @9aRQq3<qhTqTR{CSE[g&@h"@ks @ @C gNh7`@@L = C@c=NNADB@A Ng! S=S=/=r2T-`H5a"@"@ <@B@@_qIT <Gck{@@G@ 4w@ub"@I[BRSA{è_!BVCBBT][B@rATSq TqR!C[ @R҄Г B@@7!a[BR!F"@@_1@T@!@@7рQ[BRRRvT` ]bI@@ RS͢ T[BQI cQ[BR{Ckc$cw@ @ @s@a`S@[4@S**#5_1/T 1`/T41T55O@ `RK@R̂1`T`"@*`)1T@ *"= R=`"@N` N=G1T@1T @@ҿlT @|@$ T = =N N=q T T{ 51 T G1 TGR`"@!R`1 T@`"@`1` T_1TG*`"@ R`z1 T`"@*`؜1`TCcc@R`"@Rdv`g1Z{A*SB[CcDkEsF_ q`Tq!TD1TS@>1TE)#@'@f  N|@|`N|@`"@#|`aRN`=:1!T"1@TG`"@!R`+1AT @@Rxa;W1T;@W@n@ @dqThq@T1T@ R"=R=`"@N` N=G1T IS@ *1`T = =N @ N=KTKԍ1TG`"@AR`݁1Tu @@_aT@@_\qT1T:_1T <1`T41T5 5O@ `RK@R1`T`"@*`1T I@*@cRK1`TI*`"@ R`1`TIR`"@aR`1`T`CIFU1T I#R1TIR`"@a R`1T@i1 T @@ҁ*RT @;Gxa$1T;@G@: @J1@T@ R"=AR=`"@N` N=GL1!T @|@$LT = =N N= qTl T4qT#1`TG `"@!R`,1`T`"@*`1TG*`"@ R`1Tb"@*@`C8@cQC8y1TIR`"@R` 1Z IS@  1 T = =N @ N=T1@TG `"@AR`1TqTҌ1@TS@̌1TE)#@'@ f  N|@|`N|@`"@#|`aRN`=Ȁ1T1 T G1TGR`"@!R`1AT{{S*[@*[B`bSA{èSA[B{è_  {Su9 1 Tq,T G@ٟ!F#R*hD@Q5G@L@4ZFSA@{è_ R`9c@!ETBG!@ss@7!AlF@+9u9*@7р4sN4N{SGa@?TSa&@!0@87җ@6SA{èSc@`A95S#P@!7!|NB"a|`91ATC;E. ?!F"R`h`Ց![@O@7!ѡVOa[BеnEa`S@d@"c`j[B@6>NеnE@4Na[BNa`{ @S@!$@!~?0T`RR1T"@"R`R1ZSA@{è_`RR1`T"@   9? q$B:T@@R b@9d @9_\qDEzq⇟B*4__ @@Q $@@!1T_{[ @Sb@s1T@҃ R1T@1 T@qTR*rc )T?qT?qT? qT?q`T?q@T?qT`@ )cѥQ@dD@D `@ )cѥQ@dD@D `@ )cѥQ@dD@D `@ )cѥQ@dD@D `@ )cѥQ@dD@D `@ )cѥq@dD@D @T`@ )fѧQc Q@dh@D )@@ @D )Q`@@d @ D ) Q`@@d @ðD )Q`@@d @@D )Q`@@d @D )Q`@@d @`D )q`@@d @D T! RRM)@D|~_k T @Bhda7h$T@CvЄF1TVvR"@a R`~1T"@*`#1T"@bR`R~1T"@"R`R~1ZSA[B{è_`@ )Qc@dD@D U{S[vCcEkd@w@@@+@W*]l 4$@`RD@fRB~q_ T_ T_0 T@A9" 7B 7b$@U_s*Bz Td@ 7`A#`b< 7`@cA@eCc@@1 7s"*W*@7G@**7G@7G@I7***[MK@BEW@@BaT[BSAcCkD+@{˨_22222x&$@~ T2 {SS @a4bB@@B vЄFǔ1TsRs@a R"@dv`}1ZSA{¨_{**ХE @t4!E@@"@cҁT @{è_3&a@G@? TF`TyxD@hD@`@@7`L {B;cESE.?d@/Th`a6@F!@?$@TE/@@BҁTSA{ƨ_[%#C[^~DRL@7ѠHL#@FL[B"@F_D@T[#6@6C@~D4L@7Ѡ`*L#@(L[B6RKL#@L4@7R[B@  {BEs#@A@P@!TR!E@"@cҁTsE{٨_S[ck%c@@o?kkTcCS{*5wA[{V@c?`T@csTr@rrj`8j`8!*?@ah 8(!T@`p@ @p@rja<X 1&q T!?(T@@sE9V@4@s@4@`E94@ V@"@ *k`T@bsTr@rrj`8j`8!*?@Ah 8(!T@#Bp@>@@R@p?i-T@w@`p@s"sp@@`p"s@@҂rRj`805(Tw@s@ҁrj`8/5(TSA[BcCkDX@`@FV@@[BSAcCKA|H|@O"@ia8qTV@@ha8qTV@@hh8qT``8q,Ti`8|@I4h(8"ha8B klT RsyE94@V@E9`4@@V@kLFm@cRV@sE94@ s@5sCEC@V@@@F@/ @k@#@k'F@ЙR ckT!?8(8@EV@@ @@_qB|@B&V@*O@kT*'*O@@{Su*AW@: *7@) K?q*09E@q*T@ *TaQ?q)T@k)TcAj!8!Rk-*TC !#xsbEV@@o@V@_k T!@?h 8`8`h`8qTi`8|@4\q`%Th8V@ <@9h(8M|@K9*&*9C9 *@qT*D@9 ctQqhT A ÚT@`T!K!&|91T&j&8@kT*R&*@E"V@"@@ko@V@?kT"@?h 8@@CG_ITK::C@:G@:@*m&'qK@!9|$CzTj'8kDV@l#@@hp@(prj`8(h`8" j 8(AT@?@r@pjp@@wp@*p qs"h`8 i`8"" j 8(AT@r@r@ soTU;o@kJT{~;@3j{8|~@!h`84 h`8j;8*&qT|@!`8!4\qTj8b8F|@5 kf8`5*Ds C9C94V@@@o@k*T`~j`8 5*Cs 4@o@k T*%\qDzT**KD*Cs C9C9x4V@T@@9o@k T`~c~@Ak`8 5*Cs **D! !TF 9*)C@q@T@TcQqTR\qaT@R@9q\qTRZ u4T@Xo@kJT*%\qDzT*Cs V@a~@ @ha8*h!8"jb8q`TqTV@B@qT@h!8x9V@@hb8@@9qYV@!@"hc8*"h#8j`8?q TV@a8a@"h 8j 8`8*?N?@EV@!@"h|8* h<8j{8qTq`Tq T"ѥ`8che8@he8 94 R@y-V@@h{8V@@h|8BhD{SA@b@T@HM5@0@`H7`@1@T`SA{è_ր@0@H6$vlF@I`@1@T``@1@T`@H@7Ѡ@!xD!@ M 4y"@7Ѡ`&H@ҹ!H@  {` (@Ry1T`*@a* @{¨_ {SyH@!,B@_TB;E. ?Th`H5~]a@!@ ?ִSA{¨Ht]a@SA{¨!@SA{¨_ {S@a@qZa"@!@kA@B@k!"@!@kA@B@k"@!@kBA@B@k"@!@kC@A@kca@b@k"@!@k|}BR$` @@7 `@ @A7!@F@?R e*@qmTb@  A@$x?q(T#|cc$#7qT?qTB_ATs@SSADR@{è_AzaA BSABAT@_  {S @T@ C6[ 7`@QqhTb 7`@7" b"`7` @7b b27`@ 7bB 7`@@7 bR7`@7B ~Tc@~Tе4b|7`"@`{7b }@z7`&@x7 btw7`*@v7 bkt7`.@@s7B bbr7`2@p7 bY@o7`6@m7b Ql7`:@ k7е" b"Hi7`J@`h7B=cB^g7`*@e=cbT d7`.@bc!` K`a7е b$ `7`j@^7b!}]7b! w`\7bB!@ q@[7b!k Z7е"bX7`@`W7еbb V7`@T7еb`S7`@Q7bP7`@@O7е"bN7`@L7еbb@K7`@I7еb"H7`@G7еb2E7`@@D7bBB C7`@A7еbbR`@7`@>7еbb=7`@ <7еbr:7`@`97еBb 87`@67c`57`v@3еc27`z@1еc/7`~@ .еbb2s,7`A`+7е cB*7`@(cb! @'7c! y&7";cq$7`@ #е bH!7`2A` 7b!@@7c"!Y7cB!`;R7cb!K7c! D@7c!:=7c!;67c!:/7еb@7`A7c"!)7cB!@/@7cb!`7b7`A` 7еb 7`A 7еBb` 7`A7еb7`A 7еb7`A`7b"!@|[BSA{è_D!@@D!@C[B[BD!@6[B[BD!@)[B[BD!@[B[BD!@[B[B[B[B[BD!@[B[B[B[B[B[B[B[B[B[BD!@Ԩ[B}[BzD!@Ǩ[Bp[Bm[Bj[BgD!@[B][BZD!@[BP[BMD!@[BC[B@D!@[B6[B3D!@[B)[B&D!@s[B[BD!@f[B[B D!@Y[B[BD!@L[B[BDB!@?[B[BD!@2[B[BD!@%[B[BD!@[B[BD!@ [B[BD!@[B[BD!@[B[BD!@[B[BD!@ק[B[B}[Bz[Bw[Bt[BqD!@[Bg[Bd[BaD!@[BW[BTD!@[BJ[BGD!@[B=[B:D !@[B0[B-D!@z[B#[B D!@m[B[BD!@`[B [BD!@S[B[BD !@F[B[BD!@9[B[BVcDB !@)[B[BsD`@s`4`@![BD!@[B[BD !@[B[BG@L5[BD!@[BD!@[B[BD!@֦[B[B|D!@ɦ[Br[BoD!@[Be[Bb {Sһ= @ABCDESA{¨_  {S':*1TRcSA{¨_U@sD`@ר4`@!}G@˨@4D!@o{S[SA{¨_U`D!`@YBE{C@Sa@5@?hT!E@"@caT{¨_G!@ {@!T@!6@"@? T@ |{__`T"C`B_T#xbcxxC!TD!@f!OR G!@@XG!@P@"(@ 4!@$ (@a 4@@qZ"@!@k"A@B@k"@!@kA@B@kA"@!@kA@B@k"@!@kbA@B@k"@!@k$Є@?R(@qmT @c'  @q(T|bB$B7x_qTqT!?AT@E_!@"(@4a @(@4!aTB@H(@4T@@1T " @*F  {ES@/!FT@!T@!6#>;@R5!E/@"@caTSA@{ƨ_ D!@={cEckb@G[D@? TZFcS @T@xt T@!T@6/@"|>k@@5 72SAR[B!EG@"@cҡTcCkD{ɨ_S[oSA[BD!@ߤD!@פD!@Ϥ[B{cES @@WғBA;4F@A<T#@:5 @[BA` A@ 2A 4"5!;fT*@7!9847@  m`3!`;TT*@7!617@ l 1!9BT*@7!2/7@ l.! 0T*@7!a/x-7@ l,!:T*@7!a,8+7@ l`*!; T*@7!)(7@ l (!:S*@7!A(&7@ l%! ;S*@7!$x$72@ "BF!` S@#7B""! S*@7!X!7 !S*@7!X7!S*@7!AX7kBB,` ?LT! S*@7!! 7A` @! 4>>>->>}k!` R*@7!!6[B^>>>>>>o2@#I@`4@B?[&>K>6>2 @   {BESR[cCC@?@ӂ`@%@.`@ӂ`@%@%` @ӂ`@%@` @ӂ`@%@`` @@ @ӂ`@%@` A#qmT Ղ9Ҡ@%@%@ T@xss_9 ~ӂ%@ '(@@T@!xu+R@hFT`_q`TւRٶ#@~'@~E?@@BTSA[BcC{Ȩ_#'#@Rk bB1?|#RB ӂ`@[%@`  'R߷(@?q T!Q @!|(haEQBQ_q(ŚB㇟BRb*|qC05@R_ @@_`T @$@h!@} ԠD{@!@E{_{ХES[ @c!F#?!@?7X @@!AT@7!r*1`T!FE@?@@cTSA#@[BcC{Ȩ@cFC_;&Ta@7!aa@!@ ?֠E?@@B`Tp2@@`@!@ ?!,E!@4!LDB!@~[BSAcC#@{Ȩ_{ =S [=N @ N<N<N cҷFk@s"3{F+TcCkDsERSA[B{Ȩ_`C @xe1T`C1T`"@%@A R1TTT` @"`@1Tx 9F@ T @ 7YTQCqKTTsd{Fa% 7C@@1@T<<Ts1=T1`1T=*[ R<N<N&j1/T`"@*`1/T5*pOCR1-T@|3Rd"@@a Rv`8@Q8j1`+T@+*c@ R`"@dv`i1)T @@6@*`"@`P1(T*@! R`"@xdv`i1'T`"@R`aRi1%T FrO#R*u1$T_+TR@Rc"@^v``d8@Qd8i1"T`"@*`1!T1!T`"@*`[B1kDZsESAcC{Ȩ_ @A xa = =@N N= `"@4@41@T}u1TFR`"@R`i1TF*`"@AR`~i1T`"@ @`@9?1TFR!Roi1T`"@*`̓1 T* FpOR1T@R@a Rc"@dv``d8@Qd8Ni1T`"@R`! REi1T`"@*` RU3:U3@!RRS) 1!T5`@@ |@D`kT{"!B{ RRRkT@cQ`5cco) c@o@R@7!cYB_s%3sEwsEpsEm  A;{E.@? h`@F{_  {ST`A`A`TT`AR`4 Rt`SA{è_d`"!R`A@`C` բBE{D@}C !E @@"@caT{¨_ @! _+T _TB|Rb__B{S*1T*@R@Q|&Q&@`@d#kTRR@s"`@aSA@{è_{B;E.`?STh` D!,E!@<5`@7`SA{¨_SA{¨4{@ @?`  @{¨_`@7``4lF!&@v{ @[*E8@@7҂5R!E7@"@caT[B{Ǩ_DQc҆|@@@_(q@TSBAziT*@@8]1T*1Ta"@@ 8@@|@SAcC"8SA8cCeScO!E7@"@cҁT @[Bc'cC{ǨSAcCS;  @!Q?TqTB&BHa8a""@_@@_֠D_֠4F_֠ E_֠G_֠E_֠lD_֠E_\{D@S*[qHTqTqT TqT @R$@a R`e1Z, q!T@R @a R`e1T4 @ R@*,1@Tw@WR@3s?-Ta@eb~@1T@ q TRSA[B{Ĩ_֟qTA@ @A45@R"@a R`]e1@T@R"@! R`Ue1@T`@@CF|1 T @c@DRDy1@T @c@dR=y1Z@`BRa R6e1AT @5@R"@!R@`Ra R&e1`T"@4D@$R @a R`e1T44@BR"@a R`e1T @'1Ta@"@?q T@R"@!R`d1`To=`@BRa Rd1aTT4"@@ 8@Q 8w@@@`BRaRd1T@CF{1T @#R1Tb @`C5$@R!Rd1@T@R"@a R`d1@T@R"@! R @`5@BRa Rd1`T@R"@!R`d1 T@BR"@a R`d1T,  {S!@A` = F=NC N<N<NL{1Ta @mp1@Ta@@RSA{¨_dp1AT` = F=NC N<N<N.{1!TOp1T`R  {@@@ @?`~9 @{¨_`@7``2lF!&@tA;{E.@? h`@7F{_րlF! (@s{ @T`AbA_TaC!Qa5aq R @{¨_R{`T{CClF!(@s{_{SDa@?T@!@?ATb @hTTSA{¨X@5SA{¨_ց@#`4 @{ @ bR @{è_  @7B2R@  { @S`bRRc1T"@R`! Rc1T"@"R`Rc1ZSA@{è_"@@D $D@@E DC_"@C B@#@# "_{D;ՃcFSE.?[ ah`fm9a@7!a[BSA@{Ĩ_1{S@T@6 @T@` 6&@ T[5 @@T@ 6"34c@?T@b@?T!șc@`?@a7!сq1[BSA{è_[BD!)@[BBD @!+@@@b@q[BDe@!+@@d[BBD @!@*@@b@Y[BDb@!)@O @?#_BЄ_B?@DT`A +0@!4FT@!1@T_{S!@1@T`SA{¨_@@?TSA{¨ 2 5e6{SEi@1@T`@1@T` SA{¨_  A@(@ @7@ւ@c@cT@c6B@D{@!,@ؔ{_{?q!F{ _ {S1"a@!@?TB;ՠE. ?Th`-15` @0`@0fCSA{¨U1` @0`@0SA{¨YCSA{¨_ {cESb@07a@` @@qT"tFb!E@"@cATSA{è_`@AT"?TG! -@qD qTE  {`.  BE?$@F@'҆@'ReB-f'' 4@a'@`@!4?!TR!E'@"@c!T @{Ũ_?ATRbR?`6D!-@qqD!.@iqaR~aa-TG! /@Yq @RAsr|!_{B;S[E. ?ckYh` T!RaR&q* @zT qT[B*SAcCkD{Ũ_?`7TTR"R*{*@S@!@P[*? TԎ@)*@qRƔK Qt**R*R*RRSA[B@{Ĩ_!`Bʘ1T  *} _q@T_qT` _B5 "A?!_T _T6  {S*@BT@6"@BT@6#@[@!TT qATT[BsFSA{Ũ_TqT`Ts4*Tq` TT sD` QqT qaT[BsE T@}Ӥ@c7h`h`T@#1@T@1@TBR)@*7!@7!?qTT @ @#@cC @ @cC#@JT T qTqT@}Ӏ@5hvhv@1@T@1@T*)@7!ѡ!@7р[B..KTT[BcC#@|..[Bu { a@b@_T `` @F @{¨_րlF!0@o{[S @BRJT@xtc@c1@TcW)*b@@b7`qT@T ҺN 5FSA[B@{Ĩ_րD!0@oP.  {SR[R*@?kT$7@@c6s6`@@`@@RSA[B{è_ { /@6 @{¨_ @{¨%! @{¨. { B@T` @!F@_@!1@T @{è_1@`51Һ\5   @_  { @o9 `@l9 @{¨_{ _T`@@!T@a6a@B$:7F @{¨_C 1\5,E@+@49B5!1 1R BR@$_kTC6B$qTq@!R@zAz@Z_@kT_B  {S[a@E@' T@ 6c7?@ Tk/ @TT#@?*1 T`@V?qTE;ՀE. ?ARh`@+!E'@"@ҁTcC[BSA{ŨGcCR!E'@"@cTc8WcCSA[B{Ũ_cC`aR7 {S_2a6@`"@!Qa6`&@@4$T @!xt`&@a"7SA@{èQ2"1 {S!@ @hq TPq T`.@ 5`"@4@41`T@*#RA1T= `"@Rb=`NA R N=Cw^1T @A@ "R"=AR=`"@N` N=Cf^1T`"@*`x@1ZSA{Ĩ_Gj1T= `"@Rb=`NaR N=CJ^1T@R @@!T@6MT= c2=N N= C1T @ @T Ձ!TE{B`4@@?!FT{_֢@!GE_D@TD!`3@m { `{`@@7!A `A@ 6`A@7! `A@7!AE,`A@7!A<,`A@7!A3,`A@7!A*,`A@7!A!,`A@7!A,` @@ 6 @{¨7! , ,!a,,{@ST4@@aSA{èq{è_ւ@@?@@!@8@`@ 4̋SASA3ŋSA {S[@a?JT` @@qT`@@7a @ja@j!Ab7sSA[B{è_s+ {@?T{"K @#}A@hc!1@TA@h#7!R{_֒+Ea!@lрE{CS@OC_mT?@A T3@`@T@6RcHQ_qTsFEO@@BҁT{ASB_@ 5T5C@@941A9BEqFҁ!FB`b;,,@8`@} A9ҁ!F5BE3@ R;@ YC@@9 4'1'@A9BEqFBBF @7 @ҢA9BEqFcFBA9BEqF҃cFBҴ#@4&R .*RFK@a@!T@7@B-!14xju@URT@Y*@\@1*7@N{@  @{¨C6 ?{ST@@7 @T@ 6!E! T`@1AT@`@@ TjA*`5=a@` @"S_qDmT?rT?rba! _8_|qT`@6SA*@{Ĩ__8|qT @9|qT @9|q!TZ*`` j*D@@! 5}a@W@`@1T`C;ՀE. ?`h`@(OC`@@TF!5@k`@@7`4*  {S`X@[c5`Cr1 T`"@*`R[1ZSA[BcC{Ũ_aH@k8K?kT2@!8: @}*1@T`"@?qTA*R_1T`"@`[1 TJ@Z@`"@} R`[1TkDA*B@Yd"@*D>@@A!6@7ѠkD)kD{D;SS@[E.@?֖h`5aр"(@@?a@7!aa)&@&[BSA{è_`@7``){S @[ @?qT@ @< S r@TSA*[B{è_ց! Rb"5!8]"@4"@D@@!@8dAAAAu{BES@@/#C9d4+@"@@T@ 7`6 D*1`T?qE!F!E/@"@cҁTSA{ƨ_[6`cWD8@Tzt @T@61@T5[BcCE[BcCF[cDB @!;@[BcCcD @! :`@[BcC  {>YH{_{ES[䉏cD@WғsFO Cy#9I43@T7@!TD/@ R!EW@"@caTSA[BcC{˨_C 5Rc5R{S!@f1@T`@ a@B=R="@N` N =B5RZ1ZSA{è_ARZ1Z  {E====#='=+=/= cCR @')y>!E@"@caT{Ϩ_G  @ T(@cT{@IS_rT_r @ Sr@Tr !&qЃ *oN_qAT@9kTR{_ *bN* *]NkAT? kaT *|pqR_&@@_ qT@ R_PccP# *T8N* *3NkTc@y R {SB_(Ta@ @T@6b@@@T@`6 lTSA@{Ũ;` cBҍV@5SA@{Ũ_` @1CFd@C7dDT4;C@!5SA[BcCkDsE{̨_{ qTMTsklTTR?K Tl@%!֚? T*H0 @@@rTrcu?TCO_FC@O@c˘@@ˀk TTskTK@s6!T@_@@@T;@bOB|j~O@@@!! Ӛ?jTG!@<@g@{@{55{@5|9S@;{kmT7@**7{@@F*{C{@@@7@#yFR&/@@FRf0@@@h;@~COK@sT ;@**;@@{@@57@**{7{@@ R{s)*K@**K@@{@`47@\#7@{V#@{@@rT@7r 7k,T.T7@{A#@{@@ra/T@7;@**{t;7@**m7{@@%;@&#ҾF@ _1@T Ҧ;@#S4&F*.C{@@kTK@**BK@@{*.@@${@47@" K@"҄@rTS@?qT?qTrT@CFC@RkT*C.C@RҢC@@7 W RRm;@bC@CO@BX@@^`4C@@@=raT@7qT9rT@C\C@qT/@7$C$C@_qT *x5*sT T"@?kTK@7q"7@ ?7?* *x5xsT T"@y?kTy!XT**@ qT@ qT@@y@yATv+T*A.@R@{@rT@;@~W~C@K@V@W@#@*OFb@cˠ T/K@ T`VSS@#qT qRhR*{-{@@` R{s)*r5;@!7@!|K@**K R@@{ RR*- R@@R{r 7O@*@ID@K7@;!;@H;@C!C@A! T@?kTT@ *BB%@y?k TaTAMT*s,qT qT@4R7@**{7{@q@T{{@7h R{4RR|qTRw`4RRrqT qTkRgRdqT qTR]RRY  { ]+@&5 @{¨_ уcE{CSd@/#` @B?Tb@@@T@6aTcFa @S+|!E/@"@cҡT{ASB_rC` c@ЀB-!<= }T@#@4҄@/RFR%RCaR_{SuARaRczuр"@`= `b=N N=CT1TRSA@{Ĩ_  {ESB@__T[@@T@@6O TF```=r 5^@@5F@+@@B;ՀE. ?@h`@6B!FT[BE_@@BTSA{̨_ր =C"үQ`5[[B'@R[BvFR@57@#?@+@```=5`FTbB@ !< =Q|B-!1 =G|[B  @P@`R_@_{@Oo@y@K*<{_{eQ0q T`DqB!>B?@B!?{_+He8e&֟qR @AR`S1ZqRbRqERRqRqRBRqRRqR"RqeRRqERRq%RRqRRqeRRqR"R {S[ckz@Uљ"3ҵ^SR` T%{s@\qTsQF5"@*` RS1TBjTzss"@_\qT}_1TRSA[BcCkD{Ũ_*E R&5TWT"@`uS&R1T!@һc?sc`l @A@B!1T@ _A@  `E{S[@O# T_ T?@C T+7@T4@  TssFҠT T@1@T@@T@ 6J@4ssFa@#5Da% 7ssF@a!(ETTZ!<7-E@7Ѡ `@ 6+@`Fa!EO@"@cҡT{BSC[D_v@V@4`0RfR%RҟA@1T`DB @!@J!+@5@ssFtw`D! @b+@һT@1TtuF6 @k@`D!B @@!TZ`D!@ `D!@Wb ,@B!;S`'4! R/7@!3! R$@`4F?!T @_TccFb_-T$x`@T`D!@@by+` C >!<7RRҔY {S [@"=` =b@N N=_`qAT D$Rc@ f1@T= Ё@B=N N=]1T D@$R1T` = a@=N N=?`q!Tc@SADR[B D{ŨeT_TqTa@]1TD"R"@R`Q1TDh"@C Re @A%h@1T?TqTDg"@BRa R`Q1 T"@e @A Rh1@ZSA[B{Ũ__XqTa@]1@Ta @ @lqT]1@TDBR"@R`Q1@TDBR"@R`Q1@TDR"@!R`Q1!Ta @"@3@D`nq@ TbRa RtQ1TDBR"@a R`lQ1TDR"@R`dQ1Z`D!@@ރ@ @ 1@TDbR"@R`JQ1@TDbR"@R`BQ1@TDbR"@R`:Q1@TDR"@AR`2Q1!T! @Ra R)Q1 TDbR"@a R`!Q1 TDBR"@a R`Q1 TD*"@R`Q1Ze{S@?@5`@`@`@ `@@SA@{è?4SA@{è_?`4? 4{OccE[uFSb@/Z*5Ra!E/@"@cATSA[B@{ƨ_ABx# @7BR {S[6#7a@7!a[BSA@{Ĩ_ {S@[*T@6 @T@@6 T @@Q7@qTT@9`@9?kTa.qq`Ea!Fk@SA[B{Ĩ_Rҗ_T@9 @9ckT!*455`Eqa!F@qTqTa!EqbBF@ Ђ`Eq`TL Ta!F 4@a!EqbBF@ a!EqbBF@ _qTLT_qlT_qT`Fa!F@ЁNO@4 QqhT7`@T@ 6`hF"!@5@T@7`@T@ 6`hF"!@x5`DT҆`Ea!F@}@z{7@S@MT[v@@4!pIa@7!a![BSA@{Ĩ_[B[B@`D@A@!T@?dB@ @e @$ @c 3! [B@`D@C@cT@dB$ @c 3!@{@S@`?`5@`?5 @`? 5@@SA{èSA@{è_ T{@S`? 5@@SA{èSA@{è_{S[c`@R|@%mTa{f@@1T C%a@7!aa"@*`RO1ZSA[BcC{Ĩ_ {"@SBT@6@BT@6SA{¨!@ 4a@@7`?T! 4SA{¨EqSA{¨_ qAT@ @a@!1AT__`D{@! ^{_ َ@41p${R{_ {! S@@7a!D[`DB $@@`xF! 2s`7bBE! B@*s`7B4"3S@73I*7"4? `7 @45:  7 @"5+@ ߕ 7 @5! Օ 7@"6. ˕` 7@6 & 7@"7"@7@77@"8`7@82 7:@"9ە6@7:@9ѕ>[B|SA{è_[B{S@T@6[tb.cbubBTE;`E. ?RҠh`@tn@@?ATb.bt~SA[BcC{Ĩ*[BcCSA{Ĩ_!n@jT{s@{3Ab7s_8˳s   { @@V`@`@`&@ @{¨{S1+r*@*SA{è_  {I;jJE==#=`E.?C'=+=/=3=7=$RE@/'C/ ) i`@(a!E/@"@caT{Ѩ_ֹ{ @w`@u`@s @{¨C  {@C$R`?{è_ { @:Z`@X`@V`@T`@R`@P`>@N @{¨' A;{`E.@? h`@@ @ @{_ {*dЄES*!@?Ҁ 67OA``I'@*C 3s;5ϊ7@@'@+@#Aˡ7C@'@5a!E?@"@cҡTSA@{Ȩ_1C@? qT`D?qB`!@A\'@@7!!"?qT{"a!(G B;`XFһ `R @{¨_R_֤  {S 5N@@ @!yI`@N@1@T`3SA{¨_`@1T` { L@`NOR @{¨_k {@S@`?@ 5 @`?֠5@`?5@`?`5@`?5@`? 5@`?ր5"@`?5&@`?@5*@`?֠5.@`?52@`?`56@`?5:@`? 5>@@SA{èSA@{è_{S{@?TKSA@{è@ @!R@QA)SA{è_{(`{-{_ {S[c_ TT @! sT@#y}4jyT@1AT'7#@SA[BcC{Ũ_ւ_T9 #B}! #B}j9#@`E!@@t[@#8@7рT @!3``#ҳH5o-` @A`E!@M[ @{@S@ e@@UCb˔҄딢_+T`B5a @ R!"@ba!aSA{Ĩ_R_@R`R` bA@ෟ{$@T@ 8@c@C @{¨ָ^{¨_ր4@A@#0@Cc@a!E!@#aT,` @{¨q@\y @@ Wy @ @ {S@a` @a@` @t@@ ?ր@7рSA{¨_SSA{¨B=`{ .5 @{¨_ր`{S @a` @a@95` @t@@ ?ր@7рSA{¨_"SA{¨   @4 :M {!!?{|_@4;@ {S[c@ `G@@uR]!|@hGs*`G '@7Ѡ@`@7` "`@7``@7Ѡ`@7`ҁ!ْ5!Ҝ5!Җ 5!BҐ`5! "Ҋ5!@"҄5_ҁ!b}5!w@5!"q5!Bk5!@e5!"_@5!BY5!S5! M5!`G@5!A5ҁ!:~5ҁ!3}5! -}5!@'@|5!`!{5!@z5!z5!@y5ҁ!`x5!@w5!"v5!B v5!`u5!@bt5ҁ!s5!s5!b@r5! q5!@"p5!p5!ҿ@o5!ҹn5!@ҳm5!`ҭm5!"ҧ@l5!Bҡk5! bқj5!`ҕj5!ҏ@i5!҉h5! ҃g5!` }g5!" w@f5!B qe5! b kd5!` ed5! _@c5! Yb5! "Sa5!`BMa5!G@`5!A_5! ;^5!`5^5!/@]5! )\5! #[5!`[5!@Z5!Y5!@ B X5! "X5!!@W5!`!bV5!!U5! ""U5!@"B@T5!`"S5!"bR5!"R5!" @Q5!"BP5! #"O5!`#BҽO5!#bҷ@N5!#ұM5! $ҫL5!`$ҥL5!$"ҟ@K5!$BҙJ5!$ғI5!%bҍI5! %B҇@H5!`%"ҁG5!%{F5!%uF5! &o@E5!`&"iD5!&BcC5!']C5!@'W@B5!'"QA5!(BK@5!`(E@5!("?@?5!(B9>5! )b3=5!`)-=5!)'@<5!*@!;5!@*:5!*B:5!*@@95!+ 85!@+75!+75!+@65!,55!@,45!,45!,"@35!-25!@- 15!-"15!-B@05!."/5!@."һ.5!.Bҵ.5!. ү@-5!/ҩ,5!@/ң+5!/ҝ+5!/җ@*5!0Bґ)5!@0"ҋ(5!0"҅(5!0B@'5! 1y&5!`1Bs%5!1m%5!1g@$5! 2a#5!`2["5!2U"5!2O@!5! 3I 5!`3C5!3=5!37@5! 415!`4+5!4%5!4@5! 55!`5"5@4`=B55B8`B5a5B 6`"5bBDA!B@)k7!`6`&aw+!6k 7bD!!`c7`b'A8A@AHce!@7 k7@bB@!7`'d@baS!7j7! 8`b(aG!8j 7@!`(A:!8j 7ab) a)!9j` 7!@9`b*aN#!9j7`*'!9j7@@s[*  :/`:3Ҍ` B@3@ ?`4@_ 35b@Ab7aBcC[BSA{Ĩ!:BQSA[BcC{Ĩ_"GYDu  {[cP-ScP@T )@B(1 Td@D7dSAcC[B{Ĩ>u@7` SA[BcC{Ĩ_  @!@ {cwFk`E@@?Z4A;`E.@?S8h`[5R @5, @= @XE?bG@H@AvFi|-sBqTt`"ȟVTBЍ5B̍5*ҷKB@a6B@!6ύ @͎>qJZZ?q T @CtEdCRCR5 @@aT0@?IS+2Cb!RChjG2C?qTo`D@@`FFSA[B`E?@@BTcC*kD{Ȩ_S[P!Qj!54C?4N?2C!R@I@R {EEEEE`.!4!/ {@SST@D@}B@s:NcӂsB}! ?cTs}a SA{¨_SA{¨ccE{S[cG`@ W ? TR @r@ TrT`E@@BT{BSC[DcE_֠9@97RBBFAh`!1TAh ksCkys9<{C{;c R c@[@Gg@o@G@T9@965F*q Tq!TG@qIT@qTR/ 6W@JS@HkFsGҤTF@ _1@T ҔW@8S@6 kFsGs@**cB[@Gs_@#C@ c # c5[@g@@@g@s@qTR *cs@[@Gs*Rc R_   R_   R_   R_   R_   R_   R_  {$RS $=a@b = =CN#@NB NA!E N"@/ CW1T` @ BCcF$RcW1@T"@#C+A M@4 B'@$RW1ZA!E/@"@caTSA{ƨ_@?aT@dO1 Ta @! @^O1Z R_  R_   R_   R_   R_   R_   R_   R_   R_  {SU@_TU@SA@{Ĩ!`,k@5SA{Ĩ_@F@@APg!1@TAP'@@H@`,#H@5@{BB4FSTSA{èb@ @@? b`-T$xb@c1@Tx"B@7р`_@SA{è_ր@7р@@<@@@SsFaB@ Pg1@T P'sBsJ@{ @T@6`"@06`@r`T@7``@1@T`  @{¨_@D AR` q  {  @ @{¨# {S@"@AT@6 @`T^f @eb`x"B_Txb@c1 T @ b`?*Txa@@1@T@x!!SA{¨_A!4F_T@1@T@DaB @!<@tGF@@ Pg1@T P'@H@c@BB4FT`@1@T`{cAc=! @ , 7`@@!1@T @{¨_{D;ST@[`E.@?֖h`F`5`@a"р?&@!&SA[B@{Ĩ_DE{CS[c+@?҃?@B,TY@=/@!6T9@ T@W @T@` 6R?A TTF1ҁ6*`45R3ҥ>** 7@E?@@B!T{ASB[CcD+@_@7р#9T@Da!=@eQvҁ6`5@Da!?@XQaB-!`>`>i @*6 @*7RRR!ѡ3ҍR3Ry@YЄ@8`+RFRR0@ҔЄ@8`+RFRR/`Y {R @E@JCӿ T+C 4*R ? TC4T +( 5R'9"T9 ++`9}@k!TR{_`Mѥxi5*!Ú  aT4|Sc5e}@q)Tc QbT'9!H)tR u@u}S!Ú  Tcx_@zB TK@G!`@PC !R Úc#9(RD5@Ga!?@PtR{Ss@[ @b`sa R@1TsC!R"@AV1ATRSA[B@{Ĩ_{@BT@6@?bT @xa{_ R n@EA!F@!DDE{CS[@7C _ T?@B Tc@@T@S`@T@ 6R TV֚F15*45R a @**b@7Bb @F!TcD@E7@@BT{ASB[C_vT55@Da!?@OcDc|C@8%R,RFR.u@UaB-!`>` hcD@7!ѡcDW@]* 6cDҬ@V*@7RRR @%@T@6T@6T@D{a@! @ @Nr{_R_{A!|F@S_!T@1@T`SA{¨_A!F!I@!`SA{¨c.``Sl@7р`Sb@@T@7@DaB @!@r`@7``  Ձ {$S[*6R 4@9KRU 5|@҂@9_kTs?AT@ 3~?ᗟjsT`}t~@R)& T@9@95B ctqT*4#q!Z!"RAK!|@% SA[B{è &XQatc^A*@F 3_@Ga!@@NSA[B{è_(*)("@)HBR_q㣃  {c @[*@s#4@!`B6|[@1@Tky 1@Tz 1`Tx81Ta@SJ1T`@ R"=R=`"@N` N<N<N>1T`"@*`A R>1T`"@*`3Y1T**Rl1Ta@ `"@R`!R>1@ T@~@@@? T @ cc@R`"@a Rdv`>1 Td"@8@cQ81@ T`"@R`!R>1 T`"@*` R>1T`"@*`X1@T`"@*`! Ry>1 T`"@R`aRp>1T`"@R`!Rg>1T*1@T`"@*`XSA1kDZ[BcCsE{ƨ_@J1TSAkD*:1TSAR@6?Ta@>1 T~@:kD9kD<`@_<T{B@@ 3ss~b_(TsRA!Fs"a @{¨__  {S@DЄFa"@T1T`CDЄFT1T`CDЄFT1T`"@BR`aR=1ZSA@{è_ {[L еB&SRZt@l+7`@р7aA$ SA[B{è_@`7 SA@7 `@7`SA  SA  {S @c`@1`T[c@**aRtTv=1 T`"@BR`Rv=1 T`"@*`W1 T`"@R`!Rg=1 T`"@R`a R^=1T`"@R`! RU=1`T`"@R`!RL=1@T`"@R`!RC=1 T`"@`@1@T*@ R^v2=1T`"@*`W1@T}1T`"@*`W[B1ZSAcC{Ĩ_[B{@S@`?`5@`?5 @`? 5@`?ր5@`?5@`?@5@`?֠5"@`?5&@`?`5*@`?5.@`? 52@@SA{èSA@{è_  @A!ET={ 4{5a&R@%#k{_{Sw@sF@7!сa@7!aa SA@{è_`@7``  A@@EAc@4c @CT!@! "#BDB _@,E{a@!9L{_{S@aFa@7!aSA{¨_  {A;c@E.@?S[#9h`Ү@ @1@TSsFa % @?aT@6%` a!`R`@7c[' % # ! [BSAcC#@{Ũ_R 3`SsF`a@E@ 3@`@A!,E!@ 2 A!,E?b!@ Һ {S[**a@7!aa [BSA@{Ĩ_@E{CS@?S_MT?@E T[#@@v `T@usT @tT@*1T][C#@A!E?@"@cҡT{ASB_Rt@TC@8-RR%R*[#RRR/ [C#@ {[ ky? =S"=c8N+^ N=<N<NMT{MTFR @! R`;1ATw@s!xuG*?1 T @!xuF"RaR1 T{T"@`;1 Tu T{ TRSA[BcCkD+@{Ǩ_@B@Ax`!@?Pq!T,T @AxaF1T Tcc` @Axa"@A@!1@TAbx3sa TCFQ`7@7Ѡ`F*"@R`:1ZF*"@! R`:1Z @7Ѡ`  @BBET@1@T _@AI!1T@@&_A  @_  {CcES[b@/C4+@@E/@@BҡT[BSA{ƨ_k Y9Fc!dD@"T@6` I@+7@!@ ? 2@@ I>` ȄELDҠ@+J@7р@6cCkD@T@ 6O! Du-o"q`@7р@LD@I@ 6@`6@`7@!@ ?ckE@!@ ?@!@ ?ֺ@!@ ?@@7cCkD_@!@ ?cCkDX@7@!@ ?@ 7@!@ ?֑@7Bb\I`o`h!@ ?PI@8.A{S@C7a! 7a!@"`7a!7a!B7a!`b 7a!`7a! b7a!@ bҼ5@8`0BҀqZSA{¨_ {A!ES[c"@O"< š~x;@a#"2|7@G9l;@a "7@`@9ˡT(TkTa! n7a!` h 7ka! a@7` a! 7ZA!EO@"@cTSA[BcC{ʨ_H@lFa! @Ha! 8 7a!` 2`7a! ",7` a! a! { R @{è_`@`5R`@D@5  @cT@C6 {&R  g{_{S@a[e&7@ғC s?T@xs`x3@!}1@TUh!R[BSA{è_#R fR[B {S@E@@' T@6[37sbP4@9q`Ta!< 5@E'@@Bҡ TSA[B{ŨJ@@9qT@9q!T@9|qT@9qaT @9@5@E'@@B!TSAR[B{ŨqTqT @9qaT @949@ @T@7A!8Ev5@Da @@!j@ 7р^[B@E'@@B T[Ka!` [4a! V4a! Q`4a! L4a! G 5@E'@@BTSA[B{Ũژ[B[B@lEbB`!@KV`5 @@4 ,F2h2| SLL|SR kHTh2`2c`2! $8 8#8|S@l2`2!&8 8'8(8|S| S    C *@E{@@' T@ 6 @@06@r@T@TBBE'AC@ҡT{@C 2@@ Sr Tr!qT2` @A!E'A"@cAT{@C _qTq, @S@ @ @@@ ppFE{C[k@W AU TS*c5 s@8 Tzyxq)TqhT|SBd2`2"$8@9 ?q T| S,FBh2!`2`2ZB8A8@8O@K@SBcDsF@EW@@BT{A[CkE_ScsQ5C@N*?jTzyx qT9SBcD?য়`q@THTq`Tq@T q TᏛ?Tzxx _q T@8b @Bb ?@ 6O@3K@1SBcDsFq TqTb @Bb ?@r"RZk?Tzbx! B| S,Fӄh2`2$8c`2 8#8 ПZSCG`?@'C@cU@S@B?T` @?᧟a` `@T@7`@r@TrATb@c @:`@7`S@  R`_`c @bZ`'?@G@wbS@{A!ES @/4A;@E.@?[ h`@zB " e@4. V+ cC~B+@@1@T`@6[BcC E/@@BҁTSA{ƨ_-zBkTkҀ T:ZFzB 4 T@T@6` @!T?T~B+@7@@6[BcCkDl4[Bрo[BcCkD`@7`kD+@@7!A [BcC Ea!@pfkD Da!@C`@@6 Ea!@CkDA@7!A!9 T6kD3ҎnѠ@*[BcCw[ck lFa!`@C[BQ[BcCa|| _A;{@E.@? h`@zB@z~@SДB80[Ҁ"p@.*a@ a7``5"T`@7!SA R[B R@{Ĩ_SA[B  $R@ ] {B;S@E.`?@h`@zB`tZ`4B@SA{è4 Da!@@CSA@{è_ {S@5 _b"@a@4a50`t"u^SA@{è_ր@ ?TUa@4@ u^@R[B!!E/@"@cATSAcC{ƨ_C?@a@+@4v`:6@1@TY`Tb@ D@c5d@a!@^d`@5[BRB-ao5+@ D@f 4f` 0@`D;!!F!;@ s@7!ѡt@V@`6@7r`@@4+@`:@7+@z CŔ@7!a`@+@ 5 Tb@ D@B c5d@a!@c+@S RQb@ D@Bc5d@da!@cqB- Du@@#uy5x@8 a"@`@qa 5`t @xa!c#@bе-4Z@x7р`~+@B-[#mD;6@7`!!D@8@xxa!@xc@7р`U(X;ND;zG`t@0@@_R_  {A; @E.`? h`@@Aa@54@ @{¨b@Na@ @{¨b@@B *R @{¨{#cES*[*a@/Cߓ+@T**#I*t5'@7]'@= E/@@BT[BSA{ƨ_ 1T1Ty D!=@C@_ pGC@BA!`ˏ`@7`@Ҹ D!@!@  **$RҘ{_1S*!!E[*cb@$@g_ @zTb:@Vւ*S 5a:@*_`5dwa:@?1Tqa q`@AzTq# @zAT{*w5!!Eg@"@c!TSA[BcC{ͨ_ Da&@@G#_*Pc\S*o*`@` DBAB!@cb#**  ?1DA:aTR_#cD{`@A!`Kb R{_?q@@z`TR_#cD{`@A!:b R{_  ?  { @`&@@&7!`*@@@*7! @{¨ @{¨_ {"BE @C@`!4 B@VT!!E@"@cҁT @{Ĩ_ { 4`@@L *|S @{¨_  { E@@*JD!!E ATBC$4 @ R"@"!!E@"@caT{¨_֎%@5 !5 $R%]{S@[@k9SS?kTs @ @MT6{kTc?r` T?rr`TrT_qT@9**` TcCsESA[BkD{Ǩ_cCsEssRsER_ qT@?kATqT? q`T?q!T ?k TcCsE@y@@**oo@cC sE? qT?qT \ERW@s>@?rT@?raT\*s@?rT@?rTERs|DR2jsT\$R%js  @cT@6"@BT@B6Nw D_  @@T_ևBf嚆f'@A@B@!@!!|c_)T@˧6 @`7Ҧ]e|&%¦A! Y,A!!?@T_֡aac!gc {[@S@A `@1` `@\ `@` TU`@ @`@j`@E`@"HeDv:@w2@&RCRR]7e.@RcRRT7e6@RR"RK7`: `"@N`@R@V[BSA{Ĩ_@@7р` { hTR Fs"` @{¨_!^ `bv"Ds^ӳ  1`T*   {S[c*k**s @T@!@vqJ` `cb4@b(aMz:y9x8RT  [B*SAcCkDsE{ƨ_  Ր{"BES@D@"@d<iT,b @ @!?@@T!!E@"@cTSA{è_ E@@T`@c@@B@!"!SA|@|{è|'J@ {sSs @[ @csC EkC@_ TL T3 @u @CUC,  @`RBCB~ӛTcW8 {csVs~s-Tz{vw&@5)T@aD@A "tD"^_q!!E_@"@cATSA[BcCkDsE{̨_֢jsBt! j3xcr{g ҿMTs_H&z* 5_#s`v`^T9{"D@AG@ tAD^jTA@7 Tc@7` [@;S@\b @bab6BCӶ~}B~ӯ @` @A! @C!TO@7W@C @`GBCB~ә @C`CaT @cC?@G@!C5Ic @C@cCA ;@   T7@7@  c @bbcC1pG@7@!~! ja@tj!^@``,0 F 3, @v @CӠVC( `b @R`BCB~ӗ  c`7T7@$~ҕA ;~}Ӏ a @`@;@!C!cC9R[@PW@NS@LO@J`@7`A[@@@1@T@W@ @S1@T Od*p "~R@+`@7`b R~2 @0`@1@T`P {S@[4@sCCӟLT` R~Tbd` TzaB @tx!B|S!ss[BtSA{èoj`j`! " Atah B|SSA[B{è_ {#cES[`@' @#1`@@T#t@ c@8Bc7B!'_4@6#@`*@a*@`.@"@B1@T"a.@`2@a2 @T@ @1@T `&@a&R!!E'@"@cTSA[B{Ũ_"@B1T""@B1T"@7Ѡ`Ѡ {S Ed@@҅@9<qAT@9q TqT @"@7B<B}"d!!E@"@cTSA{Ĩ_hT0qT(qTTqTqTqTq@TqT@"  q,T`LQqhT&ҧgm T'ATHqTA %@ @e 7<} @9QqT$@ @ 7<} @@9qT 5`a"@ @7<}<@} C #qTTB@"_q T<} @9qTaQ!?qT"A$a7@qT}!"@ @B7<}<} q@9Qq(T@9?qTe %qlT@"_ $q TC #qTTB@"_q,T"@ @7<} B "_q,T"@ @"6B "_qTQqAz T/@/@@d@9q!Tc%@ #$ {[! S"@@T@ 76A@!1@TATR@7!!`@6SAR[B{Ĩ_` a@!@ ?SA@ T@` 77 FAT@ 6V!T@6@T@7!!DBB@$!@E A@"BF?$B@T @1@T 2@2 R!!lFBB#!@9!!DBB &!@9@7@!@ ?`@7`a@!@ ?@7р`@!@ ?SAр@!@ ?֦V@6@@7р@!@ ?@@!@ ?t@`@7`A@ ?!!DBB`%!@8c0[  @!!E_ATA@A;{ E.`? h`@!A! @q T#T@ C"T{_{  {#cES*[!!E#b@7@ 5`*@g ` T@hH T@ !`T!`3RsVZ*k ThbbqT!`q3sE Fs E7@@BҡT[BSA#@{Ǩ_֠ @T qT!`4qT3sEcqTqT!`ෟc̓TIT1TA`s_@7|@#TiTcCn`!`ן4 *]hbcC)hycC ,GAatcC`n 3sD!`1@T@1@TA`1@`3@2`!``T!D@7Ѡ !: @7@!!F!3@@7*@!!Fq3sEss cCe!`WU/O>;5@!R K_  C E{CSc@gC$`.@A=(@+ =! AT@Z@4[@"BF@!b&7[k@?1TO@[@@T@[@n"@o ni3ozN"bN@9_q@T4 5`@7``T`R@9q B@T@5n96 o[CkE Eg@@BT{ASBcDC_[ks[@@7$ҋ`@ 7`]n**1 TUn*n[@sKn*n[CkEҸ#c`.cS@c@3aA`=c(@+ =@88R&RRҮҜ@88R&RRҡ`ҏt6RB?L[@9[CkE[CkE=6RH{Ss*7@*SA{è_ր@!!E`T 4 D@[4[ Ds*@a7!с {S4[@A`Ta R*9 @@_TCcѴ Ӂ@!|S5{@T_ Tbһh-Tzv;$wO!@:~S5SA[BcC{Ĩ_!4`@#`@!RQa)[BSA{Ĩh {S*! @`@?T `49aA?T `~49SA{¨_!ҹ`4a@!ҳ4a@  {S_HTT@SA!R@{è@ '#4# 5SA@{è_"BF  {$F[*_TC@cT@6[B{ĨS@@Sr@TA4`ҿq`T"B|GThv8Aha8a4U4#c|G_Thb8aha8!5T[BSA{Ĩ8BcS5x@ҿq TT*c= 4`@#cD @A@'!@'u`@*X[B{Ĩ_x*K%4 TcC5cC{c@S7@[k9``BRӗ T!{u@{uqTTa@@SAcCkD&H[B{Ũֵ RcCskDa@@SA[B{ŨSA[BcCkD{Ũ_য়{S@[cSk*+r Tr@ @ @Sr Trc?qATa"?T`@8@ 9?qTb!_@T`D@ 9`$@x 9_T_qTs*T* '7s[BcCkDSA+@{ƨ98$RA$R:`{*T* ' 74b!@@@B Hcd@T{RS`?"BDT@!!|D_T F`@6@*SA{è_R `")*@7!SAR@{è  ED@{C@-T?@AT@!!E@"@cҁT{A_@8&R 9*RG{@S!T@?e@T@1@T`SA{è_!F[!Y. f@7!ѡa@V@eT[B!D`@3@l[BSAA{è!'V!D`@6@kkA!@V@7р[B{BES@@/#@C( 4+@"@@T@6[6`cWD8@Tzt @T@6$R"1T`56 D$R*1T?qE!F!E/@"@cTSA{ƨ_[BcCF[BcCE[c<cDA @!(`@YV[BcC[BcCDAB @!)@JVCcE{CS3`[d@G @b HT34v@6  TsETEG@@BA T{ASB[CC_֢@@?``=cu@+f=B`@BSS~FS S*9qT !!?K T V4a@?r T?rca!*~cD+@`@7` cw@w@T@67@aTTv RcDc+` @@!T@a6x7@@TD!=@ 3cD҉cD҆B-A!*,KcD|&@7р cD+@ұ{nwcD+@B-A! +KcD^ q@ҁRT@Є@8@:RfRRҷ`FcDsFa@ _1@T s7a@scE{CS `3@d@/ TmT@5#!E/@"@cAT{ASB@_@U@u#Є@8`;RFRRn@  {cFSaTSA{èusFs"3SA{è_҄ TҠA@l T`@T@7!8E` 4` @`@*a @SA{è @@4Cӟ@? @` ~ӡb`b@6@*SA{è:Ѡ@DA!+@2Ҷ@7Ѡ@ҮTD!!8@QsF??q4T?qaT R55{4AR8535@359@j! T@   ql T?@z TG@@zA!TC@@z!TqAz "TO@@W@?q@OE!0@!@>ЄF`@7Ѡ@ ? V#6еFEAK_i*@#"6_q+T$)"K K@#@7c#KrK@_1!T"!7*!4@ #5**5[14O@ @*!!ja@7!a!/5O@H@<@?qBF!E!?S@7р*?@еF~7?@@)6kEsFE@@Ba)T{ASB[CcDC_s@Sx#@8=RR%Rw  ?@ @7 `?@ kEsFȪ*1aTTFW RR8!@GF?%TG$T@CF?ATC"T@!7A!TFW@s1TO@$@eD!!8@2.D!!9@+.D!!`:@$.D!! ;@.D!!;@.lE!"!<@V 6еFKK@A<Ҡ_h `@7` sFDq!TеFwcp@еFKD!!`>K@-4?@ @7 @TkEsFO@@DеF!@!>K-D!! 8?@WP?@kE7R! R8baR8aR9V!B-!7 EkE @T@ 6C`_@TD!=@{-kEkE!B`7!* EkE R<R RFtҔ W?@ ksDеF@!!@?KO= R@WFW RFCW R @T@6G_@ TC@!B`7!7 GEkEqG@!B`7! + RR%RI @Bk34D!!`@K+aR@9R29R!*aR9C5aR@9#R!2aR9D!! @7+#RBR҈@7! ;@$qTD@Ԅ95 {S@!T@A7lb@7Bb4`a @T@RSA@{è_ @@7! RD!@@*`@7` SARtro "R {RS*!R*1T *s*SA{¨_֔4D@x  {!RST9@7Ra@S[@ ?ր@7рSA{¨_BUSA{¨1@A9{9R{_{S@ 7a`@*tbEq!FSA{¨_D!!@}* {!ES[֚F @/3B#ݸq T'@@*!61T4!E/@"@TSA[B@{ƨ!BF,5C<A+d'@B7B!ѡ @5;O9O>cE{CS `d@/#@ a?H T [@ T@u`@7!с!@T`@a!@4!1PBF@k@` @!1@Tu v>@ XG` 7`@"@b*?T@2@?[C"RRba.!E/@"@cҡT{ASB_[SR [CRҾT@t#@8?RFR%Rҡ@`@JTxcT@dH6A  @?T_D{!@! B @@L{_c  -Z{EcFSA@Ś`d!FTaT@6E@@BT@SA{Ĩ_!!@7!@!!@S) @!7@!FE___D{!@!<){_{ <@T`@`>@``6@Ѩ`6b>@:Ba6!A7?bB"TR @{¨_#NlF!!`@ )Z'D!!@),  {AESF@М @qc!D!@t@6E@@BҁT@SA{Ĩ_!сYOD!!@jK@7R"RD{!@!({_  {S*[u@! `**|~`` @d64aR@93aR9T[BSA@{ĨSA[B@{Ĩ_55DSA[B@{Ĩ@&@tqT{S[`T`@6[BSA{è_` i@!G!@4ZMV@!!B @JqҔ {  5`@1@T` @{¨_{cESd@B!F!*q-T@@*6qTE@@BҡT*SA{è_֌D!!@'!с {cES[b@G7H*T T`@7@q #T $T`@ `.@4` @@7a T`6@R`#4ca"@`:;4a*@?#T`&@`"5` @F̚a*2 .7?@'Y@7!ѡa=,F,T@T@`$6W#Ҁ@1@T;@`6@:!cCEG@@B! T[BSA{ɨ_֠@P@5@P!FT@6`6@Ra 4cFa"@`:C4`*@$Tm TyC` k T`&@ 5`*TbB@" "~*Ta*@`>@?jT)PT~@TaC !k T߽`"@`"kDck+@lT@7@kD!P`T?~AT@TO4kDC@ |kDC@ykDuOqx@5p!!]@7!`>@B|cCa`"@`"`"@`"J`4`"@4`*@Ta"@aTD!! @&5Da@@a4!! &+D!! @&#w5] @A7!8`"@7Tb@@;`"@`"!! &# 5C;@tD!! @{&+{Fk;@:7;@@;7!Ad @AC`;T@T@`6 @`a@?T`Ҩ7x"@D!! @;&kD+@kD+@kD+@ {[E@@_a 7S]@"R@r*]57@Sd@mTs @-T@!bj`T@,qaTJT @TM7SA@!E_@"@cT[B{̨_SW@7@SAB@TTMT@ @ TM 7@@7SAFD!!@%s"s/SA*G!! @%@@7!SA  {_[Uc*S#\*@Z]ccr Dz T5[BSAcC#@{Ũ_`4RD@ !E{F"@<AC _!E@"@caT{¨_ƽ {SEa@@'?q T`6@R 4`:q TT[`@9 5`6@:F#AҢ_R`6@4`: @6d @<ҠA#_a@[B"*`6@:E'@@BTSA{Ũ_рx!F @1@T Fu`5[Bc@7!^I[Pu 5Da@@4!! $ҽ!! $xd @<ҠA#3_a@w@H@7р@Җ!{@S?q-T@B!F! *a@6*SA{¨_@D@4!! s$!a!! g${!E@#@_qT@!FA C^!E@"@caT{¨_ϼ@DZ4!! @$!! ;${5F{_qlTD!!@'${scE!F !d@Ҏ*@E@@BҡT* @{è_֏  {BESE@'c!A<FB$@҄@y^aR@9A06`V@957E'@@BTSA{Ũ_`\@ D!!@ @#c@7!ANaV@9!5*_@6Hx*@6@`7р0  {!ES"@oqTATFAҠ^LBFsҡR*&7`@6F!E@"@cҡTSA@{Ĩ_``@7`` @_{B;E.`?STh`2@`@@2`@a62@2SA{¨12SA{¨,  {@7SZ*ͽ7[SAR@{è_4@[D@|*SA{!RS9@l7aJ@`@`6@`R6@ ?ր@7рSA{¨_֎MSA{¨}  { @@ 7!Ak`F@@F7!Ab @R{¨_ @_  _E{C#@@ ``AT@#R!E@"@cҁT{A_5d@<&R*Rғ{@ScF`T4gGa@7!aSA{¨_(@7 @@#7!(7SAA{¨3 D!!@s"D! @!@@ED!!@a"  CE{CS[@gu@UCd@<RReR3t@4` @@!T@6c`3@!T+6`@R `@ *` 7T`@ u*1aT4 ! T 27@=R)#==R rjT qT 4!* 5@/1`T 5"B!@\*Bs;@5@7cD+@Eg@@BҡT{ASB[CC_)*1TTRR`@1AT`cD+@!!@3RS`4!!`N 5SRc+4! 27@ =R)#=`7XW6b!B-!7@9D!=@!cDҭt@D!! @!ҙ!!`5sR5D!!@s!D?q"B@!!@@Ag!}D!!@_!uRRAV _-T@FmTcD+@kP6@1T^Y *`4*N"OIOE{S*r*ad7@SA{è_`@7``{qc S)? [**s`@T@ '6a?GsP "4k*@@kҘD @ vw @`7 @z`T9 Ts@ LTR% T |@!TC@}!bj`bh C@kÜ3kTwaKA!" @7@kTs@kw@`@z Ts"Yw@k+T[BkDsESAcCC@{Ȩ_TR @34-T @s= A3`4T7 @?@ @D@ Cc;s@1?k2Aq!Ơ-!#CC[BkDsE4Ts@ T9T?@ @D@Cc;Х!-F%?q*&!C[BCkDsEB c-[BCkDsE?@D" @s@@5#c;! BC[BkDsE#c;s@1@2k!*B c-B c-B c-?@ @.C[BkDsEb7# @7 a(R@>CV;?@aKA! @D$ @@#c;e!!B[BCkDsE>B c-[BCsE57@s?@ @D@#c;!!xBC[BkDsE" c-)R@U>[BCsE[BCkDsE $F{ B{_  {!ES[ @W`@`45R.c!RF E}u@u5a @R v&6@@94*@9`4 tksx@z@RRy@yzvn)|2E5RkDsEa`" EcCEW@@BҡTSA*[B{˨_77@@CTK;|@7C@G@;K7@@O@kTxtC3SC@@E. ?CH@h`@I x4C@7@!Rzvn)|2`cks7@ @7 `kDsEo K2k;~@^7C@il;@(kRpkDsED! @m*ksw E5R~cCNl;@ k7pAR7S7@**R7S@A@9?kT?qT?q@TA@9 Q?qAzT7@R;X;@@9aR77@ kDsEEk{Ӕk|Д?q$@z T?qT?qT?q`TD!@JAkDsE/kaTkATA@9@S?qT*kTkT*SD**!@*AkDsEDS@!@ AkDsED!@lkDsED!@ckDsED!@ZkDsED!@@QkDsE*  {S[`&@qLT2`=.`=:@$> @ B@6F`$J@$N$V$Z`%^ @ b  %j `%n %r@ %v %z &~`   & @&`& @;@&&~`&y't @'o'j 4e@:`'[`@<z  n!@7 @!7 @!@7@ 6@'!@*RҚ JRҲ 46CV cB'`*! +DR r(6C@+!+$Rz 6C"(+!@,$Ro `6CB(a,!3DRd  @!@-!RY (Rr 4BCBF1TBCBF1TC)% !`-R: @vCBF1@T@CBF1 TC*%!` ! R" . vCBF1 T.@CBF1` TC+%! !R j C+%!@!$R CBF1 TC+%!! $RC,%@! dR&CBFr1TC,%! ! dR@C-%!`! dR:C-%!`!RCBFK1TC.%! R`CBF:1`TC.%!!`R*CBF)1TC/%!!`dR0C%!! dR}`C0%!@! dRr"CBF1TC1%!@!@dRa2 CBF1 TC1%A!DRPfC1%! !DREBBF1TABBF1TC2%!!R- C2%!!@R"C3%!`!DR">CBF1TCB3%!!`$R@C3%!! dR:CBF1T@&CBF1TC3%! !@!$RC4%!`!!!$R@C"4%! "!"$RC%"R C%"RҹbC%Rүv @%"!`RҤ`B4R4BBBF,1`TBBBF%1@TB4%!@6!6DR^B56!7DRzBB57!8dRoB`B58!'DRdB6@9!9DRY BB6:!:dRNB6:!`;DRCB7;!;$R8@BB7;!dR`BB8?!?DR B8%! !$R> B8%!!$R*CBF1TB8%! !$R&B9%!!dRn@B9%!!dRfB:%!!dRBBFS1TBb:%!!@$R`B:%!! DRr CBF71TB:%!`!`dR6 BB;%!!dRB;%!!` DRB<%! ! DRv~@BB<%!@ ! DRk"B<%! ! DR`B<%! ! dRU`.CBF1`TACBF1@TACBF1 T @%! !@ R6`RO4B% R&*&`B% R@B% R ~z @%! !@Rv`R4vB%`R`vB%R@ @%!!`RRR4RC%R RC%RҶ`RC%Rҩzv@RC%RҜB> RC% RҏRC%@R҂n{j~RC%`Ru`}n|RC%Rh@{azRC%R[ yTxRC%RNRwGN`vRC%RAZt:V@tRC%R4Jr-F rRC% R'p p @%!`!R@nR2`m4C% R k@kC%@Ri iC%`Rg gC%Red @%!!R cR@b4B%R` `B%Rҷ^^B%RҪ:\6[B% Rҝ2`Z.YB%@RҐ@XWB%`R҃ V|UB%Rv To`SB%RiQb@QB%R\OU OB%ROMHM @B=%!!RA@KRZ`J4 @%! !@R0H=RIG4BBBF1FTBBBF1ETBB>%!`!dRCCBF1BT@BCBF1AT @>%Х!*R^@R ?4^BCBF1>T^BCBFz1<T @?%!!dRR ;V BBR:4JBRBBF`18TRBCBFY17TRBBBFR16TRBBBFK15T @BB%!!@DR3R24NBCBF211TBCBF+10TBCBF$1`/T @%Х`! =DRF-BR,4FBbBBF 1+TFBBBF1*TFBBBF1`)T @ !DR^'Rw&4ZCCBF1%T @@! dRF2#R_#4B2CBF1!T @!Х ! R.f RG@4fC%!&$RbfCb@&!&$RZfCB'!'$RV`fC'!(dRNrCBF1TfC )!*RJ fC*!@+$R^BCBFo1TfCB+!@,DRFbCBF^1TFABCBFW1TfC`,!,$RR  @-!-RҬ` R 4C .!.DR @/! 1RҐ R@4C`1!2DRzBBF1TC 2!2$RnC0!2$Rc`[B RcC*f[BcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcC~cC|cCzcCxcCvcCtcCrcCpcCncClcCjcChcCfcCdcCbcC`cC^cC\cCZcCXcCVcCTcCRcCPcCNcCLcCJcCHcCFcCDcCBcC@cC>cC<cC:cC8cC6cC4cC2cC0cC.cC,cC*cC(cC&cC$cC"cC cCcCcCcCcCcCcCcCcCcC cC cCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcCcC~cC|cCzcCxcCvcCtcCrcCpcCncClcCjcChcCfcCdcCbcC`cC^cC\cCZcCXcCVcCTcCRcCPcCNcCLcCJcCHcCFcCDѠ  {cESa@'lG7f@#@@Ha@Rd@"@@Bb"@#@B|"!E'@"@cҡTSA@{Ũ_֬ { O`@@7!A`F@ @{¨p;{BEEC@7Ҥc,d@`TdC`@@@#!E7@"@cAT{Ǩ_`C@,T]kT`cV (@"7 @B2"( @! A"_{[|@Sck;@Tzss`{36BxF2BBB :BfB! 3,@7!сA;@{BSC[DcEkF_ր@7р;@ ;@;@  {S@[`@ck8sCT@1T @@CT@1@TJT***qTq s`7tB~ kaCka j!!?ATT 5!@7!!A @@6ESA[BcCkD{Ũ"{qTq*s`7 !~T"k`Ck`B*j @b! B~Ӡ J`7`!~T"k`Ck`BJj v6b!c-T xttR@x4 @ @R#!}Kb Dbb(k`b`Y(zb`b`P(fQ @7 @@7@`SA[BcCkD{Ũ_ @7 852{[u|@c@S#@Tzssd {3?BZ*@!63*SA|S#@[BcC{Ũ_!с@7рSA#@RSAR#@{BEOSC@_R=@5aR'47@?@3A'3`D3@@7!A;@`E_@@BTSA{̨_֢B!@`S' {(@e7 @@7E (7d@ A =? =b6 @ 5B7?DqT RD `q TRD `q@ T#RD `q@T 7D`qTDRjT?7"@"R"$?b@B1@Tbb@#Aa{_D!@E!7@}1rTE!5@DRjTE! 4@E!`3@D!@E!6@rTE!5@{@SЄET@@Gҟ76@_@TEG@@BTSA{ɨ_b@B2b@[E! 9@e@@A7!!8E[4@@s>GR5@'@X@%@D!8@0[B@[BҬ   @"!? qAT?qT?qTR_N{  4 R @{¨_Bq@"@ R_ R_ $@$ @Q|}@7%@QhcTFhcT|c R_ @!_{S_T!(Et@z@4s@`@T@6:@&5FSA{è_C9&5:@@1@T&@7Ѡ@BB-!<9%" @9!1%5@  @!7{!26{_ { `@7 @{¨`&@  @@`R_@/AB!1T@/ _A @@<@AI{c@3Es;@@G7[v@VF7!ț@7?@S 7@q 7C@a@?7!aa?@7RkR9#E|7?@~@@!T@ 644|qTR`@A T*@7р@`7р!E3@!@ 2@4@7Ѡ`RSA[BkDF!EG@"@cTcCsE{ɨ_RkS[ka7@  `b@DCT@@7C @3@B <`@7``P@7р@7Ѡ`DR^SA[BkD*@6@6!сA.@@6w4c@: @3@B< @!LD3@B@;!@ R/SA[BR([BҎ<@ 6!D3@B:!@y [B|c`::{R @7!R{_R  {SE[*u@@/5 #5cvw@RJ@?kT5@!1@TcC#@E/@@B T[BSA{ƨ_2@C6@*542@4@94 @ 7+@S 54+@K 4cC#@#@ @@7 cC#@!I "R|5"R|@4`@@7`i`ҧŰ4,E@040c#M@@C!!AA7_AC9?TqT@!G@T$@EH@HX@`KkmTxa !"@1@TG$_ր@! E_ATX!F!R{@St4@t@"SA{èA@#`?@@!a8@Db @@a!@!=.SA{è_!3.  {C;E.@?{`h`P0@?0I{k@[Rc*DSJ@k T[BSAcCkD{Ǩ6@~@!6"9!@9k72@s! < @9:05sEJ@2@7kD{Ǩ_k@zzqT7@zd@TTa@@@!1@Ta[k@zzqaT#`@Ta@!1@Ta{`@ a@F?T*7$7@4`@T[lEB@>@@5!F@@"@C1T#`@a  {@!E#@AT@6  @TE@@BҡT @{è"B-!@>"E@@BҠT D!=@ @ @{è_{A;SE.@? h`@zBsBW@!1@TSA{¨_`4E! ?@-s{ q!F{ _  {A;SE.@? h`@zB@! 4zBSA{¨ 4D!?@3 SA{¨_5{@S[4S?rT?rs@TqT`@9%q!EF SA[B{è_@ q T`@umT* 5E`@yF kT|Sa !@+c@?B@!xdx `x`x@@y7Rj_ R_R@!EF_r _{c4FST`@a@?ATb @?hT?T@SA{¨Ѷ `,`(@5SA{¨_ #`,4 @{[ TAS08}RSA[B$R{èSA[B{èaE{@ 5sF`@`^F@5sFD`@`T @{¨_  {BES*@@c#lR*K1T@!E@"@cҁTSA{֨_ԡ @@<`{!D[FS!@@@t@Ҡ~==X +!"Ҳ+7!Ҭ@*7!"Ҧ)7!@BҠ(7!"Қ(7!BҔ@'7!bҎ&7!҈%7!҂%7! |@$7!@v#7!`p"7!"j"7!d@!7!b^ 7!X7!R7! L@7!@F7!`B@7!:7!"4@7!".7!(7!"7! @7!@7!7!b 7!@7!B7!7! 7!@B@7!b7!7!"ڪ7/|@!Ӫ 7|@! ̪@7!`ƪ 7! 7!"Һ 7! BҴ@ 7B!`@ 7B! 7 @!7@@<&@?7A;E.@?֢@ h`@T3RF BA@!1!TsBq T*G`!TBȠBT!l`@6@R!/p@RSA[B{Ĩ_@` ^@A@cT@C6@rTr@TA@{2{_@RnW  @@<cE{d@WC?1`T @!EW@"@cҡT{˨_{A!@< ! @v?` @Z{¨_`4{S@!T@a7Da@7!aaSA{¨_ @/AJ!1T@/@(_A   Հ@A L!1T@0_A   {BE@SC@@We`@cqF[ksj)`)B` @T`@xw%@!T@7TAB@B1T'qT!T@@`6@7рی?@T@$6c7c;? @TF?@xwn#7O@zb@@$7@ #3`3@X7S@b@*7Bbq+ T T@@ 7@[@7Ѡ`S|@7!Au 5C@@I Ȑv7`@7``@T@@6Ͽz6[BcCkDsEF!EW@"@cTSA{˨_\6@7р` @@7@@ ҖL@6@@7@@`7Ѡ@!F_ATYT{TV@ VzP6[BcCkDsEҽB)@)[cksOD! @1[BcCkDsE@QTD!@@`7рҥ;ҝ3l@@`@7`[BcCkDsEn@a7<<:8[BcCkDsE^ q-D! @@6" `7@@YV`{`{F{_  { 1 TG`@1@T`> @{¨_{H"@4AT@R?gaT{_DB @! @9(  `@! E_T!Fl!; {BES[@@'A#?@BDT`@7``yB@7!сaE'@@BT[BSA{Ũ_DB;E. ?ց@Wh`D*`4e@@@ @B c @M`@`7`@@ E{@A@l!F C?!E@"@caT{¨_֊ @!@ @_aT@    {!ES"@ !F!]*qTE@@BaT*SA{è_@m@*7!с\RP@@!1@T_F_ {!xF?T!F!U@!1@T{_ G!F@!< {S[Ͻs+*7!F!*5Au4V@lRV[B*SA{è_Fҡz*5.V@k,E@k)`4Gҡ@ 5{@ @?@bAB@|@@? @{¨_@7BB{BS4qSA{¨!F!SA{¨_{T@@7!7 *|S{_֤D @! @&RD @! @&R{ T@H7aZ@`@ @{¨4!F!@$@@1@T` @{¨_`!F @1@T cF @{¨{S[_ TN@`@T@6eaq T!T_aqTaT@}7@7@@ @BT@ 6V@!{!T`@1!T[BSA{è_`@7lF!@D!`@C `5{cESd@G_-T[vV@@T@@+6! @q Ta"T@` B@_CTqTTFjB= !F T!E`T!D@!T$6@#`"@Tax`@T` @wqkTT` @c! @T@6 @T`7a@#7cCE!aA#O@1#T[BEG@@BaTSA{ɨ_so@}ks7` @*43@ @1@T @6`b 7a@6F 7@aw{F-T {z%  T@1@TN`*@7!сq TATZ-T {z@7!Z4kDsEl@kxw@1@T&`*@7!A?qTTkDk[ckskDsEX`b2@7F7RZ7!AD!@[`@7`ҟ[BRa@a7EC`b 7a@7F9@7!A`7a@a6~E-D!@@*`@7`ncCMZ`@cCkD`6[BcC!!D!@ @[BCS`5!K:cCz[B`b`6kDa@7cCkDF#cCkDBF{ȐASt@@@?TSA{¨_֠D!@`@7``B{S`R @ȿ{*@7!с*SA{¨_֠D@&4R&D_{!ES"@/@E/@@BTSA{ƨ_F[#C+5[B@'@@ @mT? T6`@7`[B@[ʙϿ[B@{S@[V @<=H@7!a*@7!с@7!ѡ[B*SA{è_D@7р {@TS@@mTFT@1T`@ 6u@SA@{è_րр[D!@SA @!EaT{4{ AR%E{_  {!ES[c@"@gXAT?TO#gB@eA`cB`a C``|L'@%#!5B4 T@UaTB@с7!!BTEg@@BTSAR[BcC{ͨ_}O````|L{B;SE. ?Uh`` FT @{7@SA{è_`@7`%!XE{4@!F!,D!@{_@!T@a6@!1 T*{C;E.@?{`h`  {S`۾`@7`SA@{è_@SA{èeLD{E;'@cE.?Sh`[\]qTT'@!F_ !! 7!;7! 7#"F@@@7р`@7``SA[BcC{Ũ_֡!DB!@!DB`!@  CѧE{Cc@G;7*!R[*ks**7qSja TFq!E Ҷ֚F`7 * B`   j`%  7 E AC9*@b 6?1 T{ 4{E 5E@.k T`@7` @7 ;@"@WF B@@7!с @7 `qa@7!a q!'  ` 7 @ 6SB[CkEsFEG@@BA T{AcDC_ּМF{FМEBт<@D@#4*!RI 7SB[CkEsF SB[CkEsF[CkEsFF@7р@ @7 @@7р{ҷXPS[ksٖҦF*!E֚F B`R``@1@T`¼@#SB[CkEsF  {I;JES E.`?#=$@'=+=/=3=7=;=?=B@?5i`T=c7$R)@`a@7!aE?@@B!T@SA{Ө_qg  ѣcE{CS[5`cd@_ @55T5@k3&@tF(T@T@@@6@C@A T 4T @X0:T@F?AT@/T@6*@7RaT "FTеFsҸ &d?@$T`@5`@(`@@'`@&`"@$`>@2`F@1`N@6`&@4`V@`86BJR4!4`@ V`! $@1T`x&zb9{f97@1@T`@w!!@4!1y@ybF5*5@7р 0@!#@?ATеF7;@@"3@_A+T`VbAC7C`*@$67tv9t~9ҡ~*7C@tz99z 7kE R3@`E_@@BaT{A*SB[CcD_@T@6A;ՠE.@? h`@EA4A4J=C@TJ@!7!Z<qR@]*`6kE3@l` 77 @T@ 6 C@TD!=@kE3@!'@T!@@TеF~еFK5`@5FRR A;ՠE.@? h`@E@5 Tk3D"!@&%5B`7!7kE3@gD!=@ZkE3@]@"!7!޺@7!ֺ@7!Aκ@a7!ƺ`@`@7!һFRRcD @!``@X@#$@< RR%RFsRR s@ Pa1@T P!*Ҡ`dD!@!{@FA7!sm@>7!kcRR?@A7!_M@&A7!WU@7!P@N!7!HDB`7!*L?~@V7!!77 {BES[A@'=@!4F_ TcFca7#@@*A6qTE'@@BT[BSA@{Ũ_`@7``55E!`@!с`@7`ړ @9@4(qT@@9@5_4qT@@9`5R_(qTD{@!{_A@9Ra5_ {S @! R R"ay`r9*RSA@{è_`"@94y@9?qar9@?rT?r`*!!  4u"@ R`y@9q`r9{ScE[d@FŚAa@'#m5w*@61 TqaT`@c``jA9 4`b@dnA9BEq @FB`@aR!E'@"@cTSA[B@{Ũ_7!сA:@7!0  {!E@#@_qT@ҡ!FŚA C5!E@"@caT{¨_@D@4! x! sB{S !a@7!a!SA{¨_֜,  {cE@[cȝҸF#C`@/A+4+Sɿ*a@A61TqTSAR!E/@"@cT[BcC#@{ƨ_֠@`67+@@T@`6 sBsa@4`@6sBS@7!!SA!aw ՠE_ {!E@#@_qT@ҡ!FbA CY4!E@"@caT{¨_K@D@4! ! {@7@ "db7!d?qE!F @{¨_֠D!@R"R@7!a @a @a @  {SEavA9@'a4`@R!E'@"@cҡTSA{Ũ_d@[ R֚F`9МA3"3BRϲ*@6q TT[BRe@"39B3@7!з[BR!сaȷ[B[ {R@S#c?kT`b@ 5w@[ز`b@58iwub@u5a@r~@5LT([Ba@!QcCaSA{Ĩ_Tw@z4@}ӵj`"h @}9` R`bQa@[B!Qa@[B!Q R`bQa@[B!Qa@!QC;{E.@?`h`{@  {S**@*SA{è_֙  Ձ@2_֢BF{;) @7!R{_RC;{E.@?`h`{@ ѣcE{CS `d@/#@ a? T` [@ T@@7!сaT`@!@4!1BF@N @1@T` @u 7v> tG``7 &@"=`@`wE/@@BҡTSA@{ƨ_ڏ2/Rc@C @<`{!`BESC@GҼ"7!Ҷ!7!Ұ!7!Ҫ@ 7!Ҥ7!Ҟ7! Ҙ7!`Ғ@7!Ҍ7!҆7! Ҁ7! z@7!@ @t7!` n7!  h7! b@7! \7!!8V7! ! P7!@!J@7!`!D7!!>7!!87!!2@7!!,7!"&7! " 7!@"B@7!`"" 7!"" 7!"B 7!#@ 7!@# 7!# 7!# 7!$@7!@$"7!$Bޘ7!$ؘ7!%Ҙ@7!@%̘7`.`@A= =zt@7*!T@R!EG@"@cҁTSA{ɨ_@@@`R_{S@?5` @`@ `@SA@{è_SA@{è?4?4{@S`? 5@@SA{èSA@{è_{@S`?5 @`? 5F@@SA{èSA@{è_  {S@?@5`@?֠5`@?5`@?`5`@`"@?ր5`>@@`F@`N@@`&@? 5`V@?ր5`^@@SA@{è? 4SA@{è_?`4?֠4?֠4@`R_{@ ?qMThTa"@4a*@?Ta&@5 @{¨Pb2@_Ta&@b"@!Da@@4! A @{¨_! : @`R_{S`GҒ@4@SA{è_`@7`` {S@@T@7 ү@1aTt ~`a `.!R`SA*{¨_@@1T@R  @"T@X6!@ha__B;{E. ?S@h`[!Eck@"@WBtc@`.5t@\ @ F!T@7р&@$6`@5`@5`@``@@/`A25cBq)T/@ 1T1H +R5s2@zB@Rlt2@@@S'@/@F,"@**5/@@7!,`@5`@5`@``@!`@@`@W+`@@7`@{@6yA! *j47!`7285d5@! ?@q@4T 1`T "R@C!q@7!с!@7!a`@W@)5` @a! 9y(`@`(5bA,97dQF#5!EW@@"@cҁTSA[BcCkD{Ө_`@5`@5`@`@LF@Q4`&=!@ 7! ~`@ A4E@BBcc !@'o`@4@B'!(ghY@7BB[`@5`@5`@``@@1@T/%TtSn`4F#51"T,!7LF R @@!?CUqp%fތ!Rm@YF!Rd*W!(@7@7!сa 8@CG@*7!aq/F!Rm@W./@@7!AԱF/@@7!F@)s!Rm@C /@@7!alF!&@/@@a6@/7рFқR*`@ LF@V`4/@Y@RTVARH@RW&1`@A7!r@E!Ra24`@!@ES?Ym`5,7LF @@!?@RC{qWYR͊@*2**t{!Rm@u@7рly +t9Rd!Rl@j!@EE? 5m4@_?(qT*1AT5 !+w!,7! ` @RCmNF   ;bRW7]/4`@@`@(X@Q`,rD@Kl**%4@{ Ů@` @`@`@a@ @{¨!@ִ  Հ@AO!1T@?_A  `@ApJ!1T@)_Ap   ՠ@#AL!1T@#@3_A   CC@C@{@[!E$@d$@S!4@ 4!`44c!" Vq,TsR`BMT!SA R!EC@d$@"@T{@[BCC@_S-SARSA0 @8@q`TRR`c CR@9{@ST@ TSA{¨"C"Ҹ`5SA{¨_ց@4SA{¨3WD!@-@M  `A{`lB;ՠE.?Bh`@@TRb,{_րlF!.@0lF!.@(a !   {cES[*a`@'!  /$`7/cO! 0 cFqBE@BFs@7 @7р@7Ѡ``@7``_v@7cCR!E'@"@cҡTSA[B{Ũ_JcE"2!c@9@7`:@7р`3@7Ѡ`,!RGkcCG@#cEb0!c@@7@cE!/c@!RGjG@!DG!@?T RcE"@1!c@@7 @@7рݮc҈ @A`O!1T@=_A`  ՠ@3APH!1T@3@!_AP  уcE{CS3`[d@o @b HT35 v@V  T @ @T@ 70@`@!4#RM 7C@7 @` @cR 7QR!Eo@"@cҁT{ASB[C_ց!G!@  T "T T5 @@ @R @u6ckScw@W@T@`6& ;@ATTҀ @`@T@6wcDD!@4@U@Є@< RfRRҌ`Gp@?`k@*7!ѡaέ4A!?T6kE`@7`cD6@7v cD, cD ܦ`a@7!aa4@ 7рcD@!D4F_D@!Tc @@7@kT@6@ @` >GZFҋB-!*` cDD@@4eD!4@DB3!3@AcDsD`@@4@`@! 5B @_bhD@4`@7`0cD h!8 @s@8kEF@@@h!8cDcDkE$cDkE6cDkE!8E{  @4Fu `@1@T`  @{¨_5R5 {  @ @{¨ { @lT`@@_a@ @{¨!@րD!`6@7_h!4D)@!EiF_ց!dE @!E]F_{S#B@_!T@SA{è` @@5SA{è_`# V@5BF{SA !FT1 a@7!aaqSA@{è_4@49T@@?@sѳ 1@T@7!AN@D!@7B @@b{S4E` @@!a 1@TtSA{¨_{  @ @{¨ {B@SSA{è ` @5SA{è_ {S[_!T @BFAL!1aTAL!1 TU3V 3@ SA[B{Ĩ_ T_AT @o@ @ju Ҫ#_ T5@ D! 9@S@@@TD!7@,@7Ѡ`@7`@`7`ҹ@@7Ұ@7 `@7`@7ѠҝA A D!`8@҈{SI@!F_TSA{¨_!a@7!aaZ{ЄES[ck@?w@5Tw@5Tw@5@T PX!E?@"@c TSA[BcCkD{Ȩ_77@֚FR"31`Tq!T`@+1aTRݥ*5<3<d3@`@7``ߪ @7 `ت@`6@@7@Ϫ+@T`ҥ+@@7Қ`@77L1@T +@"3@7@b`^+@{+@kVA+6+@b _AT! š__ATš__ {S@[T@T@ TTT T TlG@LSA[B{Ĩ_ʽF @A@!1T@a@!1T@A@ !1@TAMT@@@aA{ @@6`@@a6`@@A6`@@A6 @{¨!!!!A{S@[3@CsCLTT6R aR!~?Tb`#xsbKCtx3Bx^s,T1T, SA[B@{Ĩ3jcjcKBKDth#Bx^c@ARCB}!K!`bџ!TF 3SA[B@{Ĩ_#xtxtk T  @ @?kT6R  Rc9a7{@BED@bT@"6"@BT@6@CCT#@dCӟ!TB@!@_@aT !E@"@cAT{¨|@1C7 @!E@"@caT{¨_IQ  * D{S$@[ @EC@/ CT_T!+b@@?@T |@+5b @ @c@@Z'+@R!E/@"@c!TSA[B{ƨ__(T#C7'@ @@@T+@5@@7р` @@T:@'7!с +@ !F!3:@ `@+7` @'@˂` @@TXT#BB!:@7!`@T@6aA"@BT@ 6@BT@B 6"@B1@T"@!1@T`@7`` @+@}@7``@7`@k@fQ  *Ox`@7`@D!@:@@Mf`@7`@D!:@@<UR@4{SEa @@/Ҁ @C!C[TTT@3O+O@ @` @!@?@?_k T@T+@@[BR!E/@"@cҁTSA{ƨ_ b  B@!@_kTV!F L1 T! 3A+@d[B@[@@@Td@+@@7!aۧ@@7!Aҧ[B@Cod+@` @[BE!;@0@@7[B@! 3   {S*@[sCs*Ra~jacdŚh!!|b?PTSA[B{èSA[B{è_{ @>`@<`@: @{¨ {  @.`@,a@ @{¨!@{@1@T*?qF!E{_  {BET@ D@H7 @R @B;ՀE. ?@h`@x@E@@BҡT @{è_ԡ!F!: @1 T`F @AU!1T `G!@' AT@H6A@!1T_{K {`_ T@H7{A {VA@!1AT__  {@9a4{EF{_{T@SAH7Gb@!`<@ [uҖ֚Fڼ`Kޓ@5[BSA{è_@#@[BSA{è@1T[B[B@7р[Bҕ[B  @@!1AT__րF_ @B E@AT:E@  {ST@@6SA{è_#{`T!y!TVҀ @T@xu@7р`@@SA{èP{S_T T@SA{¨#5SA{¨_ {S!F!@7!сa!$a@7!aaTO 5SA{¨_־a@7!a@@T@7DB @!@=@ @7р@@6rD!@>@Sߥ{qSFz @!T@6ҁS3*SA{¨_րD!>@ p {@S @`? 5@@SA{èSA@{è_ @7AN!1T@7;_A  {@T@@6`@?Ta@ S?r`T?raca{E!@7@{_a@ @AI!1T@$_A   *qTRt?yF! B|z!@!1aT__{ ** ٮ@ @!CS? qATc4_r!3y @{¨_4_r!3@3@{@!1@T{_  {jq!F{ _AB@!@“?T_"T_T! __  {D'@!EAT_qT{èS-T_qT @ @?T@?`T@?ATEB4D{è__qTLT_ q@T @ @? T{èH @ @? T/Q/@5/K/@5BRS*a@7!aaqTaTSAFSASA {SE[%@@/҆ƌD'!EAAT@@?TcC#Br4+@@b@B1@Tb@g#*b@7BbbqT!TcCEcCF!E/@"@cҡTSA[B{ƨ_cJ~cCMۥ5ץ 5b @ @@7BT6B;{E. ?@h`{@BB;{E. ?@h`{@B  {SS-T@ @! %xc@1@TEx#cTSA@{è_SA{è  {S HT}`tSA{¨_`@7`SA{¨w=֣@BE!T@1aT_ aT@A6HD{@!`?b @{_{LG[DTW@_TSg3R`~@3LT@@?@A@!1@TASA@ [B{Ũ_z`oaQs! @ 's'@5@7рSA@D! @@kSA@  { գ@`@a@ @{¨!@р`.D@{CES#@@WA=c(@`*a `=T?@AT@4;@G@-9#@aK@@T@ 7EW@@BT{ASB_}@7!с@R@<&R *R\@{cE$@S`@/0@@BEA@yATh` @cE/@@Bҡ TSA{ƨ$w``Ga T[#CZ 74@ T! ` @#@KTTD? TT'@*@7!с[B`E/@@BT*SA{ƨ_[B` @#@ TTD?TT'@*[B[co|D?JT' @AT}ӕ@7р`d<[B`D @!'@u'b @9dD!`@c@`7р@zs@7!A8sTß@7р[BR)@b@T@6@#@+@c}@ ?T@z!xa@B1@T!b'T}/@c+@#@'@c @IT`@}"hdz7cTcbˁ B} }#@D?JT'T" +b?#Taa C*JTzv@7!!`@b#B}  }c @M[BcC  bBE{`FA@Bca!E@"@caT{è_֒{ @AG!1T@@_A  {C;[E. ?wh`SccE@d@'fG@4&a@7!a`E'@@BT[BSA@{Ũ_P{V"9 dE{CS[@7# b @BT@`@T@ 6C y}+@T!TTa!E7@"@cAT{ASB[C_ր@@!T@A6C'`[}DT`DA!=@wzB-! +@(v@Vc@< RFRRHc@< RFRR8B-!*@(mҦ#R9@A(  {bBE C@@4 B@$R"`Ta!E@"@caT @{ĨK`E@@B@Tz @{Ĩ_ {D;ccESbBF[E.?֖h``@'?Aia!F@T7@4C%a@7!ak@*6`E'@@BҡT[B*SA{Ũ_@7!@`D!B @@b;zB!с<A bR*.dE{CS[@7" @BT@`@T@ 6C Y|+@T!T\a!E7@"@cAT{ASB[C_ր@@!T@A6C'`;|DT`DA!=@Wyv@Vc@< RFRR2c@< RFRR"@B-!*@(WҰB-! +@(MҦ{ccESd@O@ @!T@6@`EO@@ҡT`SA{ʨ`7`F@A_!1AT`EO@@BҡTSA{ʨ_ky7#R @7/@-@ՙ7`F@A_!1@T@A@R`ZA`D!`@b@`D!B @@Z@'@ @@Ҳ@  {dES[@W7tcbҬe`4cB9qT!<z 5`EW@@B T@SA[B{˨gB9qATkB9qToB9|qTsB9sqT @95`EW@@B! T@RSA[B{˨Moq TqT @9qaT @9`4 Cccc $3? g`@ T@`7`D# @@!@7р`d@a!EW@"@c@Tx!` y4! y5`EW@@BT@SA[B{˨! y4! y 4! y5 @9qAT @95`EW@@BҁT@SA[B{˨PT`EW@@BaT@SA[B{˨@V`EW@@B!TRb`F@A_!1@TA@7 @SA[B{˨_(  Rc`+@BT@B6`D_ {bBES@@$@2T@c-17@[k3_r0T_rc@OC @R!T@` =$RCBS9`#6\j @4@!T@?/4 RTcs{@c{O@*q T*q@nTS[_qTc{@*BqkTTqjT(TqiTqTqhTqhT@q lTQ?$qwTqpTnx?0qVz uTC9y @qhTq TQ  T!JTrBT`D*@*@! ђC`B{@*qT@@60qT!@`F?@T/SS@@@g&5R @[@?dAa'T@1&Tr&Ta12T@72s@ M?T`D! @w@4c@@7!![BcCkD3@N0TqTcqT4#@`T@6 @1ATdЄF@@aT[@T_1Tcq@zATcQ B ؚATRRB*1@@T7@ q7T`DQ?qR3@fM? T@R5[BcCkD3@a!E@"@c! TSA{ը_!B9]s@`/'Rc{4@*qTqITBQ@qT@t@4c@@7!s@@c7!ac@ @{@= R@7=[cks3yvs@D@~cCҢ@R`zҜscQ$ۚ`7#@sEQtДDscQ!@*@# @qT!$ۚ!7!` osE'  6H[BcCkD3@mtДD@5sE *A@7!A!S RS@BR2(! ?sE|RRZ 7@? MT@sqQAzT@7? |@9Ӏ@S Sr T@4*C*QxrT9;jT['A$74`?Tk 5qT qRkcTq CcfkBT@`!4_q!T[@@? "T[6@ Rx_`qAzT_q(T[@9 P[[@mT@)6_q`T"[@#T@7$sEs@7 vh?q! 4q`TX R@!T@a6@?TtДD@! \sTT[@?T@?1 T0S'tДD@4=1T?`G!@ @8 @a!F` Ta!EA TqA T @1@T SS@[@aT@1T@BRcI1T`D!@RH6|RD6R@RR;[@T@1T$RF1T* 6`D! @@rTҍF1T?T*4R"R [@Tq!TS@1TqATS"s)Q)Gks@ RT*v1T@@7њsE@6@*@#A#@5@5@`6@ Rx_`qAzT@R@{ #A #A@@@B@@@R@@@#ARN{@@!6sEN@*@#A@@R@{ #A#A@@@B@@@*#A;${[;@@@2@2@2@2@2*ͻ6c@@!7!@d&@@!T@!69[aT@[2{@d{d@qT`D! @O@`BqTc{c O@TBqTQ_$q T@R@rERc{C@*@BQ$qH TK@_k T@Q{TO@)BM*Gc[{@*BQ?$qT!ǚ T@@!T@7`D!` @,@BQ_$qTwW1T7{@d{O@B )qT`Da!@@a`Da!@Z{S[@R?rTw@vkT*aA!? T`@a@R։`@`RSA[B@{Ĩ_*kT66"@ATSA[B{Ĩl!S?qT?qRR_R@_T?Td@RrT_`@rTSqTqR_օSrTc@*B q@Tq!TR_cR_8vA_T# @Be_`D{@!@x{_*(qTҧ**O{s{  {fr{{[`Ec2@@?2;X @E5a!LDS@k!@s]*@AX7@8@4qs;4`@A@!1@TAz7Rl@7Ѡt;@a!F; @1T;@SAkDsE;@Sa!E2@2?@"@cT[BcC{Ȩ!`z 5*BSksur{>@!j5 R {s{lp @@@!1@T_{~p{`p{A;[`E.@?"c8h`@k^^ S@1@T T^@1@T``@T@ 6@T@6% H 3@@ bBF0@5y9OD T&@!@4/zZF`@7` @7рSA[BcCkD{Ũ_`lF!@lSA6@@7@@@@1T@`lF!`@H`lF!@A@7рSA`lF!@2ҽҹSA  {SB[_ T@l T`@q TRR`@`.@`4` @@`7`@!@4!1Za @@bBFa!D!@ Tq(T`"@4`@Ta*@?T`6@Ri 4~`:a&@a 5q T*Tu& `"@@4u*`6@:_k@SA[B{Ĩ_֠@ U*1T`@qT q*DzTqT`D*!@c@C"5ê `@q,T`Da@@ 4! @`"@@4`*@T`&@@a"@˵˩`&@4`2@Tҵˡ@7!A|) 5@Ҧc"@%˿Tt5d&@˟˄B@BKTbb"c`dTSA[B@{Ĩca"@!5ko@ó4`"@4`*@Ta"@T`D! @C@o! ;@gtF@"3b  {dEccFSA@b`Ҩa!FTaT@6`E@@BT@SA{Ĩ_֍p!!@7!@!  {S*[&`~@F@a!F\! @z@6@6a!D!@da@7!aaW[BSA{è_!сK@7рʩ`D!@UѠ 3/ {SB[_HT@T@S*1T@7SAR[B{ĨڮC" 5`D!@uSA[B{Ĩ_??@ RccFT{@ A0@!@aa!G!@|T Rc @{¨_ R_dR`DB @!@R{  @4b*@_T T`F @{è_bC@>@b"@Bb"`"@@{S @ 4t*@Ta@b>@!B mTtSA{¨_{ ccEStG[c#`@_#c?  Sk wFXҚ @ k @7!сaf`FTa!D!@a@7!aaT`TTT@`T`E_@@BT[BSAcC#@{̨_2oa!D @!@Na!D @b!5`@7``44  {S@ʶ``@@`A@`=@=*@7!сSA{¨_`D!@cџeEd@O{CS[@O```= T_`AL T@"R@ 7aR4@@7R@9B6#@+@Fn@Tj'@``EO@@BT{ASB[C_֢n,qTAСB!@@tF`D!@@BaB!1`)@BaB !1`CB@7D#&RR*ϴ ү {@B`!`T{{_{eES?[c*@_CcU 43@#+@mT+/@6a?TTB@9qaT'Ss`E_@@BAT[BSAcC{̨_Rʍ57@?@q`TTdЎmzZ//s++3 {fES@j 4@;q@5"@@0@@@g`ThT9 Ra!E@"@cTSA{è_amE`D! @'R`DB @! @R  E@9k)   $!Ś?Tha8!ѿk#!Ú  T*hc8hc8_ k T!_8$A7`Ch`8AkT!_8$6_֡T_c c,ccE{S["Ra@j-lzSW@@?Tnz`EH@BT{@SA [Bc,_7mzlRa!LF{  @jm5`@q @{¨_ R  {bBES[A@'l4#@`!Rc`7 bo\ SRl@@7!сaw5j"RRG:7cC`E'@@BT[BSA{Ũ_clmcC`D@cC@7рcCLl@qT0*4ҾcC{A;`E.@? 3h`yA!F" @_!Tb @ @_T @{¨1 @R{¨_{S[c* #̋Y9F*!7 ̋!A #@SA[BcC{Ũ_ { yA!F" @Tb @ @_T 5` @ @{¨$ @{¨_{ @ `4` @0@"`_!`{p%7R @{¨_` @#R0@"`C!`lp {!R[@S@d`A5@!RaTF'fu2@my"@wbT@aT`Fp$5Zy"@T@T`5@RSA[B{Ĩ_@fA@:  {SR`@!RId`BaBkT`@eRSA{è_a [6A7?k!DZ``@ev[B?֠5q@T[B[B{S[ @ij48[BSA{è_RB {S[*R85*N*5SA*[B@{Ĩ_֠7R@B;`E. ?*@h`zL`@ 7`~[*41l @`R_{ h.l5D@5 @{¨_a!?b`5 R![q{DE[c*k@7  < @S1s@TS @! 7BBFa#7<R$R a@7!aa { X4r<kmB!-iT@yk TVha!?4B7*" Rs`@@6R\4A 5a# 5SAsE@E7@@B!TcC*[BkD{Ǩ_Ssj`R84CcEB@!c@l5hek!`7`B67W;`E. ?j`T@` @@(E? T:kr$@ T2@@B!@!*!7Ѡ CcE`!c@XlCcEB!Ҡ@c@Nlk5|٣ ky@7``E. ?j`!R3K5g@lF!@4@lF!@R@LW;@@7Ѡ1:=-8 {S@[*%7@"7*g|@SA[B@{Ĩ_  {S[uA@w@˟T`@`4)TcPnac0 `iT`@ tZuVj48RSA[B@{Ĩ_y{b @A!GW>G`@4a @Vc@Acc6`@`&R"ia @A7` @R W>G` @` w@{kBBFS @[c*!!W`7]$@UA!?ǝ4@B1@TtR}*+@*ʖ[BSAcCkD{Ũ_'`^ R`  {@ShTR@,TSA@{Ĩq`@C"E5SA{Ĩ_ր@;J*1T??@@{S[҇`@`aw&vV[BSA@{Ĩ_h`b@R`  $@g  !$@h  {[@S@@ˢA_BST RSA[B{Ũ_c@kjE9˚nE@Zѫ`?B_!b ^jncCkDcCRkDB @@"@B@#|7A_@_T @Cxb#@!1`T__{׋{_{ !!O7 @{¨_`@7``@E{CS[Vc@wb. #@a Ao=c(@a `=`*_T@C,T@ 4@WI*1` T T @@OI*1 TT+_@ 2CcF`o@*!#`7S?1TS@**g*7b.*B@R7~@5+@L@Ew@@BT{ASB[CcD_+He*bg՞@?R@i 5+@d@qaT`4S@***(b*@D_@@?R+#Є@<RfRERu`ү@a Ao=cx@a (@X`=`*  џEХEd@O{CS[@O```=- T_`A T@R5aR(`4@ 7R@9"6#@+@Zd@'@`@EO@@BT{ASB[C_ַd,qTAB#!@@TF.@Da!@@"aB!1`>CbB@7D%&RR*Һ @ RBpCA!! -B6_ =BQ@M!n <  {A *c @b@Ra@R!a @{¨_@E!#@BB@`F@``N@ `&@@&6`V@@V7!A~`^@@^7!A~ @R{¨_!~@"7!~@7!A~@N7!a~@F7!!~@>A7!~  {S**[**RT)L)SA[B@{Ĩ_{ @`@@7!`@@7!a` @@ 7!!`@@7! @R{¨_`~^~\~Z~{ @`@@7!!` @@ 7!`@@7!`@@7!a`@@7!! `@@7! `@@7! `"@@"7!a `&@@&7!!`*@@*7!`.@@.7!`2@@27!a`6@@67!!`:@@:7!`>@@>7! @R{¨_}}}}}}}}}}}}}}y}o a{ @`@@7!A}`@@7!a ` @@ 7!! `@@7! `@@7!`@@7!a`@@7!!`"@@"7!`&@@&7!`*@@*7!a`.@@.7!AZ}`2@@26 @R{¨_P}N}L}J}H}F}D}B}@}!;} Ձ  {!`SE*p7*!=j7`A`cSA{¨-$!  {R@S#?kT`b@5t@R@a@!QaSA{¨_tna@!Q { A`A@7!A|`A@7!A|`A@7! @{¨_@!7!| @{¨|  {S`[**c**#\)aRcCT)[B #@SA{Ũ_ D!/@ [BcC#@ D!`0@c{S3sF EaFE@'ҁ`JE`NE;`RE E'@@BҁTSA{Ũ_eV?8X5@`RE?T`REyR`NE*ӍAT`NEy@NcJ `FEFP`FE cF`*X {S3sF`*J5`ESA{è_ִДB`>V@>7!<`BV@B7!;`FV@F7!A:`JV@J7!9`NV@N7!7`RV@R7!6`VV@V7!A5`ZV@Z7!Az`^V@^7!2`bV@b7!Az`fV@f7!0`jV@j7!Az`nV@n7!!.`rV@r7!,`vV@v7!+`zV@z7!a*`~V@~7!!)`V@7!'`V@7!&`V@7!a%`V@7!Az`V@7!#`V@7!!`V@7! `V@7!A`V@7!AWz`V@7!`V@7!AFz`V@7!`V@7!A`V@7!`V@7!`V@7!Az`V@7!a`V@7!!`V@7!`V@7!`V@7!a`V@7!!`V@7! `V@7!Ay`V@7! `V@7!Ay`V@7!!`V@7!`V@7!`V@7!a`V@7!!`V@7!Ay`W@7!`W@7!` W@ 7!Ay`W@7!!`W@7!Apy`W@7!`W@7!A_y`W@7!a`"W@"7!!`&W@&7!AFy`*W@*7!`.W@.7!`2W@27!A`6W@67!`:W@:7!Ay`>W@>7!`BW@B7!A y`FW@F7!A`JW@J7!Ax`NW@N7!`RW@R7!Ax`VW@V7!`ZW@Z7!A`^W@^7!`bW@b7!`fW@f7!`jW@j7!A`nW@n7!`rW@r7!`vW@v7!`zW@z7!A`~W@~7!Ax`W@7!`W@7!`W@7!Axx`W@7!A`W@7!`W@7!`W@7!`W@7!AOx`W@7!!`W@7!A>x`W@7!`W@7!A-x`W@7!a`W@7!Ax`W@7!`W@7!`W@7!`W@7!Aw`W@7!!`W@7!Aw`W@7!`W@7!`W@7!A`W@7!`W@7!`W@7!`W@7!A`W@7!Aw`W@7!`W@7!Aw`W@7!`W@7!A`X@7!`X@7!` X@ 7!`X@7!A`X@7!`X@7!`X@7!`X@7!AGw`"X@"7!!`&X@&7!A6w`*X@*7!`.X@.7!`2X@27!A`6X@67!`:X@:7!`>X@>7!`BX@BA6`FX@F6`JX@J6`NX@N6`RX@R7!A`VX@V7!`ZX@Z7!`^X@^7!`bX@b!6`fX@f7!`jX@j6`nX@n7!a`rX@r7!a`vX@v7!!`zX@z6`~X@~7!`X@A6`X@7!`X@7!`X@6`X@7!A`X@7!`X@6`X@7!`X@7!A`X@7!`X@7!~`X@7!}`X@7!A|`X@7!{`X@7!y`X@7!x`X@7!Aw`X@7!u`X@7!u`X@s6`X@Ar6`X@7!q`X@7!o`X@7!n`X@7!Am`X@7!l`X@j6`X@7!i`X@7!Ah`X@7!g`X@e6`X@7!d`Y@7!Ac`Y@aa6` Y@ aa6`Y@_6`Y@A^6`Y@7!]`Y@7![`Y@Z6`"Y@"7!Y`&Y@&7!W`*Y@*7!AW`.Y@.7!aT`2Y@27!S`6Y@67!R`:Y@:R6`>Y@>P6`BY@BAO6`FY@F7!N`JY@J7!L`NY@NK6`RY@RAJ6`VY@VI6`ZY@ZG6`^Y@^7!F`bY@b7!AE`fY@f7!D`jY@j7!B`nY@n7!A`rY@r7!A@`vY@v?6`zY@z7!=`~Y@~7!<`Y@7!A;`Y@:6`Y@7!8`Y@7!7`Y@7!A6`Y@56`Y@36`Y@7!2`Y@7!.`Y@,6`Y@+6`Y@7!A*`Y@)6`Y@'6`Y@7!&`Y@7!A%`Y@7!(`Y@7!'`Y@a&6`Y@7!!%`Y@&6`Y@A%6`Y@%6`Y@7!`Y@7!AbA`k A!0G?(@7!A!tG@7!AtG@7!At=GqG |@@7!As@@7!As"BA@CA!~`@#@`_TM@a@B~!@!CavW@tW@@7!As@@7!As`i@)7!AsvA@$ @,T@2O AcABAA`vA`@@ 99< 9SA[BcC#@{Ũ_j@!RE@s@G@a7!ss$@7!s@7!Azs@fa7!rs@7!js@a7!bs@ 7!aZspX@@p?I@+7!HsFsDs Bs@s!!;s!6s4s!a/s!!*s(s&s!!sss!s!as!s sl!!s_!sUsNrDr:!r-r&rr!rrrrrrr!!r!r!r!arrr!r!aryr]rkra!arirBr8rF!ar)r"r!r !ar!r!rrr!!rrrr!!|rzrxrvrtrrrx!mrk!ahrafrRdrXbrF`r<^r2\r(ZrXrVr TrRrPr!!|KrIrGr!axBr@r>r!t9r7r5r}!An0rp.ri!k)r\'r%ru!o r}rLrBr8r.!adr!!!cr!a r !`rrrqqqqqqqqqq|qrqhq^qTqAq.q$qqqqqqqqqqqqqlqbqXqNq;q1qqq qqqqqqqqqqqxqnqdqZqGq=q*qqqqqqqqq~q|qzqxq{vqqtqgrq]pqJnq@lq6jq,hqfqdqbq`q^q\qZqXqVqTqRqPqNq|LqiJqVHqLFqBDq8Bq.@q$>q 7)B7"*F@7* J`7"+N 7+R7",V@7R@RBxF"SA[B{è_ Հ@<,t{@SДB<B.~ 7.@t7B/Ҷ j|SA@{è_ Հ@</t{SB@`?@5B@`?֠5F@`?5J@`?`5N@`?5R@`? 5V@@SA{èSA@{è_{@S@`?5@`? 5 @@SA{èSA@{è_{@S@`?5@`?`5 @`?5@`? 5@@SA{èSA@{è_{A;SE.@?"h`#t2@b@@T`C@cxCK`@`RN]4b2@A@!A@!Rk>@`AT$@A@C@_T@@?`@F@H@aTSA@{è_րa !63@SA{è8SRa !6&a !`6 @ {S[&V;յ&@SA[B{è_E. ?j`@T2` @T Sa !@7{BF? T"@BT@6"@8@B1@T"8lR{_Da!7@8@ {S@2@!R@=a@&@@x?a@A6` @0@ H@5a@!xa`v@!2av`@2`SA@{è_@a !6a@ !8 `@<@@]@!1@T_{R@S#?k` T`b@ 5[uRB)ck T5 7`@ab@tB)5V`ab@u5Ub@`u[BAQcCaSA{Ĩ_Rϸ`߫ab@5`@a@ "@uC)Q f@****!R`b@a@[B!QcCa@ R[B!QcC`b`@uB)a@!QZa@[B!QcC!Raba~b@AQ[B RcC`b{ @T@@6#@@<@c1TA<)kR{_DA! 9@,#  { @,1T5`@'1T`5`@"1@T5E @{¨_FcF`@c@@@!1@T_F_ B {R@S#?k@T`b@5[tVB)kTo7`@ab@uB)a5 `b@t@50b@@[BAQaSA{è_ta@[B!Q`@a@J!`e@*C)*b@a@[B!Qa@ R[B!Q`b`@tB)a@!Q}b@AQ[B R`b  {BES[A@G4;@4BFcksT?@ @7!`@ T5ҟ T;@@7`"@_T7`GR37C@<TC@  ~C@ a@7!aa cCkDsEEG@@BҡTSA[B{ɨ_Y{{R`~@3MT3@{`@5?TsC@7@zdC``TC@ @1ATsy{a@B1!Tx!!DcksC4BRwdq 4C@Ti}`@1TcCkDsE @`@!@F;} @8`5@w@F?jpicCkDsE cCkDsE{R@S#?kT`b@`5u@ER a@u@"QbSA{è_ֻ ab@5,Pa@b@BQ|a@"Q`@ R`b  BFT@T@a6 R_!`G{#!!@7" &!`A@z{_{RBE@SD@'*!_kT`b@ 5[ v@`R?kTR#@5uB)k Ta@'m`b@!u(@A 5R`b@u 5Ru##@*Ra@'Cm!Qa4`b@v 5a@@[B!QEa'@@BҡTSA{Ũ_['mBv[B!Qx @`@a@ A`@ `#Rm' `@a@ A`@@ #Rm#|a@"R'Cm!Q*bbaa@#@!Qaa@'Cm!Qau6a@"R*bb!Qaa@'Cm!Q`b@a!QҞa@a`b@4a@!Qa{ Y4`IeQҿkiTbH|CAhaa!c@!r"@!@?T @{¨_րA !9x{R@S*!kT`b@5t@ [*`R?k T'm`@k` T`@u@APRǵ@a R)u`b@"5'Cm!Qta5a@@[B!QaSA{Ĩ_pa@t[B!Q5 `R?k Tu@ PR A!`@ !EF,ƀ:!@CDiB  a@'Cm!Q!QaS `@a@ A`@@ mRa@'Cm!Qa*`b@ 5u@'m@7a@`b@!u(@A@4a@'Cm!Qa@"R'Cm*!Qbb`b@4a@!Q`b@u`5g@PRDu@3ua@`b@!Qy% F,!E;za@!Q``b@i"R*bbe!Qma@!Qaa@'Cm!Q`b@\za@!Q'Cm`b@U'Cm"R*bbP {SsF`b@`@`@!X@SA{è_`@!Rҙ9u@UnX`5@`@,;@@{R@Sk T`b@@5[vRB)'mkT`@d@v@A`RkTc4b@RAa_kT`b@5u@'bxb@5k:AR a@u4" @?8 Tydc@cQcMd@*Qd`@a@@ A?T @ cCkDQ[B'FmaSA{Ǩ_?`@ d@IzQcCkD[B"RcCkD'FmbbcCRkDmd@[BQcCkD'FmcCkDv@}j`"h (d R`b4d@kDQdcCQvd+@_`Tu@z99+@ R`bd@Qds+@d@`b@4d@vQdg7a@`b@d@!t(@A4[BQ'FmҏZA}a@!Qa@"R[B!Q'Fmbb|c R`bd@kDQ+@d{!!@7  `Q `@ 1@T`3S @{¨_  {!ES ["@_ F`4"F`4B#R&ҧB(B0/bS  [zs@`Ls&!TB@S`AMR<'E_@@BTSA[B@{̨_?  @_  R!E{C@S[$@OA_kT`b@h5CRK@4K@`@Q`EO@@B/T{ASB[C_ab@t@`@*5caRk`ZT`@k[T`@uB)\bb@uB[5$bb@ubZ5#bb@uY5AKR?_bb@uX5!KR8@~bb@uW5aKR1(a@bb@!Qt~5 `R?kXTuB)'mk YT`@u@A a@'Gm!Qbb@ta{5! `b@ta@z5 `R?kMTvB)k NT`@vB)a@bb@!Qt"x5 `R?k@JTR`Ga@bb@!Qtbv5k `R?k`ETvB)kCT`@vB)!R۲bb@5ARҲ`@a@@e@*C)*z @=a@!QkEa*R `@cDQ`C`@a@ A`@@:mR`@'GmQ`bb@v5R5bb@a@!Qt"45 `R?k 2TvB)k0T`@vB)!R +bb@v5!R%bb@v5!R{bb@v5!Rtbb@a@!Qt/5 `R?k TwB)k`T`@wB) R\RX `b@w 5`CRMBG`BREbb@A5R@@A`@a@ `@**FC)җG@wa@!Q KkEtag`@a@ke@*C)* `@Q`W!5R4`@a@U e@*C)*z a@ Q`A`@a@E `@**&C)YGcks'm*>`@a@/e@*C)*EEwa@!Q`bb@ R*`b7`@ab@wB)A4a@!Q`b@4a@ R`b!Q" Rbb@5AR`@a@@ sC)`@ػ `@ g@****Ҡ`a@sF!QRRbb@5AR`@a@sC)`@``@ B@*g@***n5wa@!QsFbb@.wa@!Q`bb@a R*`b]@RObb@5ARJ `@a@a@bb@!Q R`b R`b R`b R`bsF R*`bAR-`@a@pg@*C)*&@va@!Qbb@"@*g@*C)` R*`bP7`@bb@vB)4bb@4a@ R*`b!QcD!QkEa}bb@B5R`@a@,e@*C)*va@!Qbb@?va@!Q'Gmbb@'Gm R*`b R*`b/a@bb@!Q+ 7`@bb@vB)»4 vbb@b4`R`@Q`a@ R*`b!Q ^bb@4a@!QWbb@"4a@!Qٰ7`@bb@vB)4Gbb@"5u@)a@ R*`b!Qİ &7`@bb@uB)"4a@!QH! R 4`@a@`e@*C)*bb@4a@!QD@7`@bb@u@A4a@'Gm!Q8a@ R'Gm*!Q`b1`@a@e@*C)*F{C\a@!QCbb@w5 R, / R$bb@b 4w5RsDR@R`b@`4sFwaR)4`b@5 `R?k T R`@R*`_k@Tab@5aRkTv@DR߯@v`@ab@Q`4Q`Q!Q R`bRͯ`bb@`@a@`sC)`@``@@`@`@****E`yua@!Q sF{ R`b R`b R`bX`b@4a@!Q!QjR``@a@C)`@`@O`@GG@ `@****D `@Qa@sF!Q? R`b R`b R`bsF R`b2`@l`b@4`@Q`yQ[ a@ R*`b!Q`@a@`e@*C)*FzB[cD!QB9R/ C@b@!EBQv@b7@LFEiFi`;a@!QS`@=ta@!Q R!Q`b  Մ{ @4`@ < @{¨_{RBESC@'sF!`nG"cxEB@7B,bHnRz"$E'@@BҁTSA{ŨU;{R@S#?k T`b@5[tVB)k T`@tB) @`b@t5Ra@t"Q[B@bSA{Ĩ_h?`@a@ f@*C)*Ra@ٮ7`@ab@uB)4b@[BBQ@b@BQb@ R[BBQ@`ba@b@[BBQ@Ata@"Q[B R@`b{R@S#?k T`b@ 5[tVB)kT`@tB)`b@t`5a@t[B"Q@bSA{Ĩ_R;`@a@z`g@*ŘC)*ARLa@j7`@ab@uB)4b@[BBQ@R@`@a@Sg@*ŘC)*!R%@sa@"Q[B R@`bb@[BBQ@b@BQb@ R[BBQ@`b!E׺ {RBESC@/* @iG@fG@cG@`G@]G@ZG@WG@TGRN!E/@@BҡTSA@{ƨ_9 {R@S#?k T`b@5[tVB)k T`@tB)`b@t5Ra@t"Q[B@bSA{Ĩ_=`@a@ f@*C)*Ra@7`@ab@uB)4b@[BBQ@b@BQb@ R[BBQ@`ba@b@[BBQ@sa@"Q[B R@`b {S@ @ @a TBa@D(@9 E$@9CB @ Śd4`?T@@b@@!Babc1@TSA{¨_lF!@Ƞ@ 7р@ `?T@@@!`!>_TD$@9#_8c Ě`P B@@lF! @`  {RBE C@')F`e%Rb E'@@BҁT @{Ũ_8  {R@S#?k T`b@5t@=ta@!QaSA{¨_a@PqTA@A{Ҿ @c"ʉ4@MT@ @!FT4aTf?@!1@TDA!?@WX?3DA! ?@H {S*[***`X)!RP)[B@SA{Ĩ_DA!@'[B@B;{E.`?@h`#@@qB@B@B0@BraT{_c* R#  {S**[**aRT)L)SA[B@{Ĩ_{R@S#?kT`b@5t@APR&`ta@!QaSA{¨_Da@!Q {R@S*!k`GT`b@5`@[u@*5 `R?k Tv@cnfb@vf5K`fb@v5`D fb@f5g@a@cC!Qa[B!QaSA{Ǩ_fb@vf5pfb@v5$ cCb@BQ*ub fb@5` fb@5,B,R"dmb@BQ7cCL`b@@4b@BQ!QҶ@fb@5 `R?kT!Rl Rg!EŽBi )!@ĖCia@!Qafb@05t@fb@t05 !RF !E )!@CCiBmb@BQ.fb@u*b&4[BAQ\fb@tF+5fb@f4t*5D Rc `@RbkTfb@&5k `@Rbk@Tfb@f5z@qT@fb@s*5<ҁRrTz@z7 @`@Rbk Tfb@ 5v@8 `@ `@Q``!ECCi *!@E$B=`fb@tf5-fb@f 4t5!RR` !E@,lcCfb@fb@a`@cCQ`fb@a@cC!QkDaRa@!Qa R`bra@fb@!Qaa@sE!Qa>fb@v4`@Q`T`@fb@Q`L>la@!Qfb@aE R*`ba@`R^`@RbkTfb@F5v@RQ@`@Q`!RG !E+fb@a@z`@;TA@}{j`"h b@fb@BQfb@v4`@Q`ca`@fb@Q`[7}x7@`U R`ba@sE!Qfb@alUc@cQc5?a@!QaRfb@4cCkDsE-RcCkDsEfb@$!EFCiƀ!@BiR@a@cC!QkDsEacC R`bb@BQa@kb@BQ@cCkDsEfb@ R*`bcC RkD*sE`b{R@S#?k T`b@`5t@Rab@t5R ab@t5R@ta@!QaSA{¨_a@!QI{R@S#?k@T`b@@5u@2!Ru``b@u`5'!Rjua@@!QaSA{è_bR R`4a@@!QROa@!Q{R@S#c?k T`b@@ 5w@[R``b@58sTw@z5wutb@45a@`~@4T@!}Ӕjah!}wT[Ba@!QcCaSA{Ĩ_Ta@[B!Q R`ba@[B!QT R`ba@[B!Qa@!Q{S*[**c* `RX)cCP )[BSA{Ĩ_DA!`@}[BcC {R@S#?kT`b@@5u@-R a@@!QaSA{è_`b@u5ubR R@5Ma@@!Qa@!Q#cY{R@S#?k T`b@`5[tVB)k`T`@tB)`b@t`@a@ g@*C)Ҁ@*Ub@[BAQaSA{è_`7`@ab@uB)A4a@[B!Qa@ R[B!Q`ba@!Qa@[B!Qjb@AQ[B R`b{S@[d@c%0@0@@? TtD'?'@ TSA[BcC{Ũ_?AT@@0@@dT?jT'`?cD'@AT@7c d@@D!F@ @c @_ TE@!!@ @<@'?cDaT@'@7cC@7!Ҳ`@T'W'@D`4'?T@'@7U'@ҁU'@!!@ҀU'@X'U'@{SEkc@@K`T@@l6 @T@k6`@c1siT @1AkT@@ST@"7F_gT @OR@(T[%S@ @@Cӻ| x@Cz Ta@  T5FtF(6URkhTzS~S4K?UO@KljTK=UKi~S5hTe5[BҟlT`@k6S@@!6O@UUK@UcCsEE@@BҡTSAkD{Ԩ_q(TTF3RK ]3UO@K!CX7UK@K=K@ZF3UO@K6ZqT.K2}UKYҬFҚ3F3[cs.`s?1@T`_K']UO@KUC&7SUK@KC;? @?K &CU8Kuf$79UK@ K{9#CT@7% @7F@CbG3R~C7R7"G@xw;A9@$*v"4q@%T;@;aTї@@1T#@@O`@@TO@@@@ T TO@R @ T@q T @@@ T` @@?T @C A TC`7`@[K@7`@K!iT  @O@TO@`@7` @7 cEBFc0@c@`?cCsE!ta3FT7BT7@7=T7@D!!`@KF@@O7@@c7KO@X7@4R7ԭK 7@S @7 KS@`@[1@T`@1@TF3"37; @@ TF1 )T@7р+JB@7BB*&@7Bт*%@7 +FҚ 3^SSMF;Қ3@@7@[BLcF|37S7@4R7~6SSKSK7@@7SK@Kz*R796SK@KQq-T~KSKu@6ҧRKjK`SK57@7SK@KqT?@9!ySKSKU7@7SK@Kq T=KSKU7@7SK@KQ @7  @73r@7!сA `@K7` K[BzKC K@XSKU |7OSK@KqT?@~!vK`ASKUCe 78SK@KC]RR7!с@7`D!!@*[BKRRRR`@7р@@7 @7 @`7R[BKWRR\RR|RyRvRsRҸ``@7`7eR7@ @7 cCsEZD F3қC7RK@K'C6҈ҡRK@K@ @@TO@K@@7@[BK@RҜC7~S~RK@KC 7tRK@K RN``Rxt@7!aQQcCsE {R@S#?k@T`b@ 5[v@: `b@v5/a@v[B"QbSA{è_8!Rv bR Rx4`@a@!ReRa b@[BBQb@BQ$ea@"Q[B R`b{R@S#?k@T`b@@5[u@`b@u5a@u[B"QbSA{è_B bR R(4a@0Rb@[BBQb@BQda@"Q[B R`b{R@S#?kT`b@ 5t@c\L [ub@u5#9a@th ~@5TN[BcCa@#@!QaSA{Ũ_։@}ӵj`"h ?T9!}pN R`ba@[B!QcCt@z8 R`bҍa@cC!Qa@!Q {R@S#?kT`b@5`@t@[*5R@ab@ta5Rab@t5b@t[BAQaSA{è_.`@&b@Rd@sab@A5`@"db@AQ[B R`ba@[B!Q`@RbkTR> `@Rbk@ Tab@ 5v@aR1`@!EQ`c@9!@Rk@b@BQba@!Qab@5u@ab@u!5R  R !ECCi!@ƀ:E Brca@"Q ab@tb4[BAQyab@v4`@Q`R `@RbkTab@5v@aRԝ`@Qab@b@BQbab@v4b@BQbaR`b@ab@BQbl9ab@5`@b@b@,ab@u5R`AQR6!EBi!@`;Ci b@ab@BQ R*`bb@BQ {R@S#?kT`b@`5`@t@*5aRba@t@!QaSA{è_`a@`@RbkTaRH@RA@!E ;!@CCiBa@!Qaa@!Q`b@5u@`b@u5aR `R!ECCiƠ5@.`Ҁ/ZEMTMT ks84s@7@!E_TkTˠrT ks84saT ^Ts{MT k{85{ u`.T@x5 H[T@@Ta c . T@x5sE7@AsE0xc 5`@7`/DˠD. T@x3s {{>5{lT[T@aT@1@T@sE a [. T@c@4`@7`sE)5c5`@7`CCsE;%c;@5 @7 @Cc 4`@7``C@7C7@:@.ҟMT Tz|_k`TaTˠ ˠ mT {s 4saT4`Ts{ @!E_TTˠ ˠ .T@x3sѺ@x3s"@@b7 ;kC;@;b;@ 5 @7 `]C@x5sE`@`7`OCb5`@7`BC2@O뭳Tjy8[5ˠq_/,T@x:Z #rT@.`Ҁ6.ZE TT {sx94s`@`7`C r9r9@9T `@7`@ZBMT {sx4saT@Ts{T {{x5{ az[T@Ta Uz .T@x5sEܪ.`Ҁ` T-`Һ7@%RT;K;@-z ;@.T@x3s;a;@@5 @@7 Bta`5`@@7`B- Һ7@$RT;;@p;@.T@x3s @7 bB7@:@yn-ҟTTz|x?kTaT3@E? Tˠp @@!E_렭TkTˠy2paG`5"@@7 ;&B;@ˠvpˠy.LT@x3sѸ@E?뀧Tˠyˠy;;a;@5 @`7 A.aG 5"@@Ѣ7 `;A;@> *qT|GHa8_(o{S@[7@`7a@k@s6S| @S @kY+Tc?r`T?rxar TrZkTqaT`@r T@r T `g< *`@1@T`F@A_!1T@A_!1TkTcCkDsESA[B{ƨ_ q`T`9<%RK@@!1@T  T@7Ѡo@!1AT oT yD!@8@**cCkDsEҮ@{+A`;%RG 3@!1@T )Tx@Q`;%RJzx@!1@T pxuTy>cCkDsEcAYAP[BSAkD`sE{ƨcFcPѤE{CS[@_ `.C` O@A=c(@a `=`*_T?6@VlT@@4TO@RBBE_@@BT{ASB[C_֏@35$@<&R<*R``.Cv@a @VAO=c(@a `=`*  {1@T!E BF(@q {_S!E {=T@T{_SG!@{1@T!E BF @q {_ּS!E   {!ES[ @m*s7`@$@^Y`Y `Y`Y `Y`E@@BT[BSA{ܨ_D@`@7``? @?r`T!R!06{[*@S@?rT?rR]I@rTr4 [BSA{è_C@@4G$hc8hd8h#8ckT_ ѠE{CS[c+@O $@<R =RR Fy@RB;E. ?֡!FL@h`!F`TTҿTR @v~@3lT@ 55sF@EO@@BaT{ASB[CcD+@_qlT6"R@`5s;FA76@7!3?lF!`@$@<Rv@ =RR^`Ҽ"RM 4Ҵ@vF@4@Tu @@Tt@TT`@F*`7FTFFgF@@T@ 7DB @!`@~@AT@A7DB @!@r"Ri`@E*6gR  {q S*[@sg7W@c*7@@!?)'q`4@k*@C@k;@ҙ:   @O!+ Tb5~}BP6N9?@k!@ ;@RG@ |@! T}#i`?kT!k ?k3ÓsKc3k Tk T#kTg@k`@zkTsc C@`Ks?  @ tT?@s@kK T{р#,TcCkDSA[BsE{ʨ_Qh7@OK@ Kd@|@@1@Td` ! cCkD@D@c;k12h-?q*!9cCkDcB c-cCҿ@T@7?R@cCa>R@ {р7@O@{a?@ks@ T#`{чC@`K@ !D @ @c;e!K@@>cCkDicB c-@7@C@ڍ@ O2{AS!Fϝ*!ay6hTR?@7!сa@7!aa=@6SAR@{è_֠D! @Ѡ ==`@7`SA@6~=SA@ {S*[***k`X)RP)[B@SA{Ĩ_֠D!@~[B@{SPC"R}*a@6*SA{¨_ !a6=D!`@~@9!E_qF _{}F{_ {S @`@# 1 Tc 1@T1` T*[*1@ T`"@*`aRn1 T`"@*` Rn1 T`"@R`Rn1T$@R`"@a Rv`un1@T`"@ `Rln1 T`"@*` Rcn1T`"@*`1@T`"@R`RTn1 T`"@*`1`T`"@R`REn1[BZcCSA#@{Ũ_[BcCcCO{BES[A@GR=965aRo@4`@qT`6@R4#`:a@`.@ 4` @@ 7`"@5`&@ 4`2@T`"@a>@'@!?JTѴ @6`"@5`&@4`2@T'@`>@T`"@ 5Tu"5&O`6@:@#@`7EG@@BATSA[B{ɨ_@'@!BT`T˓g@6~c@@`2`&@ 4a2@`"@?Tb.@_T'@b"@`"B5T`2`"@a2@`.b*@DAT`*Da@@4! j}ҴB!@! Z}a*`*@T`&@@u"@T"RX@`&@`&}X 4D!@:}@!E!@@@4AT`"@`4`*bE`@b˿aEc Du>@'@5cB˵c +T%c@@'@`2@`a"@'@`2@!a"`2N@M5Kc@@`b"@a2@Bb"!a2n9`*@TBbw;`*@ATu*&`@@!`"@b>@_kT`@@!sa"@`>@`~4a*@$AT`2A `*{ cES[`@g#G  [& kϝҹ9FZc9+ @ @ @7!сa;S F`T!D!@Da@7!aa;TT@`TcCkD+@Eg@@BaT[BSA{ͨ_֠D!`@cCkD+@ck+cCkD+@`@7`kD4+@cCcCkD+@w5:{S@[?ր5v@cw@`@ATs@MTcCRSA[B{Ĩ_" T{v`? 4cC"xv? 5A{ `g! @{¨_" @_T AB"c#HP_ѦE{C[ck@O?T*!~SsL8Қ8RTG@;C@ ;SBsFEO@@BaT{A[CcDkE_hz{|q)TqT qT-FB2!2MLkT}Sm2`28888SsSBsFһh28885*T`z| qT}S!d2`2$898য়q@T(Tq@Tq T q TᏛT`z{ _q T{8 @` 2:G@Ҍ:C@:SBsF~q@TqT @` q2cR3[T`zb! B| S,Fӄh2`2$8c`2 8#8ПCC;`'#@K@bB~?+T @?᧟ @T@@7@r@TrT@@;2;@@7K@  R?l?@@€;1;@y`';@?a?@m =9K@ {S 7@[*ck&ARS@SAkDcC@[BD[@Hc@L{Ũ_֠D!@}zSA[BcCkDD!`@ozSA  {S*[***`X)RP)[B@SA{Ĩ_֠D! @Kz[B@{S@LSA{¨_{[A@S!T@6@!T@A6S@c T@? Tss҄b_TsJ5%R )5@SA[B{Ĩ_րAƀR`!D5@..!`@@D@!@@D!@y@E!@7@y@  {k4R{_֠D!`@y {S@8@ ?ր@7рSA{¨_SA{¨;8   @@_ 7!aR_{+8R{_{ @`@@7!A8`@@7!!` @@ 7!`@@7! @R{¨_777{ @`@@7!`@@7!!` @@ 7! @R{¨_777 {S@@TFAT`@7``SA{¨7@94 @ 9SA{¨_ {S@8 @e8`@c8@ ?ր@7рSA{¨_SA{¨7{S[@8h@`@#a@vB`&@T@ ?֠@7Ѡ`SA[B{è_zt5}SA[B{èk7  @aR_{S[cvbA`@a@=˿b@Җ˕@``<T@@Ab7!A7b @"0@b#747җ6[BcCRSA{Ĩ_A"  {S`="=Na@u@ N= t1` Tt1 T@_TqT C @DRr T`@` `"@5@7"@@q TRSA@{Ĩ__Pq T_Xq T_`q! T C@DRrT`"@4"@@q(T@a @@7]t1`TF C"@ RA~1T"@@@@!<@&CC7@6CR"@R`Lh1T@_Tq@T_PqT_XqT@7 @6T1T@`6`@D!@a @|Ѡ}6@@7Ѡu6  $@_<TC(Bx#$_3  { @`@@7!`@@7!` @@ 7!a`@@7!!`@@7!`@@7!`@@7!`@@7!`"@@"7!a`&@@&7!!`*@@*7!`.@@.7!`2@@27!a `6@@67!! `:@@:7! `>@@>7! `B@@B7!a`F@@F7!!`J@@J7!`N@@N7!`R@@R7!a`V@@V7!! @R{¨_֬5{5q5g5]5S5I5555555555555w5m5c5Y{ @`@@7!`@@7!` @@ 7!a`@@7!!`@@7! @R{¨_P5N5L5J5H5    @_  {cES[`@'ҲU#@ T@?0qT#@5T@95?qTE'@@BTSA[B@{Ũ_`n1b TD!@~##@~T?qT`n1bTCo!~D!@!{cES[cks'md@w@9s_qT<R_qTR_q@T *CQ$q T_qaT@9d_qT?q* CIQ?%q T˄c R?jT @Is 藟 闟 *5Bx**K_q`TRq TA% *`Q *|@74Q? k ф,kl8qT[ kҁzKRRMR*kMT Ta~  k T3kl8!Qs @8@8<LT`cBqRҀs&q,T_q4T _[1TK@ K!@  s@!`ass@H5DB@><Ew@@B TSAA`[BcCkDsE'Fm{Ϩ_A%*"@8d"@8r  A -$Qcmb(as>qLT_qz4m T_[qT @ s@zas * ]@9qTqTR qT RNRQ$qT  `R$2rBNzB/5 L]GB @8y/R@9K; A /ҏR@9 @8R_[1TbK 4 K rT!!!@ s@!bas|` 4|qT!!s@r!J RRcq-T6!b(RaB|bCQ_qTA rT @ s@aasAlr T?q8T  s@!|JAR?qT6Ab(RaB!|RKRBKk4TbK_qT K r!T/qg `-H4s@@R! Rbs@afs`( ?k1TR?k5T<@sqT"_Tk@AĂ!ka8?qT*@(R"R R!?kTBxSRRARkmTs~"k`8sQS @kaKЄ qTH4s@@4@` RyTKqT|qm Tb RBKq  nR )s@ `TE0` R)@@$qT6'8Rk-T_8ARBQ7@AR|@@Q_kTs~"k`8sQS @ ?kTjs8ARBQ7@s`Q R~@Bc nq;ᧀZ <@gj;g @/c@@_BB~ @SD0@ R,1@@7@ @@b_k@ЁkЃqT!KBK`K@?q T_qT@qT@?qT@?qT6@`L0@@/@@@kTq(Tc /sKW/@`@+[)KK@m K hS W@f@q@-&T`@Q |`g"g`bs@ aI4Tlqa@a! `@RA( ?k 6T@qԠR"@zi8TR |`g!bBg!(bs@@_q( Az@@z8T!@[@@  ;@<)6;@3@ K@bAaAR} k-T.kl8!Q ~0Y)S;@*C6@;@ @ s@c?QbcbasK q(g@gAR `~@6@;@6@jR TqkTT@#4@ ?L@@T5@4s@*g;@asQ5s@@T@( ֠RkT@@kJTs_@@/@! %@!R5 %A@ R!*A@"Q@AK/G@$@?q$T%TG@ @Q @-Q@@?q%TR@a ?q,(Ta ?q TG@- 6@RAR5@"kcǛG@"kc8%.K@+A%T@@@5@@q T@{kT,G@*@@51`T 5;@C4s@ K*` K@Q |`s@K@aT@@xT!K?qT*7l@saK@ 8`sy@ms@K@T@@( A4֠RkTnRk@@TkT@ Rs_4@@6K@ 8` `sT;@eDQL2)J`@5`@qT!R.5a-@qMTG@{@kMT@@6s@!(`sxT( a R!KԠRk !kT4( ;@D)^cD)4n @`a_@T_T~nZ iTla@aTl@aQ@kTRB @(  R l|`gs@!b!(c fs` ( kT_` TsO h)T f֠RBK `B @|`g5yqqc@a! `xb8a4@@ aTD@ aLT0;@jR@ "G@4G@E;@q"5G@@K!K5@G@2;@^@@WKqT k*T@ Rs;@Ts@@ATH@ aTs4@` G@ @?qT@IS@`6@E@_@_q,TC;{E.?`h`@"A`J"` {_u-{[5@Ssq!TTqATck7hA9@<:>yjҁ@Rm1T*KLT<=N`C N<N<Nx@B7`@@A6<`"@*b=`NR N=FAa1@ T<`"@"Rb=`NR N=F3a1 T<`CB=NF N<N<Nw1T<`"@"Rb=`NR N=Fa1 T@^7<"= RN N= F`7@`"@`x1ATkDcCM;g Fc)b@_ 8@ ҭ<cC"=Nc kD N= FSA[BsE{Ϩ Fc)@_@SLS@5@bLS@ 5@7Ѡ`N,@<3@"=N N+= J'7aT3@@!x{K{` TҀ@_@,C@7@7Ѡ,kD,҄,@ @@@W_m T<"=N N= F7@@9xx%qT T<"=Nc* N= FCB3@!{bc@(= <N N= FcCkD@!1@TS<"=c`+N N= Fn;ъ@7Ѡ@7 <R!R=N`"@ N`=FH]1cCZkDi+@J4+b@_ ]F*% R5TWLT`"@8R=`#]1T=fc&1!T9fc 1T0<sE*=NSAc ,[B N= F{Ϩ <c@"=N N= Fc;@;u@#@T<cC=Nc! N= F@+`"@fR`!RmTFR`"@R`\1@}T>|<B=N`C N<N<Ns@7@7<R8<@R=cNR@`"@ N`=F\1`T<"=DRN N= F 1T@<`"@Rb=`NR N=F\1T> <B=N`C N<N<N8s 7@7`*<R=N N= FQ1`T<"=DRN N= F1T{@?= 2T[L{Ck?*2Tz{y:2@@9Pqa3TA@QqTA@`3T<=c$N N= F4@i7h*cCkDBUA_Tzw@q T`"@`?@TF"RR= \1@eT=?T>`dF`Cr=7@7`FR`"@!R=`[1aT=1aT@fR`"@!с!R`[1T9*@7cC @<@R=cN!R`"@ N`=F[1cCZK@7`<`"@*b=*N` R N=F[1T<`"@Rb=`N!R N=F[1@T<@"R=cNR`"@ N`=F|[1 T<`CB=NF N<N<N7r1T<`"@"Rb=`NR N=Fa[1T<"=DRN N= F1 T<`"@*b=`N R N=FF[1`T@Ck!!#?T{y91JT@FR`"@R=`)[1@IT@9=HF`Cq=7@7 FRCR=1=aT1s)d=o)=k)cC'=e)=T<*`"@ R!!RZ1 =T<`"@Rb=`N!R N=Fr<cCNc" N= FkD9 "=c`#{y <N N= FzTqATf 6sNO 4o<"=c@%N N= Fc{Scc@[b@*t@1`Ta @"@"xt*`nZ1ZSA[BcC{Ĩ_ { @STT~` @ ` b@D_JT"@a4@!a4?1@Tdx"RSA@{è_J{#RST@C1`TRt SA{¨_ e @%{S["@ef @`@t1T` @4 RSA[B{è_xext1 T"@R`!R Z7e@R_` @3   {[cSDRPr!T`@"1T5`@c@@cc+1T`@G1SAZ[B@{Ĩ_ @!R`RY1ZSA@[B{Ĩc*̲SA  @  {S[TRSA[B{è_֠"@*s`a RY1T  `BE"g{` bA@hTS `T @6R!g* `Ta$dӁABpQ$R~FfCa~!8c?iTC!d4*C6#*RRdBKRcK" šB@!$ÚB!|!E@"@cT{¨_֤Rb B@aT `e`ԀT {_t{!R~{_փcF{BEcLD@ң4qT4@E@@BaT{è_ z?q`AzATha8!C9B? aT@ A4@9"b8A|@"`Ss|SD* SqTGIha8Bha8gia8Eia8@*)ia8ha8!!*!*!*B@*"b@B(ba@5s4 @@a"RD!,@h @~nQ(a @{k_SY[c ^mT?{ TBKT?{T"@*`! RX1ZSA[BcCkD{ƨ_֠C+zssd@ko*?1Ta@d1 T?{, T+@+{@?JTa{y9!@|d1T+@!@Bcc`*Tzs@A@!1ATbx3sC9o`7 @7 "@*`RdX1+@ZA @@7 &+@&cc@"R"@aRdv`FX1@T+@Rcc@R @! Rdv`5X1T{S@? 5`@SA@{èSA@{è_{!ES @!R7ҲE@@BҁTSA{è_[ R` {cFBEScLD@'#4qTa4"`ha8!`9s? aTR!E'@"@cҁTSA{Ũ_1?q"`BzTsA4@ `TR@Ol aT ` TRG6g.gblyc8ca(bycCk@T|S4!G?q,TRR~@$|t4*|Su9*aj"8|Sj"8|Sh"8%h"8`|Sh"8`|S h"8h"8R@4R@a5Rn aDTG@(`*!QG?qT?1+T ` @z@T8a*GD!-@?g@G!`.@6g{@ @?B;ՀE. ?ց$`.@@h`l@@BA@P@ T E!`.!`|`T_ @{¨_cl c5~m ՃcE{d@,ҀFCb`@a6R!E@"@caT{è_րFjCBۃ!b%RU{cESa@!C!-S4B`?1TF!E@"@cҁTSA{Ĩ_08@{SB_T@T@3@!1@TSA@{è_/C"S`5BF  {)E@D H!T@ H!T{ &5& 5D{_ց!Ez&5!Du&5 {BES@@7`@T[@ƌD!EAa Ta@c@#3?Tc`BK4/@d@@!1@Tq TAT@7!ѡA$cC#@E7@@BTSA[B{Ǩ_c#LK`4@7` @7Ѡ cC#@ &5&5UJ J c 6T]qTT@7р cCK4@7Ѡ`O$@7`H$@`7рA$cCҠBE7@C@ATSA{Ǩ42$/$[c#"a@@?T@7р$cC@7Ѡ`$7@7  $ncCk$cCcC  ՃcETHƌD@T{%q{H {S[U@_T T[BSA{Ĩ_@l6`@7`bҁ @Tzuzu'6`@7`@@Ү#@5#nR5Ҡ#  {ck*vI 8-[S+Icq @T@ 7 T{A`@1T@@1@T@4x'7`@6@@7@` a@7!a! @7!сa\#` V#`6`@7!aI#SA*[B+@cCkD{ƨ_2@`@7`@@7@/#  TD!`0@A##D@4@!@/1`@h@# # #E{@A@ҁ!F C!E@"@caT{¨_{ _AT`@)95F @{¨_C1Q 5ccE{d@%`FCb7@6Ra!E@"@caT{è_`F\CB#!A"R{S!R`4@е@B144`?7`FSA@{è_ {bB4F@T@ R!aT{_`Da!@cR`D?q%Х-c@*!1R@@`cуxccхL@`TL@TL@TT@D R_dD{ @!`2@WR{_*BQ_qT{a!TG584285`D{_ @ @?T`Fqa!E@!1@T@@"@@qaT_`Ea!F`D__`Fa!E  {DccE@gFb@B#4`FA  Aٝ @a!E@"@caT{Ĩ_   {hESC[=#='=*+=/=3=7=;=@7/' )sP 4T7>*c}@*zbB  Ra!E7@"@cTSA[B@{Ѩ_`"qT>c}3|{ccESa@!C!-O4@B3 @4B`?7`Fa!E@"@cҁTSA{Ĩ_R{ccES[b@7C72Ra!E7@"@cҡTSA[B{Ǩ_c#.ccwF#/?\ 43@@@TT@!T@7 6cC#@cC#@"qTT{Sa@s"SAR{¨_Z{"@ `E@`E_T" @_T" TT`Ea!E@"@cҁT @{Ĩ_@`F?a!E}2@T  { @"8@BB@{e{_ 4@`@3@3 @_  {a!ES[uF"@ҡ(a!FT7@sZa@7!aA`E@@BAT[BSA{Ĩ_^(@7!Ag `E@@BTW] @7!a@A`D! B @@jL [BSA{Ĩk { _T`@Iq Ta!F`E @{¨_C@4N5 {1@T*?q`Ea!F{_֟3a!F  {dES[@'$B404#@`a!F!["єa@7!aa@6`E'@@BTSA[B@{Ũ_@7`рdE{CS@/B?@@Ta!FR@a!E/@"@cT{ASB_t@T#@<@>RRR?4@RT#@<@>RRR?@bBF?!@&*@6a!Fh @<`?&{@SBѺ ҴҮ Ҩ@⋑!4&9`7!437@0 !5`u*@7!сa7w@0 !@5Pu*@7!с7BBA!3|SA@{è_  {S*[***`X)ARP)[B@SA{Ĩ_`D!5@[`[B@{S@%u*@*SA{è_  {@S@`?@5@`?֠5 @`?5@`?`5@SA@{è_@SA{è {S @?5`@?`5`@SA@{è_SA@{èccF_B?!@1T#@c1T#{&@T@`76"@_ATԆ*{64"@_T`D! 7@x{_a!8E]4`4@_T@{@94{ @94`D @!@6@_ {gD@ShEHTf@GT,`TC 5SA@{è_@55uеD@7Ѡ` a!E5a!D@5   R 8R${@S!CaR#ф@@_sKs?Ts~@`LSA{è1ssFs"3SA{è_1[v֚FFH7!F@u7р`~@3@!@7!с@7Ѡ`[B@7р[BҞ[B[B {R@S*!k`T`b@@5[ v@`R?kTcJb@RAa_k` T`b@ 5u@ҕ xb@ 5k:Rka@u@?8lTc@cQcAa@cC!QkDa [B!QaSA{ƨ_ֺa@`b@ 4a@!Qav@}j`"h  R`b˶a@kD!QacC!Qa+_Tu@z99+@+@ R`ba@!QaZA}<`}a@!Qҹ R`ba@kD!Q+@abBFc"@#@B@%@a˂@@c |c|ן_ {S*+@[**c*kϽRkDX)cCP)SA[B{Ũ_`D!@8@-^SA[BcCkD_`E{C#@@ ``AT@sX1`T`G`@1@T` @`E@@BҡT{A_~@@&R*R<@{6*1T{*/{_ {a!E`FS"@"z`)&@6` @@Ta!G!@%a@6`E@@BҁTSA{è_`@7``/`D!9@]!aa!!с {Sa!E@#@'A0@a a!G_ Ta@#q1 T`@[#@ؖ#@@#6@@@@6@@@@6`@p[B`E'@@BҡTSA{Ũ_[!!@~@|#@zxvt[B!!!A`DB @!:@ҿ!@+pt@7!с{S@cwF[ks@T I%q 4J TH1 *j  @#R_T#Re@1T@ Tqd@1T`@$V 6`@6RSA[BcCkDsE{Ǩ_{{F`L1@T` v3`L1@T` @ @1T_aT{#3R_?33@e`D! @\{{F@!@?TRqTT`@1@T`@7р_T{#3Rc@@c@3!@o?TRq3@TҮi@7!с R3q3@TT`@1@T`@7р ieҋvi3@o@@7!сcRqKTc@T`@1@T`@7р<o@T`@1@T`@7р@/-cc@cc@"(33@Jc|c@`t`@nRj f@!0@!@An`D{@!@ [{_  {bBF@B3STSA{¨@h`` @h@7BтSA{¨_-R{[@$@TS KT~"v` @@T@@6a T`ha@E7dh!! T} w [BSA@{Ĩ_[B{Ĩ} SA[B{ĨdEDE{CS[c@mT?@F Tky@1Tt @@T@6`@#8@6Ts{@`@T@6|@@T@ 6@ @@```@| ( @xz Tz: TZT+- `F?` Tc3"COޮ O@ @1@T ` @@:T*@bw@AT"__qT!ч5kEsF`E@@B!T{ASB[CcD_`@1@T` @mT@1@TksB, #X`G!;@Z`lF!<@Z@7kEsFJB`,!;@@rkEsF,@s`!AWkEsF,`kEҠ@R *R`9ҐB5! ;B!:@@rkE +T{S[B+c87"ksB TD@RqTZsxa33`ZqTSA[BcCkDsE{ƨ_֟T vq TszQ.qT#ӚT@ T T@ ?T#Ӛ? T?@T)T˙@!B?@9T )T0@T@@_k(Ta!H9A@59QC 9~ӟT@kyzrqTHQqTRnqTT@BB*_@3T 4ADTT@BB*_@3T  5` Q@{`5sQZ | Tӂ@! _HTrT@cB*@3T T0@)T@@kTK5sQ# s~ӟiT kszqTOiT˃@!B?@#Tb CH#: T0@T@)TP?qTR% q@T%qT 7A7_aT+T@ ?,qhT#yT˓@B@3T4!K3A5sQB s~ӟiTAks@?<q@TA@B@!#T`D H!T T)T@BB*_@3cT  T0`5` Q# ~ӟT k`zqATT`@ITp*E˥B@$TB~ETFҟkTx`kcTBA 5@_5  Z_֟iT@ ?2ZT@bQ_(Ta0!H3Aq`T`4s Q@ s~ӟITSksBB*_@3Ty 4  {S@ @@ ?ր@7рSA{¨_SSA{¨B { @`@`@@7!A0 @R{¨_@7!%@!7!eE{CS[c@Ҥ T_`C TX@AT5@w@C@ab;w*O`E@@BT{ASB[CcD_+@@+7 7@`75!@7@7!!aT `T+@@@ @5@7!сT7*@@R@fR%R7ҵ7*7@+@Ҫ7@+@@v  O{S`E[@/```````2=@?C T| طbBF@H@?`R /#3C`NO@J@F5?q,T+@?#Ж+@?$ЕK@J|@@f)`B1%!e@Ttc`E/@@BT[BSA@{ƨ_#`D!@W`R@R`@``!5`D!?@W @_qAT_q"RAT5Qr{ @`@`V@`V`R@~ R @{¨_` { T@`vV~ @{¨_{S@O@ ?ր@7рSA{¨_SA{¨  {  @@7!`@ `@@7! @R{¨_֮@7!a  {c@dES@7cCB3ch 43@Un 4!@@?5B@?@5F@@SA[B{Ĩ@@`?ր5@`?5@?֠4@SA[B{Ĩ_ @`R_@T@74@ @_R_ {S@?KT`T! Ӛ?Ts~ T(TA!|F9 @ѯ@SA{è_րSA@{è@@|F?T@1@T@G!@WR@@|F?!T{ @4@FK `@1@T`  @{¨_֠aR@p  {S @ta @?`TFa @!a SA{¨_@E@w@4$w@7р@@hD@w`5@G!@Q{BBESA@+$@FBna@6@E@@BҁTSA{Ĩ_!aA_U{CcES[c@a@/@d@0@`@WE@TS C4 @ TS@Rj38@E/@@BҁT[B*SAcC{ƨ_֬#@SV @% T@!QU>G@G!T#C7 @#@K TA!8E& 5`$ 5@T@ 7@8E@*7!ѡA@D @!@s @T`!'@*C`4 @TlTlTseTs$TT`KTTDMT'@TT+@jTj`8j!8#@! @+TTV>G@D!@PZ@kTATDT'@D!@sFDJT'@V4wR<#@+@҃ @*Ta?cTcb`af#@s!X+Z?Ta[| bˠL @ {BBE C@. T(T* RA!Eb@"@cҁT @{è_"@D! @PR{@A@$RBzT{"@G-n@@@DB @!@q!@TДE@T` @Ta@RDЄF!hc8!!" haB1Th!@7@!:_>7@!`;_@=7A!;_<7A!<_;7A!=}_;7@!>w_@:7@!?q_97>@!k_87*B!e_87&B!__@77n@!Y_67f@!S_57@!M_57A!@G_@47r@! A_376@!`;_27A!5_27A!` /_@17~A! )_07"A! #_/7A! _/7A! _@.7B!@ _-7*A! _,7A! _,7~@! ^@+7vB!@^*7@!`^)7A!^)7RC!`^@(7@!^'7A!^&7zA!^&7BA!^@%7@! ^$7nA!@^#7A!`^#7A!^@"7A!^!7R@!^ 7Z@!^ 7J@!^@7@! ^7C!^7@! ^7A!@^@7B!`^7B!{^7B!u^7@!o^@7A!i^7:A!c^72A! ]^7@!@W^@7@!`Q^7 A!K^7A!E^7@!?^@7A!9^7B!3^7B!@-^7@!'^@7^B!!*!^7RB!^7C!@^7FBA! =^@ 7C! ^ 72C!! ^ 7fC! ] 7bA!&]@ 7ZA!&] 7VA!']7NA!(]7JA!*]@7^A!@+]7FA!@,]7RA!,]7C!-]@7A!.]7C! 1]7B!2]7A!2]@7B!2]|SA{¨_  {B#f|@ G9B@9g7@@ $@A407 R @{è_ 6@@ $@4s @sb@A!F_T* @ 4s @ @C{  u4Ta @T @{¨  @{¨ @{¨_@D{ @"4@BB@{OL{_ 8@`@3g`3g {[S @ T@c@B@@_@ T_ 4"@@?@1@Tu !3o`@T@1@Tt` @cS`cC`[BSA{Ĩ_``@ `@7`@cC` @@`@`T"Rظ4.@`7BѢB`@wҤcC@D!@ HcC@A @@D!@G{S@?5`@``@`@@SA@{è?ր4SA@{è_?4 {E;S@E[f@@O@E. ?ִh`@@EO@@c!TSA[B{ʨyck+5ckY@@8`@`@x_ATT+}79}5a @7@#y+@@EO@@BҁTSA[BcCkD{ʨ_@EO@@BҁTa @[BcCSAkD{ʨy+# @_@a @y}77@@+}7}a @#7@ly`T^+@i?c@N7 {[@S@@0` @@7!сaSA[B{è_S`@1T`"R4@7р@H҅$@T{@ 4@c@ @{¨֠J<494R4BBDT @{¨_@7BBYd@@D! @@mi  {S@@@ ?ր@7рSA{¨_CqSA{¨2 { @@ 7!A`@@6`@@7!A`@@ @R{¨_! @7!A {S@ @ @_T@a@@ CD(@9E$@9B @ Ś$4c?T`@`b@b@!Babc1TSA{¨_@lFA!@EF@ 7р c?T`@c`!_mTB_8xb@lFA! @%F`c@!@E{CS@WC _'T?@BT[@Tt* `a@VF?A TcSks$@5a@A6[{D:s*@7Ѡ`j`[CcDkEsF@EW@@Bҡ T{ASB_s@Sc@%RRFRҨ$!a=cDkEsF`@V־ET*@Ra@7!a@7рV@) `@T@76@D!@E@7Ѡ[CҦ[cks'mC@D! @jE@6A!8E5`@1@T``@D!@WE@ 6@?$VaT@?<hT @@@|?T@7 UX#@4p wR@7!с!@76@7Ѡ[CcDkEsFI@7@6[CcDkEsF3!?T`@'mh @7`` /S)@? T!T@ 7(!`T!`g `HT)iA` %R@7!a@7р  'Gm. `@7` Ҡ@7Ѡ@[CKH[C?DAV=[C@7Ѡ`(!`T!`g `HT)iA`[C'Gm@`C"`*(h bT!8j!(h))a@7р@HA`C@C" g@A4C@ @7р`@7Ѡ`[C'Gm9j(a))` [C'Gm@Ja^J)h`7р  {@  @8a @!a @{¨_ E@6i 4Di`@a @7!a hD@!i4/i {  @ a@ @{¨!@  {?"BFS$BT @T@`6c !7`R.'a@@!1@TaRSA{¨_ D!`@C!c !`7`R '@ҟ@!{#@dT@D6 @_T" @ @@!1@T{_@!1`T__ E!!@C$F? T Dc @!@Nf{S5RS ,!R!K`!|@4 avs^ADSA@{è_{S**[**c #R T)L )SA[BcC#@{Ũ_@`@__ {[!@c*$@!8Ss;@ @= h7@? q#T4@`<?1"Tk9? 1$T: ?1!T71Ta@O?1@T`@aR"=R=`"@N` N<N<NO31 T`"@"R`aRF31T`C$FJ1T#R1 T`"@*`A R.31T`"@*`M1@T**RŨ1Ta@!`"@R`!R31T@@@@?T @e"@R`a R8@Q821T1@T`"@BR`aR21 T`C$FI1 T#R+1@T`"@R`!R21 T`"@*` R21 T`"@*`,M1@ T`"@*`! R21 T`"@R`aR21 T`"@R`!R21T`"@BR`aR21T`C$FdI1T#R1T*1@T`"@*`LkD1ZSA[BcCsE{Ǩ_R@6?MTa@21 T~@@"@@_qAT" A9B2" 9*1TkDO>1TkDkD`ЃNc=SA N[BcC=sE F{ǨSkD@{SU !@!yy|SA{¨_{R!!E@S$@'A_kT`b@5R#7%5[uB)k Ta@'m`b@!u(@A5 ab@5`@a@` @ A`@ Y !R#m*#@Rj&`@[BQ'Cm` E'@@BҡTSA{Ũ_['m2ab@u5RM`b@u5RM `b@u 5aRM@ `b@u@5aRM`Ɲ`@a@@ A`@ D!@{A#`@!R[BQ'Cmab` D! @iA#`aRME`"BE@ hq`!@ #@`@a@ж @ A`@TɠaR#mp D!@-A#daRmM "BE@ Ơhq!@u#M`@[BQ'CmM6`@!R[BQab`@#@Q`EҊAR`@Q  {S`[**c**# o\)RcCT )[B#@ SA{Ũ_ D! @@[BcC#@ D!@@@qaT@` R_{ q{_  {S*c**@[k@c@*k***R*+@@*w 4q T_qT4c@!!F***!*R48 5 RSA[BcCkD+@{ƨ_c@#:ZF****ABR4#Ac@****R4c@****A@BR`4c@A@****R5Rc@ )!!F*`@A9*! *`2`@9*Ry@5Rc@!!F***!*Rjq {SI)!H?k,Tb@_qTa@BRcC)eD)w4` @J@!Q RJSA{è_B4_q`T_ qTa@BRcC)eD)wJ@5!Q TD!!@?J@R!Q@a@dC)RfD))@Ssv 4@a @`@A93`@955a @\4{J@4@J@!Q@!Q$D))&E)!!FR!5J@@!Q {scA[ @k_T @`*= ``< RN N=F/1Z[BcCkDsE{Ǩ_֗{z`S<=N@ N<N<NqT@@F1T @ "@R`R/1`T"@"R`R/1@T@DRC1@T"@ZSA4 q Tq!T@@VF1@ T"@"RR_@@HF1 T"@R`Rw/1` T"@"R`Rn/1@T@*@$#@R1TM; 7"@R`a RV/ 7*`7`@7``!@"@?hqB`R8/1AT `@ 7`fSAX#cE{CS[d@7#` @" ? T c`@T @s T}ӒL T`}Ӎ@ T?T{!!Tˠz!!š@@?`ןcD|8!!E7@"@cT{ASB[C_c2cDu@{ @ FT@T@6#T D! @>S@c@҄ RFR%RiҽxT`}u D!` @Z>{Sc@k8@s @{AtB5:@[M Tb@u7р V}"c`vY?{ue 7?ф{5Bc_;F?@@{5[B R`:cCSAkDsE{Ȩ_]`btjTa{`" @A@!1Tbx [B@1TZ˓b`_Z}akza`k:JT`{u @ @1aT`zuaz5@7!!o _@peA @?r`TRA!#\{BRSa=_!=&@NN!@@ N<N<N1 T`C"BFז`T@9 7`"@R`a R- 7R+7@7р@`"@bR` R-1`T`"@bR`R-1ZSA_B{è_ր@7р@ $ЄGKT_%hc8he8h#8c {$#cES[cke@?3 @ T}  b`Tzs @{3z3s^`xs @1@T bx3z3skT@@?@X(!!E?@"@cTSA[BcCkD{Ȩ_֓)S !//@B@!ga 4`@7``3@ TT @"՚_#T~?T G! "@<Ҿ`@7``_ҵ D!!@<ҭҀ @@ {[@S(@@ @5@c@ TbB@7р sbb{szs{3E@TB @{3@@1! Txsx3s@bѣ7b@ @@@1@T@ @" @a6cC@1@T[BSA{Ĩ_cC R* bbҴ*Tz`"@" @A@!1Tbx A_!cC@  {S5`Aa!22lP@76la!2P7:la!2P7>l!"P7Bl!"P@7.l! #P7BB@7B &!@#P|SA{¨_ {  Eqa@!1@Ta @{¨_{S@@@`@>`@@@ ?ր@7рSA{¨_SA{¨p@!!ETV{4{N'R %aZ{_  # {S@@`@`@`@@ ?ր@7рSA{¨_SA{¨0{S#[c 5# @ @1@TvT@7!ѡ@7!сaa@7!a#@SA[BcC{Ũ_bcb"x`A@!1aTbx Abx #@FCA#@B`;#cE{d@?!&[@Scr TrC @S&sRO`` =H1T?@k5!`;q@r`%To @````r3Tբ[@@?r T?r F7;IT@9@9`kz8qT;@*WF*57@W@T%*yk 8`kz8q`T8@T@`76@`T@7Ѡ[@ @r Tr !!@kr Tr!_q@T:ZF7TC@@*5W@@ T@T@7`6K7@7р7@]SA[BcCkDsE!!E@"@cT{ר_"R*6kD7@SA[BcCsES[ckse*u`6@@7рkD@[@@7@@  TC@@;5W@;@ Tc7*!@ak'877@ 7@M@CK~K@*@qT*ak 8@7Ѡ 6KK@@T9@5R:dz SA[BcCkDsEqkk@)!@+ E@@BTSA[BcC{רT(@#@ 57@u`!$J4`@7`@ kDR?@;C/7;@`c$;7@@;!T@6!$;@4S@ @#+TW@ @1@T @7Ѡ;KH;@K@7 @@7 ;!;@ D!$@9;@@@7ѠkD cT E!%;@\;@@@6@iZ;W@;@ @7 @kD {S[@a @T@6"@_T5 @P4!C@1T#c Ec@`?*a@a6%[B*SA@{Ĩ_֠ FT D!@&@9!@! !a {S@U8@@  @@?a@7!aau@SA{è_ DB @!&@[SA{è<{S ` a@6@6SA@{è_`@7``Cр<!a6{*S a@6 FT@T@76RSA@{è_ E@]4]!a  D! (@t8@7р`iIT D"R!`'@ [@6  #cE{C!@S[?3ԟd@WbE@&RsЄ@` *Rv s@@T@6ck@ @; ;{F@` *7 TqRR F! Tҕ@ 4F?!T @T@_q1`A0l@1T| V vw wx9y9z9A! 7cDkEsF EW@@B! T{ASB[C_RRRҽҎv !TRRR D!+@7R@ T*7ATqq?q@zT D! )@7cDkEsF@1T@1Tcks`@7` Ҟ D! +@7z@* 7qqq$@zTZ4*4 D!)@k7@*7qRR5?!B-!<)҇OsFhe> D!*@I7cDkEsFX  A;{ E.@? h`@@`@ @!1T{_<\ F  {SJ@SA{¨SAR{¨_@zc #cE{CS3`[d@7 @?HT3`@#w@*7 aT F0@Ac!1aTs@@ @!1@T @9q#@BhRA*9!!E7@"@cҁT{ASB[C_V@CЄ@ RfRERҳ`A#a @ @1@T #@#8{"BE!!FS@@ҟT,B,a@7!aa  E@@BaTSA{Ĩ_֓@`@1@T`{S#[ ҡ@7!сa@7!aSA[B{è_`@7`` {Ս[ ES@5F@/f @1@T`܍ҡ\ `@ F?T@ \F?!T#R҃`a@7!aA E/@@BATSA[B@{ƨ_܍;J#BR{@1@T@7р`p G@Z`5Z@@  {  5`@1@T` @{¨_{S=/`A0l@1AT||4!Rpy97SA@{è_`@1 T`@1T {"BESA@( /`A,l3B.@7!с E@@BҡTSA{Ĩ_ D!`.@a5{S[.`At @ub4lҟTza!B@ATc.`Axb4lTzv@ T@!1@T{6`@1@T`[BSA{Ĩ_``@7`cCcCҫcC{S E[d@c#@g`~A9 5LT`@>`zA9d@99F4 B ~o@7!ѡaz4R(5`@bb@?@@B @_aT*/H7)5 `>@u> @BTbbRa`~A9`R5@7р`KR!!Eg@"@cATSA[BcC#@{ͨ_//@3Q/3@+@2+`N@aN FiA7o@!T@ 6C!/c 4/@"@@T@@ 6 @1 T+@ @1T@@7Ѡl+/@c+@a_%F#cE8!Q`b@!@/@W4@ D! /dzA9"c @q@BB!1V J`R@nb bb `x0  DaB @!`0@V@7Ѡ`gDa!/@4@@6  {cESb@ҟ T T@k @7!ѡ T`@qT `@` `.@ 4` @@ 7 `"@4`*@T `6@R@4`:a&@5`*\:`6@YT ` TT@!E@"@cҁTSA@{Ĩ_[a"@?TE@@cҀ T3` /# 5`@qTt>@ 4`"@4`*@@Ta"@T4E@@BҁTSA@{Ĩ DA! @|3ҴDa@@!4A! r3ҪsA! j3Ңҝ8j@!7!Z5@`7ѠҊ`6@:@6@ҁSA{Ĩ\ {S!E`@#@'T@6BfE'@@BҡTSA{Ũ_@#@`?C\@  {S@SA{¨ 3\[@@b@#@SA{¨`@hQSA{¨_bQ!@a_@BT@O7_{#@S[@`Tc# PAҔ@xssTRH@TSA[B{Ũ_c' C'@J`2  {c @S  @[*BFTFqcE!F8!.P7@9t @75T}Y4q Tkst@@SkS*r Tr`a;y @S{5*RB77@4VR@9B*kD 3[B9sESAcC{Ǩ_ARzqT*a(qHTT?T[BkDsEҗ5 `@ks7` @929@97qT*a4qT{@*S5`@7@87@*Ѻa*4qT(qT4q@T_T*$r`u7(q T4q TTqT2*a(q`T22  kDsE`@7` [B{ @1@T B@9 7ңDa!@3@1iPL[Baq @-T`@r TSq TqR!@Sr T@?q T?q TRc@*ra Ta@B|9`@7` @9x92*7@*a(qT2*CRy`@7`*=s@ 2R[BkDsERr¢R9Ryrac! @ O{ES[B@GҀ=_( T`@Rn5aR" 4 T`@!F T@!T@a6}@aT T` @qkT@'@c{@`@4#@`REG@@BT[BSA{ɨ_u@'@D!=@0!B`7!<`4 I@'@c@!B!1`4H`4c"@5{@@S8@c`[T`&@< @c6@`.@cc6* `&@,  `&@b2@@_T`>@v  `&@V` 7b @@t T !1NT[BSAcC{Ũ_A@A "b*@c @B@` ` !1Lb*@T@7Ѡ`[B[Bt@@TAkB 9FdPaT a@@t47Ѡ`@7@[BkDҼ@7Ѡ`[BҴ@7Ѡ` @7ұ[BҬ[B@7рҢ[B @7  @7р` @7Ѡ [BkD`&@BVO7a @@t 4 1N@T@7`v@@7@ @7 j[BkD]@7@7р@@7@` @7  [BkDEMJG[BkD:B?<8[BkD+30  {ЄES[*c@Oa @X@q @T?T`@1@T`EO@@BTSA[BcC{ʨ_ksw@!E@F_D@aT@1T  c4 @d @@kCC@ Ta9" @A@!1@TAbx9C48@!s1@T#CbB C?(F?@4K@ @1@T x99 G@ @1@T x9sE54BҟTa9! @"@A@!1@TAbx9xkDs#CC(@4G@@ @1@T 9#! kDsEo{BES[*A@/+#BC*j+@'@?T@6E/@@BT[BSA@{ƨ_ր@7рDa*!` @`Qр=39{@T@6B;E.?@@h``."@`@GT_1@T'@B1@T{G4'@B1@T{vRM{_ { )E=C=#='=+=/=3=7="R#@/'+ )`@!E/@"@caT{Ҩ_ {cESB[d@'_hT6@T@?3Ѐb TzuBRqTb!E'@"@cҡTSA[B{Ũ_֡!TDa!4@.@-`4 T @|-4C @u3``4c"P4@-T@h- 5R{S@T@6`@r`T`@1TSA{Ũ_`cRw @ @[rT@`@SrTs@*T#*qTj58#@aR`ILcCrr`ss[BcCOR`5*kj7Rj589cC#@ [B{ Rb@AT@6 @{¨__DaB @!5@$P`@7``{S_T@@ b@6?T@5FSA@{Ĩ_`C55Bb"@W{#@cT@6!@?T{!B-!@\E{_aD!6B@@B @O{BESC@!F!'@%a@7!aE@@BҡTSA{è_RE@@BҠTv|@SA@! @`{èg  {BESC@bB6(4`@T@a60@Ta@A!1@Ta@A6@R!E@"@cҁTSA{Ĩ_7@!8D!,@,@BDa @! 7@@@BOBE{FA@܍BcI!E@"@caT{è_{S_hTTBFSAAR@{è`7#Ҹ5SA@{è_֢@,]  { A@`>@!1@TAb>?`@1@T` @{¨_ {S*[5R"D@_$qTT4_ qT@*c4SA*[B{è__XqT@k"T2(T_@qT@kT"_Tq`T_(qT"RkT`~Sb@ !R! j`8@ E`x`?jT@aqTc~S"RB  xc_jTR @kT_qTRR@kT @kT*kT @kT  {S@@T@T`SA{¨_ {BESC@!F!6!FT '@)$@7!с`@T@61 `Ta@7!aa&E@@BTSA{è_֢@P!F!<@ ?T4Da!8@y+@7!AE@@BҠTSA{èD{`T{{_ { @ST@@6s sBs a@s"!`4SA@{èQ @SA@{èl%  Հ@ {[5@5STcsFb#`Tzsg@ {3s#@SA[BcC{Ũ_SA[B{Ũ! @BFU[B{ŨBF!F! 3M@7#@ҁ#@  {*S!`G{5DSA{¨_֠Qq(T qT@9`@9?kTEBR @7!FaTa @BR @1qTH`Ta@BR@SA{¨0{SSA{¨cSA{¨_  A{ 4ҷ a&@?T @{¨__`@@)@!T@7`Ea!8@x*  { *1T*kTHk!EF @{¨_r F{ @`@P`@!1T @{¨_ {cES @a@WcFTb*@BCc#3 ~cE+@@O@ЄЃ*5@EW@@cATSA{˨_ @1`T /@Y@@ {SE[ @@7@+bcTTC7cC+@!E7@"@caTSA[B{Ǩ_֗zs@T@`6sc#S+@cC#9Fc!6@7/@`+@#`MTdxb TB]!$73@@T@6 @ TCP 6@7`$+@@7!cC#@cC#@B Txb?aTR$Tsl#@@B1@T! "R7 @"7!#@s}R+@be`x`"@B1@T"b $RA s#@g  {*R@y@p7 {_<@!4 x` 5,@|F @TAB@aT@1@T_ AB@ {*"@y@p7 {_<@!4 x` {%@7S[ &@1aTFd@!Tҳ @1@Tv~SA[B@{Ĩ_@1`T@1T`@T@`6` @`@1@T` {*1 TqT4Gc8{`|@{_{1T*qHTBGEBa!F_@{_ִ!E EE{CS[@- T_`C TcX@AT|5@ ab YcDE@@BT{ASB[C_c+cD@@+77@`7!@7@7!!T T+@@@@@7!с!T?@@RfR%RҴ7'7@cD+@@v7@+@cDқ  {S@?@5` @?֠5`@?5`@?`5`@SA@{è_SA@{è {@S`? 5@`?ր5c ESA@{èc\@SA@{è_@_qATn_qATn {S@?5`@`@@`@`@-URSA@{è_?4?֠4?`4? 4{S@?5`@?`5`@SA@{è_SA@{è  {S_TT,@ TSA@{è@@#Ҕ5SA@{è_M@@{S @`@?֠5`@ `@ SA@{è_? 4SA@{è?4{C;E.?Ssh`` @0@!EAIFSA{Ĩ_ր! 2@@aT@69`@"AvbB@*7!с@6!DbB9!@&!DbB9!@&!Dc @b!@B:һ@Ҹ; {S_TT(@ TSA@{è2#5SA@{è_֝@@E{CS[@W `.@#=@A`=(@a*ca @AL T@= 4K@aBF`!b@;j 7@@6 a @@O6a Aa==a*@(*```=PJ@1! T"@]6^6@EW@@BT{ASB[C_!`.!@#u@#@U!A =c!(@a*a `=@RR&R .@@@7р҄VB?*1 TW]*6]6@.@tL]*]@RR&RҿҞ @!1@T_{[4@S ckν#]6@мyN]3 aN@9?q T@sy{J@9@z@@OJ@"@B`1 T` `B6 o DTF"4_8?qTR9@&@@T@@ 7` `` @:@?1aT`@`{9cCsEzkDSA[B{ƨ_`T`R@9q BT@5cCkD|}@sE`B&@@T@7@!1@T`` F` V4B?sE9` A`.@  {S@U@ ?ր@7рSA{¨_SA{¨  ՁU{S_TT`@qmT`@5@SA{Ĩ΃@`&#<5DA!%@$SA@{Ĩ_D!! @$@6@\@7Bт?TM@  CE{CS@'D _`@,T"RRK*1T?qE!F!E'@"@cҡT{ASBC_F@RRRk`@Є@RRR[@*6@u@@ {c<S$@94(q_q@zAT(qT@qTqSA{Ĩ_?+?@`?bx!@!0@j 2?@@T`@7` @7р t"#@ qG@I4%IR#@??@??@ {SE@@'a @F` TFiA#n^@@!T@A6A!;4@ @1T`@@7`\@@C<@9b#P!E'@"@cҁTSA{Ũ_@DA!@3@#@ `@7`@@DA!/@#`@`6-p@$@{S@t@`@}`@{`@yҬ ?ր@7рSA{¨_SA{¨  {@!T@6{¨2AR SASA{¨_S#a@7!aABE{C@C77 @!E@"@caT{¨_»@!T@A6@?<T@!@ |_{ᤀR A{_#`!C"!R!KxbBуx_T |@|_  {BES@@/5C*#R@7E/@@BҁT@*SA{ƨ_D@|q #tG@ <`R`@5Dm 4@a^!a^b(a`  4@`  {S4@45ZaJ@?1ATKSA{¨ZSA{¨_"{F[{{1Ta*1`T{`|@**V*{_  {F{_ {BESA@GR5'@t @KT!Q@7` @`@@'@`@1@T`EG@@BT@SA{ɨ_c@@!Dc @@B @D!!{_q@@?! !t_q@?!)!m_q@?!6!f_q@!`>!!__q@Ё >! !X_q@a@>!!Q_q@Ё=!1!J_q@A!!C_q@A>!>!<_q@=!!5_q@>!$!._q@a ?! .!'_q@Ё?!`#! _q@?! !_q@>! 3!DA!@@@7р@33@A9 Q?qAz)TDA!`@@63@DA!@@@63@C|@?Td6@xa!@!T@A76 @T_qTTDA!@lkEkEDA! @^kED!!@UkEDA!@LkEabDA!@@kEbAB-! @f6@@RFR%R@Җu@UD!!@@"D!!@kE CR  {S[*!R 4a@*SA[B{èSA[B{è_{S@T`Aa _`Tq#T~@|}ӌ``a@t@ tRSA{è_u@@ {S*A`= kDsEk@acC@a_!E@"@TSA[BcC{Ҩ_ksu@9 |uh68Z T* 83 T`mi3@9ZT3kT U93@ @:@7!a1_!TkDsEҋkDsET3N! ښ?TAsҗ3@˿ T%3@@T7@!TCz3@7@@B!< D@B!1 { :_T ښKTAsRZ?LTa@999JTkv89a@99 @o@?@G@g@T  @o@?@G@g@T_TT@T33@˿Tҵ3`TZ3@@9*˿M T*` xmhkDsE@9*! ښ?TAs@_ T*3͡3@  Tu3Z<3@7L cB@5yG!!,@kDsEokDsEh#3Tkv883@77@33@Z_Z WkDsE?kDsE93@_ZTZޝ{Sc`AhT @[8qaT"A)4*Tq TQu@ 7 7"R` @qT@xr T3/ NSs RT[B3@SAcC{Ȩ_B)asr*%H  T T˟ TRx`k TaTk 3/[ZbT:@ya&@x?kTT5ҟxu`@y !kT` Ts (T[BkDsE3@ҕ [B[BR`T3/#T[B3@[Bҩ@Rk<kT3/WuӟbT`@yk@Ts hT[BkDsEsEna@yE*R5s [BsE 7s N` 5R*s N`as R4[B#kDsE3@Z [BkDsE3@RTTGNjek { KS[@cks @ITuV@9 9Cc9c^`@~)@?8q`T.@`TF@; {`ր@,qT!!0!X`x`! `@f@@TT_x*|q@z뢛T@y* |q@zJ4.@ T@`C"xaT@y@?kTc^@@.@cc^_ TvSA[BcCkDsE{Ǩ_`@@4`@4@?LT @2w `dV@@h:T@z`q@TcK`N@ &@z T@Z`?@qFT@@? T`Z@wTdV@(@@cc^ R)`@ @ m*@q4`@@4`@Tc^@cIb7c^@c@QRzdV@Q<q(T"B01BX`x`"@ִA`b@@ @ Ѡ@`NѠ@4*?(T@ =A`b@@7`R@Ba"B|} @2w"`N TdV@Tc^@`b@ VA`b@@7` `^<K@ @abKc^@EA`b@@7`R@Ba"B|}ś @`N@ @`5cK @Ҡ7` `^'@@"6 @ Ѡ@`N@Ѡ@+TC!T Ѡ`R@Ba"B|}c^@@@!\c^@c c^@ b@A!\c^@c c^|@ 6 @@`N@aZ@@w@! @`b? TdV@c*@c^bR`@4 $):A@7 ` `^@@ @`@_@!$A:T`T`N@aK& "7~}h TdV@aR@AaK`@cc^!˴?TaV@cc^!@P@24 :c6 @{`N@  .@TF@; `Cxa`J{c;{}!c^@cc^`R@7a7~}`^@`^!a|@\7dV@c^@_TO4<pa|@|7`@c^@ a|@|7dV@c^@_T@ @@aMA`H@A`b@ab`@ 6 @@{`N@ @@_@ A:T @T`Z@") TdV@@@h#aK@`@c c^@!˴?i TdV@@c*@R@c^$)24 :@y @kT`Z@wITdV@@c*@Rc^$) `@@" : Ҟ`|@7dV@c^@_T`R@a7~}nc^@cc^҈`|@<7dV@c^@`|@7dV@`@c^@Aw@@@?T`KTcaV@2L@!c^`@4 :o@@`b@TaV`@w@~t .@Tak|; `Cxay4*z` @m`b@@aK@Bw$_TUTdV@@c*@Rc^@ (`@24 ",:,w`b@<h`N@ @`b& _q@aT!˴?iTdV@`@c*@Rc^4 $): [{}TdV@aR@əaKcc^_|@7dV@c^@_T_|@<7dV@c^@_T`@b@뀣T:T_x?q:TG?|qa@z9T@y_qH9T!G_|q!b! @zJ@4 멟T@y(q@T .@ TF@`CxaT .@TF@`Cxa@4}@a@xS?k͛TaR@#b `C@T4GITT@y?qHTa8@y_qHTb8_kT @a@xS?k͗TaR@'b&`GĘ@TTBT@yO*@yLkaT .@T@`C"xaօ 46IT@y@5 .@'T@`C"xaִA`b@9@@7` `^ұ aKbb@ !w`b? TdV@@c*@Rc^m@!A*?@ kTw@5@z`q@T`N@`b@ &@z Tc^@ @1T@?@ 댞T`Z@w TdV@@c*@@Rc^BUZc^@:^|@܇7dV@c^@_@T2`dV@@̐Th:*@4`@5`@4` @Tc^@;w`K{}CTdV@aR@c^@cc^^|@\7dV@c^@_T`@TҢ^|@|7dV@c^@_@T`@a@|T$T_xqH$T3@?ӟq3@hbx@z#T@yc?q"Tsc@@?|q"<hbx@zkx4IxT@y_@?kwT .@`7T@`C"xaa@Ҁ@TaK` gTcaV@"@@ .@fTF@`Cxa .@ T@`C"xa|@o4 a7`R@"a"B|}c^@cm4<nT@y@c`n4 .@@T@`C"xa^|@m7dV@c^@_`uTD4A4ajT@y@?kjT .@T@`C"xaOR3RJ=%@4RJ)`4<@`KwTcaV@T@x@dT @2we@`V@h:?bT@ z`q!T.@%T`CF@xaҵ]|@a7c^@@a@xS?k_TbR@Aa\`?A@^T T^T@y7*@ycc@7@_k\T @6@R ``@kTbR@W!.@`T@`C"xax]|@T3Z@?ӟq3@hbx@z=T@yc?q(=TKc@@?|q"<hbx@zJ34@y?(qT2T@y?`24@ .@`TF@`Cxa0T@yqT!4G `8@?k/T .@@T@`C"xaY4 V4b-T@y*,4@ .@TF@`Cxa +T@y`*4@ .@'TF@`Cxa.4`@f@ (THTR#TRk'4(&T@y@?k&T .@T@`C"xa_x*|q@z@4@y*|q@zi"T@yqT!4G `8@?k@!T .@ )T@`C"xa`@T_x(qATT@y@`4 .@@-T@`C"xa`@ 4` @롙TE`N@`b@ &@zK5T`K{}'TdV@aR@_`^@`^`@b@TT_x?qhTG?|qa@zT@y_q(TG_|qb@z?k4Y[|@\7dV@c^@_`TRR`@`T@y(qT@@qT4qT`Kw TdV@`@c*@bRc^9T@y?qTB4GAa8"4@ .@ TF@`CxaQ4[|@ 7c^@@aK@Bw$_T TdV@c@*@"Rc^@_@%뤨A:,T@+T`N@& 7{}h TdV@aR@ŔaKcc^!?) TdV@@@h#aK@`@c c^@!˴?TdV@@c*@BR@c^$)24 : 4 4T@y @?kTҲZ|@|7dV@c^@_`TT@y25ҠZ|@<7dV@c^@_@T`ҕZ|@7dV@c^@_ TҊZ|@|7`@dV@_@Tc^@~Z|@7dV@c^@_TY4]RRJ 4UA`@~t .@@Tak| `Cxa`@T*@ r4`@q4` @TNZ|@7c^@41DZ|@7dV@c^@_`Thz c^@h:6l4 @!|F_T@!1@T_@u ѤЄE{S[@oRR #B-A ҅A;ՠE.@?!h`!@!C !EoA"@cT{@SA[B@ _ֱ`! ?@W8@^@7Ѡ@@7р`@7`#Y1TCB- 6 -@@7Ѡ{ҳ@7Ѡ@@7р mҥifc`Ҙ {S@ `7 ?ր@7рSA{¨_SA{¨E{Sx`6@`B'SA{¨{B.!'3@4F@!40 3C ѢBE{cA@Gc( T#@S3R[?7 7@d ґa@A6 T(TT48u}SA[B#@!EGA"@cҡT{@cCC _S[#ϔ^D!<@@_SA[B#@4 7@!aSA[B#@/;/@  {@@(S?rT?rTqT@98q!EF {_g-T*85EF@ q`T@@y  # Rc QH @ { !Eb@#@AT@a6@!T@6@!@?Ta @!@?TH7@/@!E@"@cҁT @{Ĩ_>D! @F 3D  {!.S" 7!.B 7!.b` 7! / 7!`/ 7!/" 7a!<`7!/7$ 0Ҏ``@ @1@T !@-B@6@7 sBsbb sB֝`7a@AdZSA{¨_@@7!Aι{S@[*6@?<T cq7CD@zA T-T RKB@ TecbB$՚ssR*Tzc! "Etez#B^c"/SA[BcC{Ĩ@ RSA|(՚[B{Ĩ}ӆb!RTxcc*SA[BcC{Ĩ_SA@@[BcC{ĨBSsRq!$!B@!SA[BcC{Ĩ @@¿ { @S!XE[4` @SA{¨@!F~!@T@_a@T@ 6b @@1B@i5@7!сSA{¨_֠D!`0@# ա!E{Fk"@C" !E@"@caT{¨_  @ @! @{S@oH@A@ ?ր@7рSA{¨_SA{¨$ {S @AT`&@@&7!AԸ`.@@.7!`:@@:7!A`>@@>7!`B@@B7!`F@@F7!ASAR{¨_@ sN R`1R7{  @{¨_#@s@b7"{D&@[!EA@T5`5L@SS7a@*!6qTT@7ѠSAE @7Ѡ`K SAF[B{è_[B{è@7ѠSA!a1.+SA@?mT @@  _T@A@CF_{B`SU49SA{¨!F!SA{¨_  { @"@7@ R{_   @#{`@@_Ta@ S?rT?rea!B{s`@ 7`{_ȷ_a@  դE{@C `TR?aT!E@"@caT{¨_֠ @ {ESB@7_T[@ T3@ E?aTccCk` 4+@ @T@6 @T @Sr`Tr !!_qa T @9*9 /@g*a@ 66cCkD@7р [B.** +3@**/+@F*+@@7!A9/@@7!A273@ @B3 Tw[BcCkDE7@@BҡTSA{Ǩ_[ck!a96_q` T @D! 4@xD! 5@qcCkD6/@6!@D!6@`cCkD@@T@`6 Tc @@T@63@T@6 @ @!T@k@YS:S_rAT@?rT@ҙ1c"҈5җ @yRСB-!<1T[B3ˣcB-!11B[BcCwcCED!2@cC8D! 3@cC0_r?rsS@Sr!T@ҵF3 @mT**@+n*+@@7!73@B+@@7!aWcCkDrsN6{S_HTT@SAR@{è6# 5SA@{è_֢BF  ռ4@BF@?$B@T_@{@S`?5@`? 5@@SA{èSA@{è_  {!E@#@_qT@5@ҡ!FA C1!E@"@caT{¨_ՏD!%@HD! @@{!E@#@_qT@ҡ!FA C1!E@"@caT{¨_֧@D@4! ! @`7|@mD{@!{_{DcES[@a@ *hTT@?s*1T*aC`4D@PE@@BT[BSA{Ĩ_X@g@yc@y@8>@(`>@$`7#5`@7` ; ѣcE{CS[ @+d@?#`b?(Tct@!TsFa a a !`7@ t @?a TaT@ db`mT`@T@7xa@B1AT`x!!`@񔢟7`TcDE?@@BT{ASB[C+@_cɎz@Aha@!1@T!c x4C F`@xa @7  cD`@7` ҢcD+TTD@@!9`@@6S@$@҄RFR%RҞD@@!:`@6@T@`7D@!7@`@6bcDw@?D@@!8q`@6 {[@Sq$A T@z`TF@@APg!1aT@J@SA[B{Ĩ_ւ@!4F_T@1@TAP' ӚTw~`T@A@6 TAb}6 ҃)Tjad@eD7ej!! }@@SA[B{ĨM@V ѤE{CS@7# b ?@BT@@T@@6_TFT`@T@!6R!E7@"@cT{ASB@_ְcD @!`@8!ѡ''@)sFu@Uc$@RRFRc$@RRFR@@Fs{s@S[cS @! 7@!@k:SdkaW+bTrHTr?rGT?r9k;Tq TrOT@r@OTw{/``Ӏ?T5@9Q@HssT[?kT!E.@T@x7 D7k!CTkDSA[BcCsE{Ǩ_{s Tjs8kaT!`gA.l>T@x7s4 q\Tq3TkD q`Tq!TrT@/``Ӏsk9E`mTztq4tm{A{{rAT@/``Ӏsk9E` T ztxp4tMrSr`Ta5@/``Ӏsk9E`MTTkt8p@4t+5@/``Ӏsk9E`Tkt8Ѩp4trztxp4џaT M`6@7 hkDBTkt8p4џaTt@.T@x5@5`@ 7`G`@7`@?Tzt[p4џaTV zxNp5aTT xV`.,T@x51@!T@1@T@M5@7р@zxx"p 5aTT@@Tv. T. 4@7р v4kt8p4џaTj/hkw8o5aT@T@.LT@x54@Mkw8o5aTT.lT@x5@!T@x5@7р @T{@5@`7р5@7р {**FT qBTX 4 q)Tq T?/``ӀATt gER#T7@#aˀ U .<T@x57@W eDRT7@aˀ . T@x57@i85`@@7`!@@7Y7@5 @@7 kD @7 `@7`u@E?TD`@x5 67.MT/5`@7``ҰW,/``ӀTٛ gERTa7aˀ@.T@x57@!@9k`w7Tjw8k@k`TATs U@E? T@E_ T?KT!{ u "5a@ !7`l!ˀ`. T@x5ѵs@E_T@1@T@7$ ] @1@T@kD{ך{{S@E?T@1@T@5Ek5a@ !7`#w/``Ӏ T*`gER- T7 aˀ`.T@x57@;5`@7``@7``ѵsTzwk@_kT!ˀ 0T.-T`4`@7`ͯ!@ykٚ@wTzwxk@kTATs@E?`T.(@E_ T?kT!!ˀ.T@x5ѵs 5a@ 7`|{5`@@7`pD!@8@@4`@7`\Y@ !@kfwWS@F@E_T?T!S8S 2TIa@ a7` )@x5;`@!T@6@?mT @@  _T@A@CR_{>R` {_{cES[b@'HTLT`@@qT`@`5ab@`@!<@?T`V@`@7`@ 4 7d@ҕFA#*`@bb@@B @_AT"R@7BтbĮ@7`2@`N@!E'@"@cҡTSA[B{Ũ_֠`>@> B`N@@N7! @@7Ѡ`Ҝ` @ @T7@@7р`z@TƺqTT@7@ҀF#@4@ 7ѠP@cF8W {Z@҆@Җ`b@!@/@{D!%@sD! @k@$5e# 5\Ҽ4*@7!ѡaqT@TD!@kE!F#>5  {S<@SA{¨l@?cB@ˁAT T@B1@TccBSA{¨_ATbcB@  { @`@@7!A`@@7!a` @@ 7!!`@@7!`@ @R{¨_@A7!{ Z @{¨;  ռ?qT$A@!1@T_?qTx@@!1@TA@!1T {S@SA{¨SAR{¨_{S @?5`@?`5`9 qT`"`5`@SA@{è_SA@{è  {S@[ @ @?5@? 5B@R"_k Ts?5B@s@RSA[B{Ĩ_?4@?@4 {@S`?5 @`? 5@@SA{èSA@{è_!R\ {S \!FQ!@!T@a6@!T @cxaATSA{¨ ՂBF!F_>^@!1AT__{S@BFBTS J7@SA{è_ Ҧ`,E@`@7``@7`@t@o {S[cc@4!`6*@7cуC7߽[BSAcC{Ĩ_= {S@@@6! E!@ ?ր@7р SA{¨_!!SA{¨{CRE@@c !E@"@caT{Ĩ_  {*ХE@S_q TS#R@[Oc#ksscS9< =R @7;?cE{!FW[჏<sq TQ@`T5O?ATS9@&7@4O?"TFR@S@?@@@n4w@_T?@ GG@"@7B"bSCGOFG@O@qTqT@5@ 5CJa@@?AT@?`5)C@' 4SA[BcCkDsE!E@"@caT{ި_S[cksKF?TE?Ta7`R@5a5˵~}xy`^@`^@ @v`N@9  ?/@ TF@ @"xa@#"TA`b@U@@7` `^5tB@@"6@ @`N@ @4@@q@ T4q T`KvT TdV@`@B+@caRc^ )`R@Ba"B|}-yh{c^@h; @1TA@?@ T`Z@vTTdV@@cE+@@Rc^) `@@  cK"3#?3@|@7dV@c^@`TT @@?kTT@2 5 ?|@7dV@c^@`TAAu @9~4?/@ T!hu @"xa@#"TA`b@B@@6@ @@@`N@A@@?+T`Z@vTTdV@c@E+@ Rc^TA`b@B@@"6@ @@@`N@@@@kTCT@`R@Ba"B|}xc^@`R@Ba"B|}xc^@3>3@|@57dV@c^@ T@B @kT`Z@vTTdV@c@E+@Rc^X@48҅>|@7`@c^@`@@ 7` `^t3s>3@|@7dV@c^@`TAA @9v@~4?/@!T33@4 Y>|@7dV@c^@T@@ @abc^@HB@A@\@c^@c c^U@ @@a9A@TA`b@ab`U@6@ @B@v`NA@ @@_@ A:T @`T`Z@" TdV@@@@h#aKB@`@c c^@!T? TdV@F@cE+@R@c^)2 A@55`R@a5˵~}wc^@cc^@@A@`bTaA@TA\ c^@c c^U@6@ @@@`NB@aZ@@v@@! @`bT?)TdV@E+@cc^aR`@ )=|@՘7dV@c^@3=3@|@u7dV@`@c^@`7 ` `^@@@`Jc5˵~}!~wc^@cc^3=3@|@57dV@c^@T@a@xS?kmTaR@'b&`GĘ@`T TT@i*@fkFT@a@xS?kLT@9 ?/@TF@@"xa@+@14`@ }4`@|Tc^@TU=|@7c^@9?/@T@@""xa}F4eR@9!/b`_B@T@ 4F@@"xafF49?/@`T@@""xa4 @@"2xaQF4LF`4GF 4`KvTITcdV@T@Yv_ <|@7c^@`b@@@@aK@BvB$_JTTITdV@B@c@+@RT@c^(`@2 ,`b@@@aK@BvB$_?TTiwTdV@B@c@+@!RT@c^(`@2 ,s5`N@ @`b&@ _q@T!T?TdV@c`@B+@Rc^BU~}TdV@aR@qvaKcc^ҋ<|@q7dV@c^@T< c7dV@c^@T"sT@qTa!4G `8@?krT9?/@+T@@""xa`N@`b@@ &@z˝T`K~}[TdV@aR@1v`^@`^@,qmTZ`xa ȉ@aKbb@ !v`bT?iTdV@c@E+@Rc^@!B*?@ Tv@5_@z`qT`N@`b@@ &@zJ Tc^@@?,T @2v3adV@ @h;T3@c^@@z`q@ TcK`N@@ &@z T@Z`?@qTz`@ @)23`]dV@@3@T h;@+@4`@ 5`@4` @Tc^@%v`K~}TdV@aR@uc^@cc^z`@T;`J7dV@c^@T`@T@+@`4`@ 4` @T`Z@~}#TaR@}uc^@cc^;F7dV@c^@ T6c^@҈3;3@|@UQ7dV@c^@TKST@i*rFR4@9 ?/@ TF@@"xaBQT@?qTbB4GAa8ZFO4@9 ?/@`TF@@"xaր@9 ?/@ TF@@"xaMT@ F L4@9 ?/@TF@@"xaJT@@|FI59?/@ T@@""xaWF4RF`4MF4HF4ET@@F?kDT9?/@ T@@""xa0F4+F4&F4AT@F@4@9 ?/@'TF@@"xa"?T9?/@TF@@"xaF4y@_@%뤨A:aT@T`N@&@ 7~})TdV@aR@taKcc^!?)FTdV@@@@h#aKB@`@c c^@!T?ETdV@F@cE+@AR@6@R ``@k2TbR@9V!?/@3T@@""xa`@@449?/@T@"`x``@T@(q2TB2T@\@F?ka1T9?/@@8T@@""xaր@ /T @2v+@ F?`V@h;-T@ z`q@ T9?/@@!T@"F@xa+T@@?k +T9?/@@=T@@""xa`@b@`)TT_?q,T`G%@?|qxe@zT@?q,T`G"@?|qxb@zJ5.%T@(q %T9?/@5TF@@"xa`@?%TA#Tx`@b@"T2T_?ql2T`G%@?|qxe@zb1T@_q 1T`GE@_|qxe@z?k5T@@F49?/@@T@@""xabT@qTa!4G `8@?kAT9?/@T@@""xaF45F4SF@4NT@@?F49?/@ T@@""xaRoF45F40}97dV@c^@`T!`@ 4` @롳T45ph9 6|@jT@@?k!T9?/@T@@""xaF4`@e@ T TRcTR7`@T@+@4`@`4` @TgoF4`@a@` TT_qHT;s@~qFXux;@@zT@s?qhT ss@@?|qFXax@zk5/`@`T+393@|@7dV@c^@T;|}bR@k@T_h% (F4a__*/|q@zF`@ T_(qT]383@|@U7dV@c^@}T@?(qaTL`@a@ T T_qT;r@~qFXux;@@zT@s?qhTrs@@?|qFXax@zRF4OdV@c^@T`@f@TTRTRk5RiRw_*|q@zF{8|@7dV@c^@ T3o83@|@57`@dV@@Tc^@@*|q@zFNRuRF@4@*|q@zFF4{@S#@ @[cQ@ _DDqTbTRTu@`T@4Hc8c` T`@(q`Ts6 Ta@ 5`BSA[B{Ĩ_sB&@T`@kTs&@T`@kATs6@Ta@*75s @BTa@?kTs @"Ta@?kTs"@a!4GT`@qHT `8_kTs"@a!4GT`@qHT `8_kATs6@Ta@*4s @@!@ DTAa!E{`FV"@C" a!E@"@caT{¨_Ns { =TA @`F!A {_ {"@SBT@6p1T 5SA{¨2B-!@SA{¨_b @ @SA{¨{@[c7S@?rT?rTRS*TLs*T5*!T@5x5*=qSAq`Ea!F[BcC{Ĩ_SA`E@`EqT qT@ qa!EbBF @9@y{@"@7@ R{_Ř  {7C@y{G_ {I;jJES` E.`?#=$@'=+=/=3=7=;=?=B@?5i`@T@c7$R)@`a@7!aa~`E?@@BAT@SA{Ө_dr{Sct [opRsS8314 @ҕ[BSAcC{Ĩ_P@ a7SAcC{Ĩ1,`G!@@@`LD!@6`@ccDT@ @$@@T{sq{_R__   {S@t@`@@ ?ր@7рSA{¨_SA{¨{S@@@!6`@?`@=`@;`@9v'a@!@ ?ր@7р SA{¨_!SA{¨  {S@@@A6`@`@`@`@ a@!@ ?ր@ 6SA{¨_!рSA{¨  {  @`@@`@@7!A`@ ' @R{¨_@a7!q@7!i@7!Aa{S@?`5`@?5`@ `@@SA@{è?4SA@{è_ {B;`E.`?{@h`#  C;{`E.?`h`@A{`D!)@{_A_{ CqTT!`C@7 @{¨_R`LD!*@  `C?_A;{`E.@? h`@A`{_`!`+% {S[7Ŧ*R7SA[B{è_'}{C;`E.?`h`{ҦC@cT@6{ a!DB,!@&{_  C;{`E.@?`h`{@AG {S[Kw2G }@T@J@4`&@a!F![BSA@{Ĩ@SA[B{Ĩ__{bBES@@/ Rm5C*#R\i7`E/@@BT@*SA{ƨ_ր#XG4`&`Ep4`D@T1%pDm4@a^!a^b(a` {Sca^A[`|D@?`FXp@?*?65` @#@|@!6?-T#@SA[BcC{Ũ_ր@7р`@7р#@#@!ѡޕ#|@{S5a@*7!aa•@*SA{è_  {D@6R{_a!lE$@BR  C{CS[cks?` @ T@#rAT|3:@ a7 T@@ @48@@1@T@@*7!сAwF@1@T` za!FT @T@6`@1@T`?@*Ҫ@7!с@7!сAa@7!a{ASB[CcDkEsFC_c @ac T"x`B@DT@D7`DB @!:@(`cCT<[@ :R@ZG@-TC@G!xwT@T@7!kxrT`@T@ 6g @ɔ2@˜6vt@`7рҰ2@`@`; Ep@   A;{`E.@? h`@a{_`lFa! @{@@@ԙ @1@T {_  { @8@6 @{¨_BB^@!T@6{ƖStF'qTҁ 'qןSA{¨_R_R @a{ @@`@ @1@T {_ @1@T _(@a5 @*_  @"@AK  bBE{@@bD@7cD@/*Cdc@ #*`E@@cҁT*{Ĩ_m  {S*bA_Ta@?k-T`@kT` @SA{¨_qlTw{S @b@d@ `c@@9dB|S_|qZ` @9S `!a?bT9@6SA{¨_  @9!C?,q`T?(qT?0q T!4Q!?q(T@9R"07@|S7_R_ R_@R_K_@8c$ B*  hE{C[uFcsg@@Wo@ TS@T@cUaGTkvC@1@T@1@Ta!F!@1@Tq?T[@>K#c ={`b?dU@T?@R1@Tq@:T"=kO`F͕R_!MG@7!%GD@T@C6; @;@??T@;@xa @T@H6 @!HT @1@T :A#@O%BB@AT@D6!RaGT R1T2*1 TO@@ T@q@$@z@zTK@DTA!؋5A!`;Ӌ` 4@1aT|F?@c@@7[@SBkE@E@@BT{A[CcDsF_Skl[@ @7 ;@;+@ @7  ! ?5  T?@BBF7!@?v4@#R*0qT5g@@_@@1 4_@Rd`Jc@FFA@7!Aa@7!aA@7x@7`6X2!@?!4_@R @@T@@6G@7!aa!=`5!!`<5@lF!@@!,@k@@La!= 5@DB @!`?@ @7р@el@B j_@ a{`g@@aM  "RW@T7sT7"RS`75iT7"RS 7 _T7@7o@ d'CcE@!c@m@D!@O`@lF!@wW@@CR7+x5uS{1S@Tҋ??c9@[?[cyW@t T@TW@@SrTW@@_ TY*Fq TW@@1`TW@ W@@D!;@SBd@kEW@r< _@JR@@@T@6G@7!@1@TY9F@D!@<@nbk@@[@DB @!@>@ @@@7@ @DB @!=@ @7 Ӑ@D;@!<@/GSz1G@S@TF B *qaTB*qTW@wv{S =TWF[*ķ@@A!F_Ta@@T"t`@X`7d@7ddR5[B@SA{Ĩ__@[BSA{ĨBBFmf`@7`[B@m@`4S[B@֣{CcESa@5`A`@F[``@7`@A!E@"@cҁTSA{è_j: 5@Fp`@LD@5{kq{_ {S4ff{`A!= 640 or 0 for unlimited.-X int_max_str_digits: invalid limit; must be >= 640 or 0 for unlimited.strictPYTHONHASHSEED must be "random" or an integer in range [0; 4294967295]--check-hash-based-pycs must be one of 'default', 'always', or 'never' /lib/pythonX.XPython %s cannot decode PYTHONWARNINGSPYTHONWARNINGSPYTHONDEBUGPYTHONVERBOSEPYTHONOPTIMIZEPYTHONINSPECTPYTHONDONTWRITEBYTECODEPYTHONNOUSERSITEPYTHONUNBUFFEREDPYTHONDUMPREFSPYTHONMALLOCSTATScannot decode PYTHONDUMPREFSFILEPYTHONDUMPREFSFILEcannot decode PYTHONPATHPYTHONPATHcannot decode PYTHONPLATLIBDIRPYTHONPLATLIBDIRPYTHONHASHSEEDrandomPYTHONSAFEPATHPYTHONFAULTHANDLERPYTHONPROFILEIMPORTTIMEPYTHONNODEBUGRANGESPYTHONTRACEMALLOCPYTHONPERFSUPPORTPYTHONINTMAXSTRDIGITScannot decode PYTHONPYCACHEPREFIXPYTHONPYCACHEPREFIXcannot decode _Py_StandardStreamEncodingcannot decode _Py_StandardStreamErrorsPYTHONIOENCODINGcannot decode PYTHONIOENCODING environment variablesem_clockwaitsem_trywaitsem_waittimestamp too large to convert to C _PyTime_tsem_postPyWideStringList_Insert index must be >= 0error getting getpath resultscannot calculate path configuration without GILerror reading frozen getpath.pyerror evaluating initial valueserror evaluating pathconfigposixos_nameWITH_NEXT_FRAMEWORK/usr/localPREFIXEXEC_PREFIXVPATHlibPLATLIBDIRPYDEBUGEXTVERSION_MAJORVERSION_MINORPYWINVEREXE_SUFFIXENV_PATHENV_PYTHONHOMEENV_PYTHONEXECUTABLEENV___PYVENV_LAUNCHER__real_executablelibraryexecutable_dirpy_setpathwinregreading getpath resultsbad value for option -X frozen_modules (expected "on" or "off")[GCC 12.2.0]%.80s (%.80s) %.80s00:04:54Oct 2 2024main%s%s%s, %.20s, %.9snegative argument not allowed/dev/urandom (or equivalent) not foundFailed to read %zi bytes from /dev/urandom/dev/urandomCan't initialize threads for interpretercpython.PyInterpreterState_Newfailed to get an interpreter IDinterpreter already initializedper-interpreter obmalloc does not support single-phase init extension modulesthread state already initializedfailed to set current tstate (TSS)PyCOND_FINI(gil->cond) failedPyMUTEX_FINI(gil->mutex) failedPyCOND_FINI(gil->switch_cond) failedPyMUTEX_FINI(gil->switch_mutex) failedinvalid interpreter config 'gil' valuePyMUTEX_INIT(gil->mutex) failedPyMUTEX_INIT(gil->switch_mutex) failedPyCOND_INIT(gil->cond) failedPyCOND_INIT(gil->switch_cond) failedPyMUTEX_LOCK(gil->mutex) failedPyCOND_WAIT(gil->cond) failedPyMUTEX_UNLOCK(gil->mutex) failedPyMUTEX_LOCK(gil->switch_mutex) failedPyCOND_SIGNAL(gil->switch_cond) failedPyMUTEX_UNLOCK(gil->switch_mutex) failedCan't initialize builtin typeCan't initialize generic typesfailed to initialize a typecan't initialize sys modulecan't set preliminary stderrfailed to initialize importlibfailed to initialize an exception typecan't initialize builtins modulefailed to add exceptions to builtinsfailed to create interpreter trampoline.failed to create a module objectfailed to initialize UnraisableHookArgs typecan't init context typescan't init float info typeCan't initialize unicode typescan't init int info typefailed to initialize deep-frozen modulesfailed to create interned dictMISSING__main__defaultcan't initialize warningsmodules__stderr__displayhook__displayhook__excepthook__excepthook__breakpointhook__breakpointhook__unraisablehook__unraisablehook__versionhexversionCPython(szz)_git_frameworkapi_versioncopyrightlinuxmaxsizefloat_infoint_infohash_infomaxunicodebuiltin_module_names(O)stdlib_module_nameslittlebyteorderabiflagsfinalversion_infocpythoncpython-312cache_tagaarch64-linux-gnu_multiarchimplementationfloat_repr_stylethread_infometa_pathpath_importer_cachepath_hookssysDISABLENO_EVENTSDEBUGGER_IDCOVERAGE_IDPROFILER_IDOPTIMIZER_IDmonitoringEllipsisNotImplementedFalseTrueboolmemoryviewbytearrayclassmethodcomplexenumeratefilterfrozensetpropertymaprangereversedslicestaticmethodsuperzip__debug__builtinsbuiltins.ExceptionGroupExceptionGroupEnvironmentError__import__import _frozen_importlib # frozen _frozen_importlibimport _imp # builtin _imp{sO}OO_installfailed to create global interned dictfailed to intern static stringObjects/listobject.cType does not define the tp_name field.type '%.100s' is not dynamically allocated but its base type '%.100s' is dynamically allocatedObjects/dictobject.cmethod cannot be both class and statictype '%.100s' participates in gc and is a base type but has inappropriate tp_free slottype %s has the Py_TPFLAGS_MANAGED_DICT flag but tp_dictoffset is settype %s has the Py_TPFLAGS_MANAGED_WEAKREF flag but tp_weaklistoffset is settype %s has the Py_TPFLAGS_MANAGED_DICT flag but not Py_TPFLAGS_HEAPTYPE flagtype %s has the Py_TPFLAGS_HAVE_GC flag but has no traverse functiontype %s has the Py_TPFLAGS_MANAGED_DICT flag but tp_dictoffset is set to incompatible valuetype %s has a tp_dictoffset that is too smalltype MRO must not be emptymro() returned a non-class ('%.500s')mro() returned base with unsuitable layout ('%.500s')non-string found in code slotCannot extend an incomplete type '%.100s'duplicate base class %Uduplicate base classObjects/tupleobject.cModules/gcmodule.cOut of memory%s() method: bad call flagsattempting to create PyCMethod with a METH_METHOD flag but no classattempting to create PyCFunction with class but no METH_METHOD flagunexpected end of datainvalid start byteinvalid continuation byteutf-8invalid maximum character passed to PyUnicode_NewNegative size passed to PyUnicode_New) -- PyDescr_NewMember used with Py_RELATIVE_OFFSETtoo many digits in integercannot create weak reference to '%s' objectobject already tracked by the garbage collectorinvalid slot offsetMultiple Py_tp_members slots are not supported.__weaklistoffset____dictoffset____vectorcalloffset__With Py_RELATIVE_OFFSET, basicsize must be negative.Member offset out of range (0..-basicsize)Multiple Py_tp_doc slots are not supported.Type spec does not define the name field.Py_tp_bases is not a tupleCreating immutable type %s from mutable base %s is deprecated, and slated to be disallowed in Python 3.14.Metaclass '%R' is not a subclass of 'type'.Type %s uses PyType_Spec with a metaclass that has custom tp_new. This is deprecated and will no longer be allowed in Python 3.14.Metaclasses with custom tp_new are not supported.Cannot extend variable-size class without Py_TPFLAGS_ITEMS_AT_END.tp_basicsize for type '%s' (%d) is too small for base '%s' (%d)weaklist offset %d is out of bounds for type '%s' (tp_basicsize = %d)dict offset %d is out of bounds for type '%s' (tp_basicsize = %d)vectorcall offset %d is out of bounds for type '%s' (tp_basicsize = %d)builtin type %.200s has no __module__ attributemetaclass conflict: the metaclass of a derived class must be a (non-strict) subclass of the metaclasses of all its basesbases must be typestype '%.100s' is not an acceptable base typemultiple bases have instance lay-out conflictNegative size passed to PyUnicode_FromStringAndSizeNULL string with positive size with NULL passed to PyUnicode_FromStringAndSizetype '%s' does not have Py_TPFLAGS_ITEMS_AT_ENDCan't initialize builtin type %sunnamed fielderrmap insertion problem.module %s: PyModule_Create is incompatible with m_slotsPython C API version mismatch for module %.100s: This Python has API version %d, module %.100s has version %d.nameless modulemodule functions cannot set METH_CLASS or METH_STATICdelassign toattribute name must be string, not '%.200s''%.100s' object has no attributes (%s .%U)'%.100s' object has only read-only attributes (%s .%U)'%.100s' object has no attribute '%U''%.100s' object attribute '%U' is read-onlytype object '%.50s' has no attribute '%U'Objects/moduleobject.csequence index must be integer, not '%.200s'type '%.200s' is not subscriptable'%.200s' object is not subscriptableunmatched paren in formatUnmatched paren in formatBad dict formatPY_SSIZE_T_CLEAN macro must be defined for '#' formatsNULL object passed to Py_BuildValuebad format char passed to Py_BuildValueMissed attribute '%U' of type %sObjects/longobject.can integer is requiredPython int too large to convert to C ssize_tlist modified during sort'%.200s' object is not iterableiter() returned non-iterator of type '%.100s'%R returned NULL without setting an exception%s returned NULL without setting an exception%R returned a result with an exception set%s returned a result with an exception setdict mutated during updatepthreadsemaphoreembedded null bytelocalesy#nnsunsupported error handlerObjects/unicodeobject.ccharacter U+%x is not in range [U+0000; U+%x]'%.200s' object does not support item assignmentPython/import.clist assignment index out of rangeNegative size passed to PyBytes_FromStringAndSizebyte string is too largethe function must be called with the GIL held, after Python initialization and before Python finalization, but the GIL is released (the current Python thread state is NULL)PY_CODE_EVENT_DESTROYPY_CODE_EVENT_CREATE%s watcher callback for %UPyErr_NewException: name must be module.classsOO while calling a Python objecttype() takes 1 or 3 argumentscannot create '%s' instancesUO!O!:type.__new__type() doesn't support MRO entry resolution; use types.new_class()nonempty __slots__ not supported for subtype of '%s'__slots__ items must be strings, not '%.200s'__slots__ must be identifiers__dict__ slot disallowed: we already got one__weakref__ slot disallowed: we already got one%R in __slots__ conflicts with class variabletype name must not contain null characterstype __qualname__ must be a str, not %s__classcell__ must be a nonlocal cell, not %.200R__classdictcell__ must be a nonlocal cell, not %.200RError calling __set_name__ on '%.100s' instance %R in '%.100s'new style getargs format but argument is not a tupleexactlyat leastat mosttoo many tuple nesting levels in argument format stringexcess ')' in getargs formatmissing ')' in getargs format%.200s%s takes no arguments%.200s%s takes at least one argumentold style getargs format uses new features%.150s%s takes %s %d argument%s (%zd given)bad format string: %.200sstr or Nonestr, bytes or bytearrayunsigned byte integer is less than minimumunsigned byte integer is greater than maximumsigned short integer is less than minimumsigned short integer is greater than maximumsigned integer is greater than maximumsigned integer is less than minimuma byte string of length 1a unicode character(unicode conversion error)embedded null character(unknown parser marker combination)(buffer is NULL)(encoding failed)(buffer_len is NULL)encoded string too long (%zd, maximum length %zd)encoded string without null bytes(unspecified)(invalid use of 'w' format character)read-write bytes-like objectcontiguous buffer(impossible)no current interpretersuper()super() argument 1 must be a type, not %.200ssuper(): no current framesuper(): no argumentssuper(): arg[0] deletedsuper(): bad __class__ cellsuper(): empty __class__ cellsuper(): __class__ is not a type (%s)super(): __class__ cell not foundsuper(type, obj): obj must be an instance or subtype of typedescriptor '%V' for type '%.100s' needs either an object or a typedescriptor '%V' for type '%.100s' needs a type, not a '%.100s' as arg 2descriptor '%V' requires a subtype of '%.100s' but received '%.100s'%U takes no arguments (%zd given)%U takes no keyword argumentstype.__init__() takes no keyword argumentstype.__init__() takes 1 or 3 argumentsmaximum recursion depth exceeded during ast constructionAST constructor recursion depth mismatch (before=%d, after=%d)yOcompile__path____origname__iso-8859-1utf-8-latin-1iso-latin-1latin-1-iso-8859-1-iso-latin-1-encoding problem: %sencoding problem: %s with BOMfrozen object %R is not a code objectunexpected indentunexpected unindentincomplete inputerror at start before reading any inputunexpected EOF while parsinginvalid syntaxmultiple statements found while compiling a single statementXXX readobject called with exception set y#marshal.loadsmarshal.loadNULL object in marshal data for objectEOF read where not expectedEOF read where object expectedbad marshal data (long size out of range)bad marshal data (unnormalized long data)bad marshal data (digit out of range in long)bad marshal data (bytes object size out of range)bad marshal data (string size out of range)size must be positivesurrogatepassbad marshal data (tuple size out of range)NULL object in marshal data for tuplebad marshal data (list size out of range)NULL object in marshal data for listbad marshal data (set size out of range)NULL object in marshal data for setNULL object in marshal data for code objectbad marshal data (invalid reference)bad marshal data (unknown type code)expected ':'expected an indented block after 'if' statement on line %dexpected an indented block after 'with' statement on line %dAsync with statements areexpected an indented block after 'for' statement on line %dAsync for loops areexpected an indented block after 'try' statement on line %dexpected 'except' or 'finally' blockcannot have both 'except' and 'except*' on the same 'try':Exception groups arematchcaseexpected an indented block after 'case' statement on line %dPattern matching isexpected an indented block after 'match' statement on line %dno import module dictionarybad marshal data (index list too large)marshal data too shortread() returned too much data: %zd bytes requested, %zd returnedinvalid kindinvalid tokeninconsistent use of tabs and spaces in indentationtoo many levels of indentationunexpected character after line continuation characterunknown parsing errorunindent does not match any outer indentation levelParser column offset overflow - source line is too bigLoaded module %R not found in sys.modulesObjects/codeobject.ccode: co_code larger than INT_MAXcode: co_code is malformedcode: co_varnames is too small# type: tokenizer beginning of buffertok_backup: wrong characterignoreinvalid character '%c' (U+%04X)invalid non-printable character U+%04Xasyncawaitdefinvalid hexadecimal literalhexadecimalinvalid digit '%c' in octal literalinvalid octal literaloctalinvalid digit '%c' in binary literalinvalid binary literalbinaryinvalid decimal literalimaginarydecimalleading zeros in decimal integer literals are not permitted; use an 0o prefix for octal integerstoo many nested f-stringsf-string: expecting '}'unterminated triple-quoted string literal (detected at line %d)unterminated string literal (detected at line %d)too many nested parenthesesf-string: single '}' is not allowedunmatched '%c'f-string: unmatched '%c'closing parenthesis '%c' does not match opening parenthesis '%c' on line %dclosing parenthesis '%c' does not match opening parenthesis '%c'readline() returned a non-bytes objectreplacereadline() returned a non-string objectsource code cannot contain null byteswaswere%U() keywords must be strings, %U() got some positional-only arguments passed as keyword arguments: '%U'%U() got an unexpected keyword argument '%S'%U() got multiple values for argument '%S'from %zd to %zd positional argument%s (and %zd keyword-only argument%s)%U() takes %U positional argument%s but %zd%U %s givenexpected bytes, %.200s foundVariable annotation syntax isVariable annotations syntax isonly single target (not %s) can be annotatedonly single target (not tuple) can be annotatedillegal target for annotationassignment to yield expression not possible'%s' is an illegal expression for augmented assignmentType statement isDid you mean to use 'from ... import ...' instead?bad RAISE_VARARGS oparg'async for' requires an object with __aiter__ method, got %.100s'async for' received an object from __aiter__ that does not implement __anext__: %.100s'async for' requires an iterator with __anext__ method, got %.100s'async for' received an invalid object from __anext__: %.100s'async with' received an object from __aenter__ that does not implement __await__: %.100s'async with' received an object from __aexit__ that does not implement __await__: %.100scoroutine is being awaited alreadylasti is not an int__build_class__ not foundno locals found when storing %Rno locals when deleting %Rname '%.200s' is not definedno locals foundValue after * must be an iterable, not %.200sno locals found when setting up annotationsbad BUILD_CONST_KEY_MAP keys argument'%.200s' object is not a mappingcatching ExceptionGroup with except* is not allowed. Use except instead.cannot 'yield from' a coroutine object in a non-coroutine generator'%.200s' object does not support the asynchronous context manager protocol'%.200s' object does not support the asynchronous context manager protocol (missed __aexit__ method)'%.200s' object does not support the context manager protocol'%.200s' object does not support the context manager protocol (missed __exit__ method)%U argument after * must be an iterable, not %.200s%U:%d: unknown opcode %dcannot access local variable '%s' where it is not associated with a valueerror return without exception settstate mix-uporphan tstatenormalizeunicodedataNFKCunicodedata.normalize() must return a string, not %.200sstartstopuncollectablecollected{sisnsn}field 'id' is required for Namefield 'ctx' is required for Namegc: collecting generation %d... gc: objects in each generation:%s gc: objects in permanent generation: %zd collectablegc: %s <%s %p> in tp_clear ofgc: done, %zd unreachable, %zd uncollectable, %.4fs elapsed in garbage collectioncannot use starred expression herecannot use double starred expression here':' expected after dictionary keycannot use a starred expression in a dictionary valueexpression expected after dictionary key and ':'dict unpacking cannot be used in dict comprehensionrR{{}}Parser/string_parser.cstring to parse is too longbytes can only contain ASCII literal characterstype_traverse() called on non-heap type '%.100s'Objects/typeobject.cfield 'value' is required for Constantcannot mix bytes and nonbytes literalsfield 'value' is required for Attributefield 'attr' is required for Attributefield 'ctx' is required for AttributeAssignment expressions areinvalid syntax. Perhaps you forgot a comma?expected 'else' after 'if' expressionf-string: lambda expressions are not allowed without parenthesesMissing parentheses in call to '%U'. Did you mean %U(...)?<>with Barry as BDFL, use '<>' instead of '!='!=tuple index out of range__build_class__: not enough arguments__build_class__: func must be a function__build_class__: name is not a string__mro_entries__ must return a tuple%.200s.__prepare__() must return a mapping, not %.200s__orig_bases____class__ not set defining %.200R as %.200R. Was __classcell__ propagated to type.__new__?__class__ set to %.200R defining %.200R as %.200Rtype object '%.100s' has no attribute '%U'The '@' operator isAwait expressions areOsobject.__getattr__descriptor '%V' for '%.100s' objects doesn't apply to a '%.100s' objectPyMember_GetOne used with Py_RELATIVE_OFFSET'%.200s' object has no attribute '%s'bad memberdescr typedescriptor '%V' needs a type, not '%s', as arg 2%U takes exactly one argument (%zd given)__format__field 'value' is required for ExprUnderscores in numeric literals are only supported in Python 3.6 and greater%S - Consider hexadecimal for huge integer literals to avoid decimal conversion limits.%.200s() takes no keyword arguments__set_name__() takes 2 positional arguments but %d were givenexpected an indented block after function definition on line %d(Async functions arePyArg_UnpackTuple() argument list is not a tupleAsync comprehensions areat least at most %.200s expected %s%zd argument%s, got %zdunpacked tuple should have %s%zd element%s, but has %zdType parameter lists arepositional argument follows keyword argument unpackingpositional argument follows keyword argumentiterable argument unpacking follows keyword argument unpackingGenerator expression must be parenthesizedinvalid syntax. Maybe you meant '==' or ':=' instead of '='?expected argument value expressionattribute '%V' of '%.100s' objects is not readablecannot assign to iterable argument unpackingInvalid star expressionfield 'value' is required for Assignexpected '%s'field 'name' is required for aliasat least one argument must precede // may appear only onceparameter without a default follows parameter with a defaultFunction parameters cannot be parenthesized/ must be ahead of *expected comma between / and *Positional-only parameters arefield 'func' is required for Callfield 'arg' is required for arg*trailing comma not allowed without surrounding parentheseshasattrfield 'op' is required for BoolOpgetattrsetattrPyMember_SetOne used with Py_RELATIVE_OFFSETreadonly attributecan't delete numeric/char attributeattribute value type must be boolTruncation of value to charTruncation of value to unsigned charTruncation of value to shortTruncation of value to unsigned shortTruncation of value to intWriting negative value into unsigned fieldTruncation of value to unsigned intbad memberdescr type for %scannot use assignment expressions with %scannot assign to %s here. Maybe you meant '==' instead of '='?named arguments must follow bare *bare * has associated type commentvar-positional argument cannot have default value* argument may appear only oncevar-keyword argument cannot have default valuearguments cannot follow var-keyword argumentattribute '%V' of '%.100s' objects is not writable__name__ must be set to a string objectfield 'left' is required for Compareexpected an indented block__qualname__ must be set to a string objectThis object has no __dict__f-string: conversion type must come right after the exclamanation markf-string: invalid conversion character %R: expected 's', 'r', or 'a'f-string: valid expression required before '='f-string: valid expression required before '!'f-string: valid expression required before ':'f-string: valid expression required before '}'f-string: expecting a valid expression after '{'f-string: expecting '=', or '!', or ':', or '}'f-string: expecting '!', or ':', or '}'f-string: missing conversion characterf-string: invalid conversion characterf-string: expecting ':' or '}'f-string: expecting '}', or format specsf-string: expressions nested too deeplyunterminated triple-quoted f-string literal (detected at line %d)unterminated f-string literal (detected at line %d)invalid escape sequence '\%c'unbound method %U needs an argumentfield 'ctx' is required for ListupdateCannot have two type comments on deffield 'value' is required for FormattedValue__class__expected an indented block after 'elif' statement on line %dexpected an indented block after 'else' statement on line %dotinvalid %s literal+field 'test' is required for Ifmust be str, not %.100scan only concatenate str (not "%.200s") to strstrings are too large to concatexpected an indented block after 'finally' statement on line %dobject.__new__() takes exactly one argument (the type to instantiate)%.200s() takes no arguments', 'Can't instantiate abstract class %s without an implementation for abstract method%s '%U'u005c\U%08xtruncated \xXX escapetruncated \UXXXXXXXX escapetruncated \uXXXX escape\ at end of stringmalformed \N character escapeillegal Unicode characterunknown Unicode character nameunicodedata._ucnhash_CAPI\N escapes not supported (can't load unicodedata module)unicodeescapefield 'value' is required for Subscriptfield 'slice' is required for Subscriptfield 'ctx' is required for Subscriptobject.__init__() takes exactly one argument (the instance to initialize)%.200s.__init__() takes exactly one argument (the instance to initialize)unable to get sys.modulesexpected an indented block after class definition on line %dObjects/weakrefobject.cimport %U # previously loaded (%R) module %s: m_size may not be negative for multi-phase initializationmodule %s has multiple create slotsmodule %s has more than one 'multiple interpreters' slotsmodule %s uses unknown slot ID %icreation of module %s failed without setting an exceptioncreation of module %s raised unreported exceptionmodule %s is not a module object, but requests module statemodule %s specifies execution slots, but did not create a ModuleType instanceexecution of module %s failed without setting an exceptionexecution of module %s raised unreported exceptionmodule %s initialized with unknown slot %ifield 'name' is required for FunctionDeffield 'args' is required for FunctionDeffield 'name' is required for ClassDefcheck_hash_based_pycsPyModule_AddObjectRef() first argument must be a modulePyModule_AddObjectRef() must be called with an exception raised if value is NULLmodule '%s' has no __dict__attribute of type '%.200s' is not callablepartially initialized module '%U' has no attribute '%U' (most likely due to a circular import)cannot access submodule '%U' of module '%U' (most likely due to a circular import)module '%U' has no attribute '%U'module has no attribute '%U'%s() requires a dict argument, not '%s'field 'target' is required for comprehensionfield 'iter' is required for comprehensionfield 'elt' is required for GeneratorExpTrailing \ in stringinvalid \x escape at position %zddecoding error; unknown error handling code: %.400sfield 'target' is required for Forfield 'iter' is required for Forfield 'test' is required for Assertdictionary changed size during iterationdictionary keys changed during iterationcannot unpack non-iterable %.200s objectnot enough values to unpack (expected %d, got %d)not enough values to unpack (expected at least %d, got %d)too many values to unpack (expected %d)not enough values to unpack (expected at least %d, got %zd)byte string is too longisinstancecan't concat %.100s to %.100sa bytes-like object is required, not '%.100s'field 'ctx' is required for Tuple in __instancecheck__BPyBuffer_FillInfo: view==NULL argument is obsoleteObject is not writable.Objects/object.c in comparison'%s' not supported between instances of '%.100s' and '%.100s'expected default value expressionfield 'left' is required for BinOpfield 'op' is required for BinOpfield 'right' is required for BinOpwidth too bigprecision too bigcharacter argument not in range(0x110000)%pinvalid format string: %sPyUnicode_FromFormatV() expects an ASCII-encoded format string, got a non-ASCII byte: 0x%02x_PyErr_SetObject: exception %R is not a BaseException subclassNormalization failed: type=%sNormalization failed: type=%s args=%Scalling %R should have returned an instance of BaseException, not %s|$OO:AttributeErrorfield 'elt' is required for SetCompPython/getargs.ckeyword this functionEmpty keyword parameter name%.200s%s takes at most %d %sargument%s (%zd given)Invalid format string (| specified twice)Invalid format string ($ before |)Invalid format string ($ specified twice)Empty parameter name after $%.200s%s takes no positional arguments%.200s%s takes %s %d positional argument%s (%zd given)More keyword list entries (%d) than format specifiers (%d)%.200s%s missing required argument '%s' (pos %d)%s: '%s'more argument specifiers than keyword list entries (remaining format:'%s')argument for %.200s%s given by name ('%s') and position (%d)keywords must be strings'%U' is an invalid keyword argument for %.200s%sinvalid keyword argument for %.200s%sfield 'test' is required for Whiletraceback must be a Traceback or Nonefield 'target' is required for NamedExprfield 'value' is required for NamedExprfield 'op' is required for UnaryOpfield 'operand' is required for UnaryOp%s only supported in Python 3.%i and greaterPython/traceback.c__traceback__ may not be deleted__traceback__ must be a traceback or Nonecatching classes that do not inherit from BaseException is not allowedfield 'elt' is required for ListCompfield 'value' is required for keyword__init__() should return None, not '%.200s'field 'test' is required for IfExpfield 'body' is required for IfExpfield 'orelse' is required for IfExpfield 'target' is required for AugAssignfield 'op' is required for AugAssignfield 'value' is required for AugAssignproperty %R of %R object has no deleterproperty %R of %R object has no setterproperty of %R object has no deleterproperty of %R object has no setterproperty has no deleterproperty has no setterfield 'context_expr' is required for withitemproperty %R of %R object has no getterproperty of %R object has no getterproperty has no getterfield 'value' is required for Starredfield 'ctx' is required for Starredempty separatortuple indices must be integers or slices, not %.200scannot fit '%.200s' into an index-sized integer'%.200s' object cannot be interpreted as an integer__index__ returned non-int (type %.200s)__index__ returned non-int (type %.200s). The ability to return an instance of a strict subclass of int is deprecated, and may be removed in a future version of Python.no symtableis_frozenuninitialized classmethod object__future__nested_scopesgeneratorsdivisionabsolute_importwith_statementprint_functionunicode_literalsbarry_as_FLUFLgenerator_stopbracesnot a chancefuture feature %.100s is not definedObjects/classobject.cAST optimizer recursion depth mismatch (before=%d, after=%d)maximum recursion depth exceeded during compilation.%dvars() argument must have __dict__ attributepopis_frozen_packageno positional arguments expectedis_builtinuninitialized staticmethod objectthis compiler does not handle FunctionTypessymtable analysis recursion depth mismatch (before=%d, after=%d)name must be string, not %.200sannotated name '%U' can't be globalannotated name '%U' can't be nonlocalname '%U' is parameter and globalname '%U' is used prior to global declarationname '%U' is assigned to before global declarationname '%U' is parameter and nonlocalname '%U' is used prior to nonlocal declarationname '%U' is assigned to before nonlocal declarationnamed expressionassignment expression cannot be used in a comprehension iterable expressionassignment expression cannot rebind comprehension iteration variable '%U'assignment expression within a comprehension cannot be used in a class bodyassignment expression within a comprehension cannot be used within the definition of a genericassignment expression within a comprehension cannot be used in a type aliasassignment expression within a comprehension cannot be used in a TypeVar boundCannot use lambda in annotation scope within class scopeyield expressionawait expressionLockTypeTIMEOUT_MAXPython int too large to convert to C longduplicate argument '%U' in function definitionduplicate type parameter '%U'comprehension inner loop cannot rebind assignment expression target '%U'private identifier too large to be mangledCannot use comprehension in annotation scope within class scopefilters_onceregistry_defaultactionwarnings_get_state: could not identify current interpreterref__new____init__can only assign an iterablename '%U' is nonlocal and globalnonlocal declaration not allowed at module levelno binding for nonlocal '%U' foundnonlocal binding not allowed for type parameter '%U'Objects/setobject.cObjects/cellobject.c|=runtime core not initializedfail to reconfigure Pythoncannot initialize filesystem codecfailed to get the Python codec of the filesystem encodingcan't initialize sys standard streams is a directory, cannot continueFailed to initialize __main__.__loader__Failed to retrieve BuiltinImporterFailed to test __main__.__loader__Failed to initialize __main__.__builtins__Failed to retrieve builtins moduleFailed to test __main__.__builtins__Failed to initialize __main__.__annotations__can't create __main__ modulefailed to get the Python codec name of the stdio encodinginitializing zipimport failedexternal importer setup failedfailed to update the Python config_install_external_importersunable to get sys.path_hooks# installing zipimport hook zipimporterzipimport# installed zipimport hook enablefaulthandlerfailed to enable faulthandlerPython path configuration: PYTHONHOME = PYTHONPATH = program name = isolated = %i environment = %i user site = %i safe_path = %i import site = %i is in build tree = %i stdlib dir = _base_executable sys.%s = %A(not set)base_prefixbase_exec_prefixplatlibdirexecutableexec_prefixpath sys.path = [ %A, ] unknown filesystem error handlerfilesystem_encodingfilesystem_errors_signalcan't initialize signalscan't start tracemalloccan't initialize the perf trampolineio__stdin____stdout__opencan't initialize io.open__annotations__BuiltinImporterwarnoptionswarnings'import warnings' failed; traceback: Failed to import the site modulePython runtime initialized with LC_CTYPE=C (a locale with default ASCII encoding), which may cause Unicode compatibility problems. Using C.UTF-8, C.utf8, or UTF-8 (if available) as alternative Unicode-compatible locales is recommended. can't initialize sys.path[0]# can't import zipimport.zipimporter _config_initisolateduse_environmentdev_modeinstall_signal_handlersuse_hash_seedhash_seedtracemallocperf_profilingimport_timecode_debug_rangesshow_ref_countdump_refsmalloc_statspycache_prefixprogram_nameparse_argvargvxoptionspythonpath_envhomemodule_search_paths_setmodule_search_pathsstdlib_dirbase_executablesite_importbytes_warningwarn_default_encodinginspectinteractiveoptimization_levelparser_debugwrite_bytecodeverbosequietuser_site_directoryconfigure_c_stdiobuffered_stdiostdio_encodingstdio_errorsskip_source_first_linerun_filename_install_importlibcheck_hash_pycs_modepathconfig_warnings_init_mainorig_argvuse_frozen_modulessafe_path_is_python_buildint_max_str_digitsSet changed size during iterationmodule kind %d should not be possiblecompile.c compiler unitunknown symbol table entryint has too many bits to express in a platform size_tgetcan't convert negative value to size_tPython int too large to convert to C size_tFormat specifier must be a string, not %.200sType %.100s doesn't define __format____format__ must return a str, not %.200s<< while getting the str of an object__str__ returned non-string (type %.200s)printunsupported operand type(s) for %.100s: '%.100s' and '%.100s'. Did you mean "print(, file=)"?negative shift countSignal %i ignored due to race condition(iO)Exceeds the limit (%d digits) for integer string conversion; use sys.set_int_max_str_digits() to increase the limit_pylongint_to_decimal_string_pylong.int_to_decimal_string did not return a str-separator: expected str instance, %.80s foundsequence item %zd: expected str instance, %.80s foundjoin() result is too long for a Python stringlist indices must be integers or slices, not %.200s'in ' requires string as left operand, not %.100s'return' outside function'return' with value in async generator'break' outside loop'continue' not properly in loop'async for' outside async functionfailed to make path absoluteunary op %d should not be possible'yield' outside function'yield from' outside function'yield from' inside async function'await' outside function'await' outside async function'%.200s' object is not callable; perhaps you missed a comma?Unrecognized conversion character %d'%.200s' object is not subscriptable; perhaps you missed a comma?%.200s indices must be integers or slices, not %.200s; perhaps you missed a comma?starred assignment target must be in a list or tuplecan't use starred expression herekeyword argument repeated: %Ubad operand type for unary -: '%.200s'string index out of rangecannot assign to __debug__cannot delete __debug__requires tuple of argumentsall arguments to joinpath() must be str or Nonefailed to join paths(Niiii)cannot read file larger than 32KB during initialization%s cannot be used within an annotation%s cannot be used within a TypeVar bound%s cannot be used within a type alias%s cannot be used within the definition of a genericuuiencoding errorimport * only allowed at module levelsurrogateescape(iOOiO)(iOO)backslashreplacexmlcharrefreplaceOSError"is" with '%.200s' literal. Did you mean "=="?"is not" with '%.200s' literal. Did you mean "!="? in __subclasscheck__bad operand type for unary ~: '%.200s'maximum number of symbolic links reached+=PyCapsule_New called with null pointerargument must be iterabletoo many statically nested blocksasynchronous comprehension outside of an asynchronous functionPyCapsule_GetPointer called with invalid PyCapsule objectPyCapsule_GetPointer called with incorrect namecan't send non-None value to a just-started coroutinecan't send non-None value to a just-started generatorcan't send non-None value to a just-started async generatorcoroutine already executinggenerator already executingasync generator already executingcannot reuse already awaited coroutinePyObject_CallFinalizerFromDealloc called on object with a non-zero refcountcoroutine ignored GeneratorExitgenerator ignored GeneratorExitasync generator ignored GeneratorExitcoroutine '%S' was never awaitedasync generator raised StopIterationcoroutine raised StopIterationgenerator raised StopIterationasync generator raised StopAsyncIterationmalformed control flow graph.too many constantsdict expectedinvalid config value: %sinvalid config type: %smissing config key: %sPython int too large to convert to C intcan't convert negative value to unsigned intPython int too large to convert to C unsigned long_xoptions_stdlib_dirlost sys.flagsdont_write_bytecodejump with NULL target__import__ not foundEmpty module namemodule name must be a stringlevel must be >= 0'__name__' not in globalsglobals must be a dictpackage must be a string__package__ != __spec__.parent__spec__.parent must be a stringcan't resolve package from __spec__ or __package__, falling back on __name__ and __path____name__ must be a stringattempted relative import beyond top-level package%U.%Uattempted relative import with no known parent packageOOOOOimportimport time: self [us] | cumulative | imported package import time: %9ld | %10ld | %*s%s %R not in sys.modules as expectedfrom __future__ imports must occur at the beginning of the filedefault 'except:' must be lastcompiler PyCompile_OpcodeStackEffectWithJump(opcode=%d, arg=%i) failedcan't allocate lock'break', 'continue' and 'return' cannot appear in an except* blocknot holding the import lockno current thread ident__new__() called with non-type 'self'%s.__new__(): not enough arguments%s.__new__(X): X is not a type object (%s)%s.__new__(%s): %s is not a subtype of %s%s.__new__(%s) is not safe, use %s.__new__()wrapper %s() takes no keyword argumentsInternal lock count overflowed|pO:acquirecan't specify a timeout for a non-blocking calltimeout value must be positivetimeout value is too largeObjects/bytesobject.ccannot release un-acquired locklist.remove(x): x not in listweakref_remove_dead_weakrefargument 1on removing the last compiler stack itemassertion is always true, perhaps remove parentheses?not a weakref%.200s is not a sequence'%.200s' object doesn't support item deletionfind_frozencannot set %R attribute of immutable type '%s'Out of memory interning an attribute namecompiler_lookup_arg(name=%R) with reftype=%d failed in %S; freevars of code %S: %R__classdict___PyST_GetScope(name=%R) failed: unknown scope in unit %S (%R); symbols: %R; locals: %R; globals: %Rstartswithtuple for startswith must only contain str, not %.100sstartswith first arg must be str or a tuple of str, not %.100sargument 2replace string is too longargument 'name'moduleget_frozen_object__length_hint__ must be an integer, not %.100s__length_hint__() should return >= 0inplace%s op %d should not be possibletoo many expressions in star-unpacking assignmentmultiple starred expressions in assignmentglobals and locals cannot be NULLexec() globals must be a dict, not %.100slocals must be a mapping or None, not %.100scannot use a closure with this code objectcode object requires a closure of exactly length %zdexecclosure can only be used when source is a code objectstring, bytes or codeinvalid node type (%d) for augmented assignmentComparison between bytes and stringComparison between bytes and intdescriptor '%V' of '%.100s' object needs an argumentdescriptor '%V' requires a '%.100s' object but received a '%.100s'issubclass() arg 1 must be a classissubclass() arg 2 must be a class, a tuple of classes, or a unionInternal error: failed to get value of a constantDEFAULT_BUFFER_SIZEUnsupportedOperations(OO){}BlockingIOErrorunmarshallable objectobject too deeply nested to marshalOimarshal.dumpstoo many objectsutf8pop from empty listpop index out of range'%.200s' object does not support item deletionsem_destroyenvironF_OKR_OKW_OKX_OKNGROUPS_MAXTMP_MAXWCONTINUEDWNOHANGWUNTRACEDO_RDONLYO_WRONLYO_RDWRO_NDELAYO_NONBLOCKO_APPENDO_DSYNCO_RSYNCO_SYNCO_NOCTTYO_CREATO_EXCLO_TRUNCO_LARGEFILEO_PATHO_TMPFILEPRIO_PROCESSPRIO_PGRPPRIO_USERO_CLOEXECO_ACCMODEO_FSYNCSEEK_HOLESEEK_DATAO_ASYNCO_DIRECTO_DIRECTORYO_NOFOLLOWO_NOATIMEEX_OKEX_USAGEEX_DATAERREX_NOINPUTEX_NOUSEREX_NOHOSTEX_UNAVAILABLEEX_SOFTWAREEX_OSERREX_OSFILEEX_CANTCREATEX_IOERREX_TEMPFAILEX_PROTOCOLEX_NOPERMEX_CONFIGST_RDONLYST_NOSUIDST_NODEVST_NOEXECST_SYNCHRONOUSST_MANDLOCKST_WRITEST_APPENDST_NOATIMEST_NODIRATIMEST_RELATIMEPOSIX_FADV_NORMALPOSIX_FADV_SEQUENTIALPOSIX_FADV_RANDOMPOSIX_FADV_NOREUSEPOSIX_FADV_WILLNEEDPOSIX_FADV_DONTNEEDP_PIDP_PGIDP_ALLP_PIDFDWEXITEDWNOWAITWSTOPPEDCLD_EXITEDCLD_KILLEDCLD_DUMPEDCLD_TRAPPEDCLD_STOPPEDCLD_CONTINUEDF_LOCKF_TLOCKF_ULOCKF_TESTRWF_DSYNCRWF_HIPRIRWF_SYNCRWF_NOWAITRWF_APPENDSPLICE_F_MOVESPLICE_F_NONBLOCKSPLICE_F_MOREPOSIX_SPAWN_OPENPOSIX_SPAWN_CLOSEPOSIX_SPAWN_DUP2SCHED_OTHERSCHED_FIFOSCHED_RRSCHED_BATCHSCHED_IDLESCHED_RESET_ON_FORKCLONE_FSCLONE_FILESCLONE_NEWNSCLONE_NEWCGROUPCLONE_NEWUTSCLONE_NEWIPCCLONE_NEWUSERCLONE_NEWPIDCLONE_NEWNETCLONE_NEWTIMECLONE_SYSVSEMCLONE_THREADCLONE_SIGHANDCLONE_VMXATTR_CREATEXATTR_REPLACEXATTR_SIZE_MAXRTLD_LAZYRTLD_NOWRTLD_GLOBALRTLD_LOCALRTLD_NODELETERTLD_NOLOADRTLD_DEEPBINDGRND_RANDOMGRND_NONBLOCKMFD_CLOEXECMFD_ALLOW_SEALINGMFD_HUGETLBMFD_HUGE_SHIFTMFD_HUGE_MASKMFD_HUGE_64KBMFD_HUGE_512KBMFD_HUGE_1MBMFD_HUGE_2MBMFD_HUGE_8MBMFD_HUGE_16MBMFD_HUGE_32MBMFD_HUGE_256MBMFD_HUGE_512MBMFD_HUGE_1GBMFD_HUGE_2GBMFD_HUGE_16GBEFD_CLOEXECEFD_NONBLOCKEFD_SEMAPHOREpathconf_namesconfstr_namessysconf_namesposix.waitid_resultwaitid_resultos.stat_resultstat_resultos.statvfs_resultstatvfs_resultposix.sched_paramsched_paramterminal_sizeDirEntryposix.times_resulttimes_resultuname_resultstruct_rusagest_mode_have_functionsargument should be integer or None, not %.200sordinal not in range(128)asciican only join an iterablecan only concatenate tuple (not "%.200s") to tuple__code__length argument must be non-negativeargument 'byteorder'to_bytesbyteorder must be either 'little' or 'big'can't convert negative int to unsignedint too big to convertfrom_bytesCan't compare %.100s and %.100s__bytes__ returned non-bytes (type %.200s)byte array too long to convert to intpop from an empty set{OO}OOOOicannot import name %R from partially initialized module %R (most likely due to a circular import) (%S)cannot import name %R from %R (%S)cannot import name %R from %R (unknown location)CLOCK_REALTIMECLOCK_MONOTONICCLOCK_MONOTONIC_RAWCLOCK_PROCESS_CPUTIME_IDCLOCK_THREAD_CPUTIME_IDCLOCK_BOOTTIMECLOCK_TAI_STRUCT_TM_ITEMS invalid GMT offsettimezonealtzonedaylight(zz)tznamestring indices must be integers, not '%.200s'slice step cannot be zeroslice indices must be integers or None or have an __index__ methodus_asciilatin1latin_1iso_8859_1iso8859_1encoder %s returned bytearray instead of bytes; use codecs.encode() to encode to arbitrary types'%.400s' encoder returned '%.400s' instead of 'bytes'; use codecs.encode() to encode to arbitrary typescannot decode %ssurrogates not allowed_Py_normalize_encoding() failedno codec search functions registered: can't find encodingcodec search functions must return 4-tuplesunknown encoding: %sencodingshandler must be callablestring, bytes, os.PathLike, integer or Nonestring, bytes, os.PathLike or integerstring, bytes, os.PathLike or Nonestring, bytes or os.PathLikeexpected %.200s.__fspath__() to return str or bytes, not %.200s%s%sembedded null character in %s%s%s%s should be %s, not %.200ssOnnsstat%s: can't specify dir_fd without matching path%s: can't specify both dir_fd and fd%s: cannot use fd and follow_symlinks togetherdrop_gil: GIL is not lockedPyCOND_SIGNAL(gil->cond) failedPyCOND_WAIT(gil->switch_cond) failedminmax%s expected at least 1 argument, got 0|$OO:max|$OO:minCannot specify a default for %s() with multiple positional arguments%s() iterable argument is emptyrfind&|$OOO:ImportErrorUnmatched right paren in format stringimpossibleUnmatched left paren in format stringNo active exception to reraisecalling %R should have returned an instance of BaseException, not %Rexceptions must derive from BaseExceptionexception causes must derive from BaseExceptionos.listdirrstrip%s arg must be None or strexpected str, bytes or os.PathLike object, not %.200sendswithtuple for endswith must only contain str, not %.100sendswith first arg must be str or a tuple of str, not %.100sargument 'encoding'argument 'errors'int() missing string argumentint() base must be >= 2 and <= 36, or 0int() can't convert non-string with explicit base__int__ returned non-int (type %.200s)__int__ returned non-int (type %.200s). The ability to return an instance of a strict subclass of int is deprecated, and may be removed in a future version of Python.The delegation of int() to __trunc__ is deprecated.__trunc__ returned non-Integral (type %.200s)int() argument must be a string, a bytes-like object or a real number, not '%.200s'cannot convert float infinity to integercannot convert float NaN to integerisinstance() arg 2 must be a type, a tuple of types, or a unionargument 'path'open_code'path' must be 'str', not '%.200s'_iorbargument 'mode'argument 'newline'invalid file: %Rinvalid mode: '%s'can't have text and binary mode at oncemust have exactly one of create/read/write/append modebinary mode doesn't take an encoding argumentbinary mode doesn't take an errors argumentbinary mode doesn't take a newline argumentline buffering (buffering=1) isn't supported in binary mode, the default buffer size will be usedOsOOinvalid buffering sizecan't have unbuffered text I/Ounknown mode: '%s'OsssOFileIOnegative file descriptorMust have exactly one of create/read/write/append mode and at most one plusinvalid mode: %.200sOsiCannot use closefd=False with file nameexpected integer from openeropener returned %dI/O operation on closed filePyType_GetModuleByDef: No superclass of '%s' has the given moduleFile or stream is not readable.buffer size must be strictly positivecan't allocate read lockRaw stream returned invalid position %zdcannot fit '%.200s' into an offset-sized integerI/O operation on closed file.raw stream has been detachedI/O operation on uninitialized objectread length must be non-negative or -1read of closed filereadall() should return bytesread() should return bytesunbounded read returned more bytes than a Python bytes object can holdclose() takes no argumentsbyte indices must be integers or slices, not %.200soperation forbidden on released memoryview objectcannot create new view on restricted memoryviewmemoryview: a bytes-like object is required, not '%.200s'compile() mode must be 'exec', 'eval', 'single' or 'func_type'compile() mode must be 'exec', 'eval' or 'single'compile(): unrecognised flagscompile(): invalid optimize valueevalsinglefunc_typecompile() mode 'func_type' requires flag PyCF_ONLY_ASTstring, bytes or AST%.200s%s missing required argument '%U' (pos %d)argument for %.200s%s given by name ('%U') and position (%d)memoryview: number of dimensions must not exceed 64path should be string, bytes, or os.PathLike, not %.200sinvalid indexing of 0-dim memorysub-views are not implementedmulti-dimensional slicing is not implementedmemoryview: invalid slice key__dict____doc____match_args____module___attributes_fieldsannotationargsargtypesasnameastbasesbodyboundcasescauseclscol_offsetcontext_exprconversionctxdecorator_listdefaultselteltsend_col_offsetend_linenoexcformat_specfuncguardhandlersifsis_asyncitemsiterkeyskeywordskw_defaultskwargkwd_attrskwd_patternskwonlyargsleftmsgopoperandopsoptional_varsorelsepatternsposonlyargsrestreturnsrightsimplestepsubjecttagtargetstesttype_commenttype_ignorestype_paramsuppervarargmod = Module(stmt* body, type_ignore* type_ignores) | Interactive(stmt* body) | Expression(expr body) | FunctionType(expr* argtypes, expr returns)modModule(stmt* body, type_ignore* type_ignores)ModuleInteractive(stmt* body)InteractiveExpression(expr body)ExpressionFunctionType(expr* argtypes, expr returns)stmt = FunctionDef(identifier name, arguments args, stmt* body, expr* decorator_list, expr? returns, string? type_comment, type_param* type_params) | AsyncFunctionDef(identifier name, arguments args, stmt* body, expr* decorator_list, expr? returns, string? type_comment, type_param* type_params) | ClassDef(identifier name, expr* bases, keyword* keywords, stmt* body, expr* decorator_list, type_param* type_params) | Return(expr? value) | Delete(expr* targets) | Assign(expr* targets, expr value, string? type_comment) | TypeAlias(expr name, type_param* type_params, expr value) | AugAssign(expr target, operator op, expr value) | AnnAssign(expr target, expr annotation, expr? value, int simple) | For(expr target, expr iter, stmt* body, stmt* orelse, string? type_comment) | AsyncFor(expr target, expr iter, stmt* body, stmt* orelse, string? type_comment) | While(expr test, stmt* body, stmt* orelse) | If(expr test, stmt* body, stmt* orelse) | With(withitem* items, stmt* body, string? type_comment) | AsyncWith(withitem* items, stmt* body, string? type_comment) | Match(expr subject, match_case* cases) | Raise(expr? exc, expr? cause) | Try(stmt* body, excepthandler* handlers, stmt* orelse, stmt* finalbody) | TryStar(stmt* body, excepthandler* handlers, stmt* orelse, stmt* finalbody) | Assert(expr test, expr? msg) | Import(alias* names) | ImportFrom(identifier? module, alias* names, int? level) | Global(identifier* names) | Nonlocal(identifier* names) | Expr(expr value) | Pass | Break | ContinuestmtFunctionDef(identifier name, arguments args, stmt* body, expr* decorator_list, expr? returns, string? type_comment, type_param* type_params)AsyncFunctionDef(identifier name, arguments args, stmt* body, expr* decorator_list, expr? returns, string? type_comment, type_param* type_params)AsyncFunctionDefClassDef(identifier name, expr* bases, keyword* keywords, stmt* body, expr* decorator_list, type_param* type_params)ClassDefReturn(expr? value)ReturnDelete(expr* targets)DeleteAssign(expr* targets, expr value, string? type_comment)TypeAlias(expr name, type_param* type_params, expr value)TypeAliasAugAssign(expr target, operator op, expr value)AugAssignAnnAssign(expr target, expr annotation, expr? value, int simple)AnnAssignFor(expr target, expr iter, stmt* body, stmt* orelse, string? type_comment)AsyncFor(expr target, expr iter, stmt* body, stmt* orelse, string? type_comment)AsyncForWhile(expr test, stmt* body, stmt* orelse)WhileIf(expr test, stmt* body, stmt* orelse)IfWith(withitem* items, stmt* body, string? type_comment)WithAsyncWith(withitem* items, stmt* body, string? type_comment)AsyncWithMatch(expr subject, match_case* cases)Raise(expr? exc, expr? cause)RaiseTry(stmt* body, excepthandler* handlers, stmt* orelse, stmt* finalbody)TryTryStar(stmt* body, excepthandler* handlers, stmt* orelse, stmt* finalbody)TryStarAssert(expr test, expr? msg)AssertImport(alias* names)ImportImportFrom(identifier? module, alias* names, int? level)ImportFromGlobal(identifier* names)GlobalNonlocal(identifier* names)NonlocalExpr(expr value)ExprPassBreakexpr = BoolOp(boolop op, expr* values) | NamedExpr(expr target, expr value) | BinOp(expr left, operator op, expr right) | UnaryOp(unaryop op, expr operand) | Lambda(arguments args, expr body) | IfExp(expr test, expr body, expr orelse) | Dict(expr* keys, expr* values) | Set(expr* elts) | ListComp(expr elt, comprehension* generators) | SetComp(expr elt, comprehension* generators) | DictComp(expr key, expr value, comprehension* generators) | GeneratorExp(expr elt, comprehension* generators) | Await(expr value) | Yield(expr? value) | YieldFrom(expr value) | Compare(expr left, cmpop* ops, expr* comparators) | Call(expr func, expr* args, keyword* keywords) | FormattedValue(expr value, int conversion, expr? format_spec) | JoinedStr(expr* values) | Constant(constant value, string? kind) | Attribute(expr value, identifier attr, expr_context ctx) | Subscript(expr value, expr slice, expr_context ctx) | Starred(expr value, expr_context ctx) | Name(identifier id, expr_context ctx) | List(expr* elts, expr_context ctx) | Tuple(expr* elts, expr_context ctx) | Slice(expr? lower, expr? upper, expr? step)BoolOp(boolop op, expr* values)BoolOpNamedExpr(expr target, expr value)NamedExprBinOp(expr left, operator op, expr right)BinOpUnaryOp(unaryop op, expr operand)Lambda(arguments args, expr body)LambdaIfExp(expr test, expr body, expr orelse)IfExpDict(expr* keys, expr* values)DictSet(expr* elts)SetListComp(expr elt, comprehension* generators)ListCompSetComp(expr elt, comprehension* generators)SetCompDictComp(expr key, expr value, comprehension* generators)DictCompGeneratorExp(expr elt, comprehension* generators)GeneratorExpAwait(expr value)AwaitYield(expr? value)YieldYieldFrom(expr value)YieldFromCompare(expr left, cmpop* ops, expr* comparators)CompareCall(expr func, expr* args, keyword* keywords)CallFormattedValue(expr value, int conversion, expr? format_spec)FormattedValueJoinedStr(expr* values)JoinedStrConstant(constant value, string? kind)ConstantAttribute(expr value, identifier attr, expr_context ctx)AttributeSubscript(expr value, expr slice, expr_context ctx)SubscriptStarred(expr value, expr_context ctx)StarredName(identifier id, expr_context ctx)NameList(expr* elts, expr_context ctx)ListTuple(expr* elts, expr_context ctx)TupleSlice(expr? lower, expr? upper, expr? step)Sliceexpr_context = Load | Store | Delexpr_contextLoadStoreDelboolop = And | OrboolopAndOroperator = Add | Sub | Mult | MatMult | Div | Mod | Pow | LShift | RShift | BitOr | BitXor | BitAnd | FloorDivoperatorAddSubMultMatMultDivModPowLShiftRShiftBitOrBitXorBitAndFloorDivunaryop = Invert | Not | UAdd | USubunaryopInvertNotUAddcmpop = Eq | NotEq | Lt | LtE | Gt | GtE | Is | IsNot | In | NotIncmpopEqNotEqLtLtEGtGtEIsIsNotNotIncomprehension(expr target, expr iter, expr* ifs, int is_async)comprehensionexcepthandler = ExceptHandler(expr? type, identifier? name, stmt* body)excepthandlerExceptHandlerarguments(arg* posonlyargs, arg* args, arg? vararg, arg* kwonlyargs, expr* kw_defaults, arg? kwarg, expr* defaults)arg(identifier arg, expr? annotation, string? type_comment)keyword(identifier? arg, expr value)keywordalias(identifier name, identifier? asname)withitem(expr context_expr, expr? optional_vars)withitemmatch_case(pattern pattern, expr? guard, stmt* body)pattern = MatchValue(expr value) | MatchSingleton(constant value) | MatchSequence(pattern* patterns) | MatchMapping(expr* keys, pattern* patterns, identifier? rest) | MatchClass(expr cls, pattern* patterns, identifier* kwd_attrs, pattern* kwd_patterns) | MatchStar(identifier? name) | MatchAs(pattern? pattern, identifier? name) | MatchOr(pattern* patterns)MatchValue(expr value)MatchValueMatchSingleton(constant value)MatchSingletonMatchSequence(pattern* patterns)MatchSequenceMatchMapping(expr* keys, pattern* patterns, identifier? rest)MatchMappingMatchClass(expr cls, pattern* patterns, identifier* kwd_attrs, pattern* kwd_patterns)MatchClassMatchStar(identifier? name)MatchStarMatchAs(pattern? pattern, identifier? name)MatchAsMatchOr(pattern* patterns)MatchOrtype_ignore = TypeIgnore(int lineno, string tag)type_ignoreTypeIgnore(int lineno, string tag)TypeIgnoretype_param = TypeVar(identifier name, expr? bound) | ParamSpec(identifier name) | TypeVarTuple(identifier name)type_paramTypeVar(identifier name, expr? bound)TypeVarParamSpec(identifier name)ParamSpecTypeVarTuples(O){OOOOOOOs}memoryview: underlying buffer is not writablememoryview: underlying buffer is not C-contiguousmemoryview: underlying buffer is not Fortran contiguousmemoryview: underlying buffer is not contiguousmemoryview: underlying buffer requires suboffsetsmemoryview: cannot cast to unsigned bytes if the format flag is present%s() arg 1 must be a %s objectsource code string cannot contain null bytes_fix_co_filenameKeyItem__all__no locals found during 'import *'from-import-* object has no __dict__ and no __all__module __name__ must be a string, not %.100s%s in %U.%s must be str, not %.100s'%.200s' object does not support indexingassigning None to unbound local %Rlookup_errorunknown error handler name '%.400s'argument must be callablesignal.itimer_errorNSIGSIG_BLOCKSIG_UNBLOCKSIG_SETMASKSIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGIOTSIGABRTSIGFPESIGKILLSIGBUSSIGSEGVSIGSYSSIGPIPESIGALRMSIGTERMSIGUSR1SIGUSR2SIGCLDSIGCHLDSIGPWRSIGIOSIGURGSIGWINCHSIGPOLLSIGSTOPSIGTSTPSIGCONTSIGTTINSIGTTOUSIGVTALRMSIGPROFSIGXCPUSIGXFSZSIGRTMINSIGRTMAXSIGSTKFLTITIMER_REALITIMER_VIRTUALITIMER_PROFSIG_DFLSIG_IGNItimerErrordefault_int_handleritems() returned non-iterableitems() returned item which size is not 2__bases__ is not tuple__abc_tpflags__ cannot be both Py_TPFLAGS_SEQUENCE and Py_TPFLAGS_MAPPINGmappingproxy() argument must be a mapping, not %s%.200s.%U() returned a non-iterable (type %.200s)cannot set '%s' attribute of immutable type '%s'cannot delete '%s' attribute of immutable type '%s'OsOobject.__setattr___abc_registerCan only register classesRefusing to create an inheritance cycle_abc_subclasscheck__subclasshook__ must return either False, True, or NotImplemented__subclasses____subclasses__() must return a list_abc_impl is set to a wrong typeweak object has gone awaymodule filename missing<%s object at %p> while getting the repr of an object__repr__ returned non-string (type %.200s)string is too long to generate reprexpected a subclass of ImportErrorexpected a message argumentname_fromwbOOOsOOisiOOOOTextIOWrapper'encoding' argument not specifiedTextIOWrapper() argument 'errors' must be str or None, not %.50sembedded null character in errorscodecs.open()'%.400s' is not a text encoding; use %s to handle arbitrary codecsillegal newline value: %sincrementaldecoderFile or stream is not writable.incrementalencoder|S_IFDIRS_IFCHRS_IFBLKS_IFREGS_IFIFOS_IFLNKS_IFSOCKS_IFDOORS_IFPORTS_IFWHTS_ISUIDS_ISGIDS_ISVTXS_ENFMTS_IREADS_IWRITES_IEXECS_IRWXUS_IRUSRS_IWUSRS_IXUSRS_IRWXGS_IRGRPS_IWGRPS_IXGRPS_IRWXOS_IROTHS_IWOTHS_IXOTHUF_NODUMPUF_IMMUTABLEUF_APPENDUF_OPAQUEUF_NOUNLINKUF_COMPRESSEDUF_HIDDENSF_ARCHIVEDSF_IMMUTABLESF_APPENDSF_NOUNLINKSF_SNAPSHOTFailed checking if argv[0] is an import path entry readlinerlcompleterunable to get sys.pathPython %s on %s Type "help", "copyright", "credits" or "license" for more information.%s cpython.run_commandUnable to decode the command from the command line: cpython.run_file%S: can't open file %R: [Errno %d] %s %S: %R is a directory, cannot continue PYTHONSTARTUPcpython.run_startupCould not open PYTHONSTARTUP cpython.run_stdiniter(object, sentinel): object must be callableinterpreter already runningcurrent tstate has wrong interpretercpython.run_modulerunpyCould not import runpy module _run_module_as_mainCould not access runpy._run_module_as_main Could not convert module name to unicode Could not create arguments for runpy._run_module_as_main encoding without a string argumenterrors without a string argumentstring argument without an encodingnegative countcannot convert '%.200s' object to bytearrayObjects/bytearrayobject.cdeallocated bytearray object has exported buffers'%.200s' object is not reversiblerange() arg 3 must not be zerorange expected at least 1 argument, got 0range expected at most 3 arguments, got %zd//int_divmodtuple is required from int_divmod()tuple of int is required from int_divmod()integer division or modulo by zero|$p:ziptype object '%s' has no attribute '__annotations__'dir(): expected keys() of locals to be a list, not '%.200s'object does not provide __dir__.__dict__ is not a dictionaryCan't convert '%.100s' object to str implicitlymap() must have at least two arguments.must assign iterable to extended sliceattempt to assign sequence of size %zd to extended slice of size %zdcan't multiply sequence by non-int of type '%.200s'repeated string is too longnext'%.200s' object is not an iteratorfind'%.200s' object is not a containerdecoding str is not supporteddecoding to str: need a bytes-like object, %.80s found'%.400s' decoder returned '%.400s' instead of 'str'; use codecs.decode() to decode to arbitrary types%format requires a mappingincomplete format key* wants int%%%c format: an integer is required, not %.200s%%%c format: a real number is required, not %.200s%c arg not in range(0x110000)%c requires int or charunsupported format character '%c' (0x%x) at index %zdnot all arguments converted during string formattingincomplete formatnot enough arguments for format string_call_with_frames_removedlost sys.path_importer_cachelost sys.path_hookssys.path_hooks is not a listsys.path_importer_cache is not a dictseekwhence value %d unsupportedseek of closed fileFile or stream is not seekable.argument should be integer or None, not '%.200s'raw readinto() failedraw readinto() returned invalid length %zd (should have been between 0 and %zd)PyMemoryView_FromBuffer(): info->buf must not be NULLreadintoreadingFile not open for %sargument should be integer or bytes-like object, not '%.200s'byte must be in range(0, 256)???__file__.pyc__cached__python: Can't reopen .pyc file SourcelessFileLoaderpython: failed to set __main__.__loader__ Bad magic number in .pyc fileBad code object in .pyc fileSourceFileLoader_bootstrap_external_RAW_MAGIC_NUMBERsOExisting exports of data: object cannot be re-sizedPyBuffer_ToContiguous: len != view->lencan't extend bytearray with %.100scan't set bytearray slice from %.100sbuiltins.idNon-UTF-8 code starting with '\x%.2x' in file %U on line %i, but no encoding declared; see https://peps.python.org/pep-0263/ for detailsOOiwritingbytearray_getbuffer: view==NULL argument is obsoleterenameOOiios.rename%s: src and dst must be the same typeunderlying buffer has been detachedflush of closed filePython/ceval_gil.cin atexit callbackclosedOiios.mkdir# clear sys.%s gc: %zd uncollectable objects at shutdowngc: %zd uncollectable objects at shutdown; use gc.set_debug(gc.DEBUG_UNCOLLECTABLE) to list them# clear builtins._ # restore sys.%s # cleanup[2] removing %U gc %s # cleanup[3] wiping %U # cleanup[3] wiping sys # cleanup[3] wiping builtins # destroy %U Exception ignored in m_clear of module%s%V # clear[1] %s # clear[2] %s unclosed file %Rfield 'key' is required for DictCompfield 'value' is required for DictComp# clear sys.audit hooks cpython._PySys_ClearAuditHooksfield 'target' is required for AnnAssignfield 'annotation' is required for AnnAssigncpython.PyInterpreterState_ClearPyThreadState_Clear: warning: thread still has a frame PyThreadState_Clear: warning: thread still has a generator NULL interpreterremaining threadsremaining subinterpreterststate %p is still current__annotations__ must be set to a dict objectfailed to clear current tstate (TSS)__type_params__ must be set to a tuplethe interpreter doesn't have its own allocatorcannot use '_' as a targetinvalid pattern targetpositional patterns follow keyword patternsreal number required in complex literalinterncan't intern %.400scan only concatenate list (not "%.200s") to listglobals must be a real dict; try eval(expr, {}, mapping)locals must be a mappingeval must be given globals and locals when called without a framecode object passed to eval() may not contain free variablesfield 'value' is required for MatchValueLambda expression parameters cannot be parenthesizedfield 'subject' is required for Match** or pow()unsupported operand type(s) for %.100s: '%.100s' and '%.100s'unsupported operand type(s) for %.100s: '%.100s', '%.100s', '%.100s'pow() 3rd argument cannot be 0base is not invertible for the given modulusfield 'args' is required for Lambdafield 'body' is required for Lambdafield 'body' is required for Expressionenumerate() missing required argument 'iterable'enumerate() takes at most 2 arguments (%d given)_tuplegettersys._getframemodulenameObjects/funcobject.ca number is required|OO:dequemaxlen must be non-negativerelease unlocked lockAt least one argument is required.beforeafter_in_childafter_in_parent'%s' must be callable, not %smust be str or None, not %.100smode out of rangelost sys.stdoutsep must be None or a string, not %.200send must be None or a string, not %.200swriteobject with NULL filefield 'value' is required for YieldFromnot writableencoder should return a bytes object, not '%.200s'null file for PyFile_WriteStringwrite to closed fileraw write() returned invalid length %zd (should have been between 0 and %zd)field 'name' is required for AsyncFunctionDeffield 'args' is required for AsyncFunctionDeffield 'value' is required for Awaithow_many cannot be negativeCannot write %zi characters at %zi in a string of %zi charactersCannot copy %s characters into a string of %s charactersCannot modify a string currently usedinvalid node type (%d) for annotated assignmentcould not convert string to float: '%.200s'value too large to convert to float: '%.200s'patterns may only match literals and attribute lookupsmultiple starred names in sequence patterntoo many expressions in star-unpacking sequence patternmultiple starred expressions in sequence patternkeys (%d) / patterns (%d) length mismatch in mapping patterntoo many sub-patterns in mapping patterncan't use NULL keys in MatchMapping (set 'rest' parameter instead)mapping pattern checks duplicate key (%R)mapping pattern keys may only match literals and attribute lookupskwd_attrs (%d) / kwd_patterns (%d) length mismatch in class patterntoo many sub-patterns in class pattern %Rattribute name repeated in class pattern: %Uname capture %R makes remaining patterns unreachablewildcard makes remaining patterns unreachablemultiple assignments to name %R in patternalternative patterns bind different namesinvalid match pattern node in AST (kind=%d)can't unpack IEEE 754 special value on non-IEEE platformfrexp() result out of rangefloat too large to pack with d formatsetdefaultcannot convert dictionary update sequence element #%zd to a sequencedictionary update sequence element #%zd has length %zd; 2 is requireddelattr__delattr__expected %d argument%s, got %zdcan't apply this %s to %s object__setattr__%.200s is not a mappingobject of type '%.200s' has no len()issubclasssortedMAGICCODESIZEMAXREPEATMAXGROUPSfield 'value' is required for MatchSingletonord() expected string of length 1, but %.200s foundord() expected a character, but string of length %zd found&=field 'cls' is required for MatchClasschr() arg not in range(0x110000)__len__() should return >= 0range indices must be integers or slices, not %.200sargument 'code'argument 'groupindex'argument 'indexgroup'regular expression code size limit exceededinvalid SRE codeexpected string or bytes-like object, got '%.200s'Buffer is NULLPyType_GetModule: Type '%s' is not a heap typePyType_GetModule: Type '%s' has no associated modulecannot use a string pattern on a bytes-like objectcannot use a bytes pattern on a string-like objectThe span of capturing group is wrong, please report a bug for the re module.OOpO:lru_cachethe first argument must be callablemaxsize should be integer or None^^=fromkeysrepeated bytes are too longObjects/iterobject.citer index too largebytearray index out of rangebytearray indices must be integers or slices, not %.200scan assign only bytes, buffers, or iterables of ints in range(0, 256)attempt to assign bytes of size %zd to extended slice of size %zdtranslation table must be 256 characters longNegative size passed to PyByteArray_FromStringAndSizeinvalid literal for int() with base %d: %.200Rint() arg 2 must be >= 2 and <= 36int string too large to convertExceeds the limit (%d digits) for integer string conversion: value has %zd digits; use sys.set_int_max_str_digits() to increase the limitint_from_string_pylong.int_from_string did not return an intASTPyCF_ALLOW_TOP_LEVEL_AWAITPyCF_ONLY_ASTPyCF_TYPE_COMMENTStype 'partial' takes at least one argument'%.200s' object can't be concatenatedsum() can't sum strings [use ''.join(seq) instead]sum() can't sum bytes [use b''.join(seq) instead]sum() can't sum bytearray [use b''.join(seq) instead]s 1-zip() argument %d is shorter than argument%s%dzip() argument %d is longer than argument%s%d__defaults__ must be set to a tuple object__defaults__object.__delattr__descriptor for index '%zd' for tuple subclasses doesn't apply to '%s' object'async with' outside async functioncannot use constraints with TypeVarTuplecannot use bound with TypeVarTuplecannot use constraints with ParamSpeccannot use bound with ParamSpecfield 'name' is required for TypeVarfield 'name' is required for TypeVarTuplefield 'name' is required for ParamSpecfield 'name' is required for TypeAliasfield 'value' is required for TypeAliasExpected int as rr must be non-negativerepeat|n:productrepeat argument cannot be negativerepeat argument too largeParamSpecArgsParamSpecKwargsGenericTypeAliasType_generic_init_subclasstypingcharacter maps to Un;translating error handler must return (str, int) tupleposition %zd from error handler out of boundsfirst argument must be callable or None'%.200s' object is unsliceablecharacter mapping must be in range(0x%x)character mapping must return integer, None or strtypevarBivariant types are not supported.Variance cannot be specified with infer_variance.constraints must be a tupleA single constraint is not allowedConstraints cannot be combined with bound=...Bound must be a type._type_checkreadlinesreadline() should have returned a str object, not '%.200s'Cannot find Generic type_GenericAliasread1not readableillegal decoder stateOO;illegal decoder stateillegal decoder state: the first item should be a bytes object, not '%.200s'underlying %s() should have returned a bytes-like object, not '%.200s'NN_generic_class_getitemIncrementalNewlineDecoder.__init__() not calledutf_8_decodeNnindextuple.index(x): x not in tupledecoder should return a string result, not '%.200s'insertunsupported format string passed to %.200s.__format____name__can only assign string to %s.__name__, not '%s'strip__hash__ method should return an integerno such groupaudit() missing 1 required positional argument: 'event'expected str for argument 'event'expected str for argument 'event', not %.200sos.scandirOK;illegal decoder stateNKclock_gettime(CLOCK_REALTIME)bytes must be in range(0, 256)cannot convert '%.200s' object to bytes@c@P@?@e@d@f@N@nQ@Q@q@L@l@I@i@H@h@B@bargument 'format'castmemoryview: casts are restricted to C-contiguous viewsshape must be a list or a tuplememoryview: cast must be 1D -> ND or ND -> 1Dmemoryview: destination format must be a native single character format prefixed with an optional '@'memoryview: cannot cast between two non-byte formatsmemoryview: length is not a multiple of itemsizememoryview: internal errormemoryview.cast(): elements of shape must be integersmemoryview.cast(): elements of shape must be integers > 0memoryview.cast(): product(shape) > SSIZE_MAXmemoryview: product(shape) * itemsize != buffer sizememoryview: cannot cast view with zeros in shape or strides0-dim memory has no lengthsearchmemoryview: unsupported format %smemoryview: format %s not supported-=search() takes no argumentsregular expression scanner already executingregister() takes at least 1 argument (0 given)errorcodeENODEVENOCSIEHOSTUNREACHENOMSGEUCLEANEL2NSYNCEL2HLTENODATAENOTBLKENOSYSEPIPEEINVALEOVERFLOWEADVEINTREUSERSENOTEMPTYENOBUFSEPROTOEREMOTEENAVAILECHILDELOOPEXDEVE2BIGESRCHEMSGSIZEEAFNOSUPPORTEBADREHOSTDOWNEPFNOSUPPORTENOPROTOOPTEBUSYEWOULDBLOCKEBADFDEDOTDOTEISCONNENOANOESHUTDOWNECHRNGELIBBADENONETEBADEEBADFEMULTIHOPEIOEUNATCHEPROTOTYPEENOSPCENOEXECEALREADYENETDOWNENOTNAMEACCESELNRNGEILSEQENOTDIRENOTUNIQEPERMEDOMEXFULLECONNREFUSEDEISDIREPROTONOSUPPORTEROFSEADDRNOTAVAILEIDRMECOMMESRMNTEREMOTEIOEL3RSTEBADMSGENFILEELIBMAXESPIPEENOLINKENETRESETETIMEDOUTENOENTEEXISTEDQUOTENOSTREBADSLTEBADRQCELIBACCEFAULTEFBIGEDEADLKENOTCONNEDESTADDRREQELIBSCNENOLCKEISNAMECONNABORTEDENETUNREACHESTALEENOSRENOMEMENOTSOCKESTRPIPEEMLINKERANGEELIBEXECEL3HLTECONNRESETEADDRINUSEEOPNOTSUPPEREMCHGEAGAINENAMETOOLONGENOTTYERESTARTESOCKTNOSUPPORTETIMEEBFONTEDEADLOCKETOOMANYREFSEMFILEETXTBSYEINPROGRESSENXIOENOPKGENOMEDIUMEMEDIUMTYPEECANCELEDENOKEYEKEYEXPIREDEKEYREVOKEDEKEYREJECTEDEOWNERDEADENOTRECOVERABLEERFKILLENOTSUPPyInitPyInitUcreate_dynamicoriginspec.name must be a stringpunycodeccdynamic module does not define module export function (%s_%s)initialization of %s failed without raising an exceptioninitialization of %s raised unreported exceptioninit function of %s returned uninitialized objectinitialization of %s did not return PyModuleDefinitialization of %s did not return an extension modulereplace bytes is too longunknown dlopen() error./%-.255s%.20s_%.200sunclosed scandir iterator %RLC_CTYPELC_TIMELC_COLLATELC_MONETARYLC_MESSAGESLC_NUMERICCHAR_MAXlocale.Error.__class__.__qualname__ is not a unicode object%S.%s<<=maketransargument 3first maketrans argument must be a string if there is a second argumentthe first two maketrans arguments must have equal lengthif you give only one argument to maketrans it must be a dictstring keys in translate table must be of length 1keys in translate table must be strings or integerslstripget_terminal_sizeconstructor requires a sequence%.500s() takes a dict as second arg, if any%.500s() takes an at least %zd-sequence (%zd-sequence given)%.500s() takes an at most %zd-sequence (%zd-sequence given)%.500s() takes a %zd-sequence (%zd-sequence given){...}{}bytes object is too large to make repr(...),)Precision not allowed in integer format specifierNegative zero coercion (z) not allowed in integer format specifierSign not allowed with integer format specifier 'c'Alternate form (#) not allowed with integer format specifier 'c'Cannot specify both ',' and '_'.Format specifier missing precisionInvalid format specifier '%U' for object of type '%.200s'Cannot specify '%c' with '%c'.Cannot specify '%c' with '\x%x'.Too many decimal digits in format stringint too large to formatnon-ascii grouped digitMax string recursion exceededFormat string contains positional fieldsReplacement index %zd out of range for positional args tupleUnknown conversion specifier %cUnknown conversion specifier \x%xSingle '}' encountered in format stringSingle '{' encountered in format stringunexpected '{' in field nameend of string while looking for conversion specifierexpected ':' after conversion specifierunmatched '{' in format specexpected '}' before end of stringframe does not existcannot switch from manual field specification to automatic field numberingcannot switch from automatic field numbering to manual field specification/Only '.' or '[' may follow ']' in format field specifierEmpty attribute in format stringMissing ']' in format stringSpace not allowed in string format specifierSign not allowed in string format specifierNegative zero coercion (z) not allowed in string format specifierAlternate form (#) not allowed in string format specifier'=' alignment not allowed in string format specifierbad operand type for abs(): '%.200s'%s(...)%s()%s({%U}){%U}[][...]divmoddivmod()removeprefixconfiguration names must be strings or integersunrecognized configuration namePyCapsule_Import could not import module "%s"PyCapsule_Import "%s" is not validInitialization arguments are not supportedthread.local.%pCouldn't get thread-state dictionaryargument 'co_code'argument 'co_consts'argument 'co_names'argument 'co_varnames'argument 'co_freevars'argument 'co_cellvars'argument 'co_filename'argument 'co_name'argument 'co_qualname'argument 'co_linetable'argument 'co_exceptiontable'co_argcount must be a positive integerco_posonlyargcount must be a positive integerco_kwonlyargcount must be a positive integerco_nlocals must be a positive integerco_stacksize must be a positive integerco_flags must be a positive integerco_firstlineno must be a positive integerOOOiiiiiicode.__new__code: LOAD_FAST_AND_CLEAR oparg %d out of rangecode: co_nlocals != len(co_varnames)__code__ must be set to a code object%U() requires a code object with %zd free vars, not %zdPython import machinery not initializedmodule %s does not support loading in subinterpretersinterpreter has no modules dictionaryargument list must be a tuplecontext variable name must be a str|$O:NameErrorUSEDEF_GLOBALDEF_NONLOCALDEF_LOCALDEF_PARAMDEF_FREEDEF_FREE_CLASSDEF_IMPORTDEF_BOUNDDEF_ANNOTTYPE_FUNCTIONTYPE_CLASSTYPE_MODULETYPE_ANNOTATIONTYPE_TYPE_VAR_BOUNDTYPE_TYPE_ALIASTYPE_TYPE_PARAMLOCALGLOBAL_EXPLICITGLOBAL_IMPLICITFREECELLSCOPE_OFFSCOPE_MASKmodule definition is NULLPyState_AddModule called on module with slotsmodule %p already addedclock_gettime(CLOCK_MONOTONIC)the tracemalloc module has been unloadedcannot allocate lockonly classes may be registeredmissing 'getdata' funccould not register None for cross-interpreter sharingcould not register int for cross-interpreter sharingcould not register bytes for cross-interpreter sharingcould not register str for cross-interpreter sharingFound non-str '%s' in skip_file_prefixes.'registry' must be a dict or None_warnings.filters must be a list_warnings.filters item %zd isn't a 5-tupleaction must be a string, not '%.200s'_warnings.defaultaction must be a string, not '%.200s'alwaysonce_warnings.onceregistry must be a dict, not '%.200s'Unrecognized action (%R) in warnings.filters: %R:%d: lost sys.stderr warnings._showwarnmsg() must be set to a callableunable to get warnings.WarningMessagegarbagecallbacksDEBUG_STATSDEBUG_COLLECTABLEDEBUG_UNCOLLECTABLEDEBUG_SAVEALLDEBUG_LEAKlegacy UCS2legacy asciilegacy latin1legacy UCS4UCS2UCS4CP_UTF8Try `python -h' for more information. xb+xbab+abrb+debugpymallocpymalloc_debugmallocmalloc_debug%d %ss * %zd bytes each%48s free %d-sized PyTupleObjectfree PyDictObjectfree PyListObjectfree PyFloatObjectSmall block threshold = %d, in %u size classes. class size num pools blocks in use avail blocks ----- ---- --------- ------------- ------------ %5u %6u %11zu %15zu %13zu # arenas allocated total# arenas reclaimed# arenas highwater mark# arenas allocated current%zu arenas * %d bytes/arena# bytes in allocated blocks# bytes in available blocks%u unused pools * %d bytes# bytes lost to pool headers# bytes lost to quantization# bytes lost to arena alignmentTotal arena map counts # arena map mid nodes# arena map bot nodes# bytes lost to arena map root# bytes lost to arena map mid# bytes lost to arena map botError setting LC_CTYPE, skipping C locale coercion /tmp/perf-%jd.mapinfinitynanInfinityNaN\x\u\U...Stack (most recent call first): ... File ", line in tstate is freedunable to get the interpreter stateinterp is freedunable to get the thread head state... Current thread 0xThread 0x (most recent call first): Garbage-collecting input line too longcan't re-enter readline~tracebacklimit File "%U", line %d, in %U | Exception Group Traceback (most recent call last): + TypeError: print_exception(): Exception expected for value, found Ignored error getting __notes__: %R File "%S", line %zd .: . Did you mean: %R?self.%U. Did you forget to import %R?. Did you mean: %R? Or did you forget to import %R?<__notes__ repr() failed>+- in print_exception_recursive... (max_group_depth is %d) %s+---------------- %zd ---------------- %s+---------------- ... ---------------- in print_exception_groupand %zd more exception%s +------------------------------------ Fatal Python error: Python runtime state: finalizing (tstate=0xcore initializedpreinitializedpreinitializingunknownin new thread_PyThreadState_Init() is for internal use onlywrong thread statedeallocating Python memory allocator called without holding the GIL%s: bug likely caused by a refcount error in a C extensionauto-releasing thread-state, but no thread-state for this threadthread state %p must be current when releasingNULL object address : %p object refcount : %zd object type : %p object type name: %s object repr : %s:%d: %s: Assertion "%s" failedAssertion failed_PyObject_AssertFailedmust be real number, not %.50s%.50s.__float__ returned non-float (type %.50s)%.50s.__float__ returned non-float (type %.50s). The ability to return an instance of a strict subclass of float is deprecated, and may be removed in a future version of Python.i|ii:set_thresholdUn;decoding error handler must return (str, int) tupleOn;encoding error handler must return (str/bytes, int) tuple in __issubclass__maximum recursion depth exceeded while normalizing an exceptionCannot recover from MemoryErrors while normalizing exceptions.Cannot recover from the recursive normalization of an exception.Exception ignored on building sys.unraisablehook argumentsException ignored in audit hookException ignored in sys.unraisablehookException ignored %ssys.unraisablehook%s %s%3d %.2d:%.2d:%.2d %dlockedunlocked<%s %s object owner=%ld count=%lu at %p><%s %s object at %p>%s(%R)%s(%R, %zd)%s(%zd, %R)%c%U%U.kwargs%R.kwargs%U.args%R.args, <%s object>>, NULL>slice(%R, %R, %R)PyDict_EVENT_ADDEDPyDict_EVENT_MODIFIEDPyDict_EVENT_DELETEDPyDict_EVENT_CLONEDPyDict_EVENT_DEALLOCATEDPyDict_EVENT_CLEARED%s watcher callback for %ld%s(%ld)PyFunction_EVENT_CREATEPyFunction_EVENT_DESTROYPyFunction_EVENT_MODIFY_CODEPyFunction_EVENT_MODIFY_DEFAULTSPyFunction_EVENT_MODIFY_KWDEFAULTS%s%Rmappingproxy(%R)cannot pickle '%.100s' instancesunable to raise a stack overflow (allocated %zu bytes on the stack, %zu recursive calls)Unknown format code '%c' for object of type '%.200s'Unknown format code '\x%x' for object of type '%.200s'can't delete tb_next attributeexpected traceback object, got '%s'traceback loop detectedinvalid tool %d (must be between 0 and 5)%s() expects an error PyStatus%s: %s%.200s() %.200s must be %.50s, not %.50sis_notis_a ContextVar key was expected, got %Rempty %s on %sidentifier field can't represent '%s' constantcan't capture name '_' in patternsInvalid type watcher ID %dNo type watcher set for ID %dexpected PickleBuffer, %.200s foundunhashable type: '%.200s'index out of bounds on dimension %dInvalid dict watcher ID %dNo dict watcher set for ID %dinvalid func watcher ID %dno func watcher set for ID %dname must be str, not %svariable %R does not exist%.200s attribute not set%.200s attribute must be unicodereason'%S' is an invalid keyword argument for enumerate()'|=' is not supported by %s; use '|' insteadInvalid code watcher ID %dNo code watcher set for ID %dbytes-like objectread-only bytes-like object'%.200s' object is not an async iterableaiter() returned not an async iterator of type '%.100s'attributesubscriptstarredlambdafunction callgenerator expressionlist comprehensionset comprehensiondict comprehensiondict literalset displayf-string expressionellipsiscomparisonconditional expressionunexpected expression in assignment %d (line %d)%.200s attribute must be bytes**=ipowpowdon't know how to handle %.200s in error callbackthis __dict__ descriptor does not support '%.200s' objects%s:%d: bad argument to internal function%.200s() takes no positional arguments%S (%zd sub-exception%s) Extension modules: (total: Fatal Python error from unexpected signum: Objects/methodobject.cexpected tuple for closure, got '%.100s'Cannot recover from stack overflow.maximum recursion depth exceeded%sCannot recover from Python stack overflow.maximum recursion depth exceeded%S()%S.%S()%U argument after ** must be a mapping, not %.200s%U got multiple values for keyword argument '%S'%s assignment: '%s' deallocator differs from '%s'%s assignment: '%s' object layout differs from '%s'gteqbad argument to internal functionbad argument type for built-in operationmonth out of rangeday of month out of rangehour out of rangeminute out of rangeseconds out of rangeday of week out of rangeday of year out of rangefailed to reinitialize lock at forkdetach() takes no argumentsdetachfileno() takes no argumentsfilenocan't delete attributecan't set attributedeque mutated during iterationdeque index out of rangepop from an empty dequefd is greater than maximumfd is less than minimumis_junction() takes no argumentssignal %i cannot be registered, use enable() insteadsignal number out of rangei:unregisterunable to get the current thread statetimestamp out of range for platform time_tno interpreter providedfailed to create init interpreter ID mutex%.200s() argument %zd, item %d %.256sTokens can only be created by ContextVarsan instance of Context was expectedcannot enter context: %R is already enteredcannot exit context: %R has not been enteredcannot exit context: thread state references a different context objectan instance of ContextVar was expectedPyUnicode_GetSize has been removed.character out of rangefill character is bigger than the string maximum characterCannot subclass an instance of TypeVarTupleCannot subclass an instance of ParamSpecCannot subclass an instance of ParamSpecKwargsCannot subclass an instance of ParamSpecArgsCannot subclass an instance of TypeVarThis object has no __weakref____get__(None, None) is invalidno more type watcher IDs availableCannot watch non-type|O!O:supertuple assignment index out of rangeEllipsisType takes no argumentsoperation forbidden on released PickleBuffer objectNotImplementedType takes no argumentsNoneType takes no arguments'%.200s' object is not callable. Did you mean: '%U.%U(...)'?'%.200s' object is not callablememoryview has %zd exported buffer%smemoryview: negative export countmemoryview assignment: lvalue and rvalue have different structuresOrderedDict mutated during iterationCannot watch non-dictionaryno more dict watcher IDs availableTuple or struct_time argument requiredyear out of range%s(%zd)%s(%R, %R)must have a sched_param objectsched_priority out of rangeinvalid integer value: %Rtry sending as bytescannot delete attributea strictly positive integer is requiredrange(%R, %R)range(%R, %R, %R)cannot index %zd-dimension view with %zd-element tupleuid should be integer, not %.200suid is less than minimumuid is greater than maximumgid should be integer, not %.200sgid is less than minimumgid is greater than maximumInvalid value NaN (not a number)expect int, got %sinterpreter ID must be an int, got %.100sinterpreter ID must be a non-negative int, got %RPython int too large for C unsigned shortPython int too large for C unsigned inthuge integer: number of bits overflows a Py_ssize_tint too large to convert to floatinvalid module indexInterpreters module-list not accessible.Module index out of bounds.no more func watcher IDs availablenon-tuple default argsnon-dict keyword only default argsnon-dict annotationsfloat too large to pack with e formatmemoryview: invalid type for format '%s'memoryview: invalid value for format '%s'float too large to pack with f format__await__() returned a coroutine__await__() returned non-iterator of type '%.100s'object %.100s can't be used in 'await' expressionissubclass() argument 2 cannot be a parameterized genericisinstance() argument 2 cannot be a parameterized genericexpected a function, exception type or tuple of exception typescharacters_written__cause__ may not be deletedexception cause must be None or derive from BaseException__context__ may not be deletedexception context must be None or derive from BaseException_PyErr_ChainExceptions: exception %R is not a BaseException subclassno more code watcher IDs availableCell is emptyPyCapsule_GetName called with invalid PyCapsule objectPyCapsule_GetDestructor called with invalid PyCapsule objectPyCapsule_GetContext called with invalid PyCapsule objectPyCapsule_SetName called with invalid PyCapsule objectPyCapsule_SetDestructor called with invalid PyCapsule objectPyCapsule_SetContext called with invalid PyCapsule objectPyCapsule_SetPointer called with null pointerPyCapsule_SetPointer called with invalid PyCapsule objectParser stack overflowed - Python source too complex to parse_compare_digestcomparing strings with non-ASCII characters is not supportedunsupported operand types(s) or combination of types: '%.100s' and '%.100s'Buffer must be single dimensionswitch interval must be strictly positiveuse_tool_idtool name must be a strtool %d is already in useThe fill character must be a unicode character, not %.100sThe fill character must be exactly one character longnon-NULL old thread state|i:_sigsegvcloserange(kk):_acquire_restorecouldn't acquire lockEnable tracemalloc to get the memory block allocation traceback Memory block allocated at (most recent call first): File "", line Debug memory block at address p=%p: API '%c' %zu bytes originally requested The %d pad bytes at p-%d are FORBIDDENBYTE, as expected. not all FORBIDDENBYTE (0x%02x): at p-%d: 0x%02x *** OUCH Because memory is corrupted at the start, the count of bytes requested may be bogus, and checking the trailing pad bytes may segfault. The %d pad bytes at tail=%p are at tail+%d: 0x%02x Data at p: %02x ...tracemalloc_realloc() failed to allocate a trace%lx %x %s py::%s:%sCouldn't create thread-state for new threadunrecognized interpreter ID %lld|i:signumcannot decode stringout of memoryPyImport_ExtendInittab() may not be called after Py_Initialize()PyImport_AppendInittab() may not be called after Py_Initialize()Out of memory and PyExc_MemoryError is not initialized yetmaximum recursion limit exceededinternal error in regular expression enginenew buffer size too largedeque.rotate%R is not in dequeunable to start the threadPython/pystrtod.c%+.02dcomplex() arg is a malformed stringcould not convert string to %s: %Rfield 'returns' is required for FunctionTypefield 'target' is required for AsyncForfield 'iter' is required for AsyncForfield 'tag' is required for TypeIgnoretool %d is not in useset_eventsinvalid event set 0x%xcannot set C_RETURN or C_RAISE events independentlyset_local_eventscode must be a code objectinvalid local event set 0x%xcannot instrument shim code object '%U'expected a 6-tuplelabel out of rangestring is longer than the bufferpadded string is too longrjustljustcenterremovesuffixargument must be str, not %.50sargument must be str or None, not %.50sUUnew position too large> ^ & // ** not lambda == != < <= > >= is is not not in .unknown binary operatorunknown unary operator, /** if else [(yield)(yield (yield from await unexpected comparison kind := unknown expression kind1e%d async for for \Uxxxxxxxx out of rangerawunicodeescapeutf-16-leutf-16-betruncated dataillegal encodingillegal UTF-16 surrogateutf-32-leutf-32-becode point in surrogate code point range(0xd800, 0xe000)code point not in range(0x110000)expected str, got %scannot hash writable memoryview objectmemoryview: hashing is restricted to formats 'B', 'b' or 'c'<%U.%U object at %p>len() of unsized objectget_local_eventsstrcoll_imp._override_multi_interp_extensions_check() cannot be used in the main interpretermakedevPython int too large to convert to C unsigned int in collect_exception_group_leaf_ids|n:stack_sizesize must be 0 or a positive valuesize not valid: %zd bytessetting stack size not supportedstring argument expected, got '%s'Invalid whence (%i, should be 0, 1 or 2)Negative seek position %zdCan't do nonzero cur-relative seekstruncateNegative size value %zdnegative seek value %zdinvalid whence (%i, should be 0, 1 or 2)ixoriandilshift>>=irshiftisub@=imatmul//=ifloordiv/=itruediv%=imodiadd*=imulor_xorrshiftsub%.200s.__divmod__() must return a 2-tuple, not %.200s@matmulfloordivtruedivaddmulrange object index out of rangeand_lshiftiorinteger modulo by zero-0x0.0p+00x0.0p+0-0x%sp%c%d0x%sp%c%dfloat floor division by zerofloat modulofloat division by zerocould not convert string to float: %Riiiiiiiii;mktime(): illegal time tuple argumentmktime argument out of rangeinteger division result too large for a floatabsolute value too large__round__%s0%se%drounded value too large to represent%s%s%sj%scomplex modulo0.0 to a negative or complex powercomplex exponentiationcomplex division by zero(bbytearray object is too large to make repr value not found in bytearraycannot add more objects to bytearrayboth destination and source must be bytes-like objectsdestination is too small to receive data from sourceitemgetter_grouperO!|nContext() does not accept any argumentsObjects/memoryobject.cmulti-dimensional sub-views are not implementedcannot delete __dict____dict__ must be set to a dictionary, not a '%.200s'starmapfilterfalsedropwhiletakewhilepairwisechaincycleisliceStop argument for islice() must be None or an integer: 0 <= x <= sys.maxsize.Indices for islice() must be None or an integer: 0 <= x <= sys.maxsize.Step for islice() must be a positive integer or None.got an invalid type in Constant: %sAST node line range (%d, %d) is not validAST node column range (%d, %d) for line range (%d, %d) is not validline %d, column %d-%d is not a valid rangeexpression which can't be assigned to in %s contextexpression must have %s context but has %s insteadBoolOp with less than 2 valuesDict doesn't have the same number of keys as valuesCompare with no comparatorsCompare has a different number of comparators and operandsNamedExpr target must be a Nameunexpected expressionNone disallowed in expression listunexpected constant inside of a literal patternMatchSingleton can only contain True, False and NoneMatchMapping doesn't have the same number of keys as patternsMatchClass doesn't have the same number of keyword attributes as patternsMatchClass cls field can only contain Name or Attribute nodes.can't use MatchStar hereMatchAs must specify a target name if a pattern is givenMatchOr requires at least 2 patternsunexpected patternmore positional defaults than args on argumentslength of kwonlyargs is not the same as kw_defaults on argumentsAnnAssign with simple non-Name targetTypeAlias with non-Name nameRaise with cause but no exceptionTry has neither except handlers nor finalbodyTry has orelse but no except handlersTryStar has neither except handlers nor finalbodyTryStar has orelse but no except handlersNegative ImportFrom levelunexpected statementNone disallowed in statement listcomprehension with no generatorsimpossible module nodeAST validator recursion depth mismatch (before=%d, after=%d)anext'%.200s' object is not an async iteratorfirst argument must be callableinstance must not be Noneinstancemethodcell<%s object; span=(%zd, %zd), match=%.50R>bytesiobuf_getbuffer: view==NULL argument is obsoleteinteger argument expected, got '%s'stack to deep to analyzecan't jump from unreachable codecan't jump into an exception handler, or code may be unreachablestack is too deep to analyzecan't jump into the body of a for loopincompatible stackscan't jump into a re-raising block as there's no locationcan't jump into an 'except' block as there's no exceptioncannot find bytecode for specified linelineno must be an integerf_lineno can only be set in a trace functioncan't jump from the 'call' trace event of a new framecan't jump during a callcan only jump from a 'line' trace eventunexpected event typelineno out of rangeline %d comes before the current code blockline %d comes after the current code blockassigning None to %d unbound local%smaketrans arguments must have same lengthencoded result is too long for a Python string&#%d;PyNumber_ToBase: base must be 2, 8, 10 or 16precision too largestring too large in _PyUnicode_FormatLongnon-hexadecimal number found in fromhex() arg at position %zdinvalid octal escape sequence '\%.3s'PyBytes_FromFormatV(): %c format expects an integer in range [0; 255]%lu%zu%u%xnegative size value %zdABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Py_FileSystemDefaultEncodingPy_HasFileSystemDefaultEncodingPy_FileSystemDefaultEncodeErrors_Py_HasFileSystemDefaultEncodeErrorsPy_UTF8ModePy_DebugFlagPy_VerboseFlagPy_QuietFlagPy_InteractiveFlagPy_InspectFlagPy_OptimizeFlagPy_NoSiteFlagPy_BytesWarningFlagPy_FrozenFlagPy_IgnoreEnvironmentFlagPy_DontWriteBytecodeFlagPy_NoUserSiteDirectoryPy_UnbufferedStdioFlagPy_HashRandomizationFlagPy_IsolatedFlagglobal_configconfigure_localecoerce_c_localecoerce_c_locale_warnutf8_modeallocatorpre_configcharmap_buildCannot create a consistent method resolution order (MRO) for basesmatch() takes no argumentsattrgetterattribute name must be a stringspanzip_longest() got an unexpected keyword argumentO(O)(OOOO)kk(O(nO))O(On)iinntb_linenotb_lastitb_nexttb_frame[ssss](OOO)(Nn)(Cn)O(OO)O(OOO)length should not be negative(NNN)(O(OOO))(N)(d)float divmod()(dd)O(O)nO(())(O&O&O&O&)iiO&Unknown signalcollections{snsnsn}(iii) sss(y#)Load averages are unobtainabledddpopitem(): dictionary is emptynon-integer arguments in divisionOiOname tuples must contain only strings, not '%.500s'rpartitionpartitionGenericAliasOnly generic type aliases are subscriptablemethodcaller needs at least one argument, the method namemethod name must be a stringsys.addaudithooksys.set_asyncgen_hook_finalizersys.set_asyncgen_hook_firstitersys.settracesys.setprofilesys._current_exceptionsfirst arg must be callable2nd arg must be a tupleoptional 3rd arg must be a dictionaryOOO_thread.start_new_threadthread is not supported for isolated subinterpreterscan't create new thread at interpreter shutdowncan't start new threadgc.get_referentsgc.get_referrers__qualname__can only assign string to %s.__qualname__, not '%s'__type_params__can't delete __class__ attribute__class__ must be set to a class, not '%s' object__class__ assignment only supported for mutable types or ModuleType subclasses__kwdefaults____kwdefaults__ must be set to a dict objectf_codesetopencodehookfailed to change existing open_code hookag_codecr_codegi_coderegister_callbackThe callback can only be set for one event at a timeinvalid event %dsys.monitoring.register_callbackCannot disable %s events. Callback removed.__complex__ returned non-complex (type %.200s)__complex__ returned non-complex (type %.200s). The ability to return an instance of a strict subclass of complex is deprecated, and may be removed in a future version of Python.fileno() returned a non-integerargument must be an int, or have a fileno() method.file descriptor cannot be a negative integer (%i)failed releasing import lock after forkother argument must be K instancecalllost sys.breakpointhookbuiltins.breakpointobject %.50s does not have __anext__ methodobject %.50s does not have __aiter__ methodobject %.50s does not have __await__ method__bool__ should return bool, returned %smemoryview: internal error in richcomparefromhexgetbuffer() takes no argumentscannot extract raw buffer from non-contiguous bufferunderlying buffer is not writablewritable contiguous buffer requested for a non-contiguous object.buffer flags too largeag_framecr_framegi_frameMissing frame when calling trace function.Missing frame when calling profile function.sys._current_framescannot convert Infinity to integer ratiocannot convert NaN to integer ratioO(O)AST identifier must be of type strrequired field "name" missing from alias while traversing 'alias' noderequired field "lineno" missing from aliasrequired field "col_offset" missing from aliasAST string must be of type strweakly-referenced object no longer existsWeakref proxy referenced a non-iterator '%.200s' object__await__ returned a non-iterableType %.100s doesn't define __sizeof____sizeof__() should return >= 0invalid intrinsic functionlost sys.displayhookPyState_RemoveModule called on module with slotsrun() missing 1 required positional argumentslice indices must be integers or have an __index__ method%R is not in listnull argument to internal routineOnnsnnOnnnnncall_tracingin thread started byreducereduce() arg 2 must support iterationreduce() of empty iterable with no initial value'%.200s' object does not support vectorcall%S does not support cross-interpreter datamissing interpmissing new_object funcexpected a writable bytes-like objectbad operand type for unary +: '%.200s'concat'%.200s' object can't be repeatediconcatmust be %d-item sequence, not %.50smust be sequence of length %d, not %zdis not retrievableO:K|OOcallable finalizer expected, got %.50scallable firstiter expected, got %.50sO|O:getsizeofO|$O:ContextVarO|n:repeatO:PickleBuffersetitemneed more than 0 values to unpackneed more than 1 value to unpacktoo many values to unpack (expected 2)delitem'%.200s' object doesn't support slice assignment'%.200s' object doesn't support slice deletionlength_hintsep must be length 1.sep must be ASCII.sep must be str or bytes.argument of type '%.200s' is not iterablecount exceeds C integer sizeindex exceeds C integer sizesequence.index(x): x not in sequenceindexOfcountOfcontains'%S' is an invalid keyword argument for %.200s%sn must be at least onenewline must be str or None, not %.200sillegal newline value: %Rinitial_value must be str or None, not %.200sprocess stopped by delivery of signal %iinvalid wait status: %iargument 'tb_frame'TracebackTypeexpected traceback object or None, got '%s'maxdigits must be 0 or larger than %ddepth must be >= 0argument 'source'source_hashnew string is too longtypealiastype_params must be a tupleSubstitution of bare TypeVarTuple is not supportedargument 'globals'arg 3 (name) must be None or stringarg 4 (defaults) must be None or tuplearg 5 (closure) must be tuplearg 5 (closure) must be None or tuple%U requires closure of length %zd, not %zdarg 5 (closure) expected cell, found %sfunction.__new__result too long%R is not in rangeargs may not be deletedargument 7argument 8argument 9argument 10argument 11argument 12argument 13argument 15argument 16argument 17argument 18code: argcount must not be negativecode: posonlyargcount must not be negativecode: kwonlyargcount must not be negativecode: nlocals must not be negativeinvalid generationgc.get_objectsgeneration parameter must be less than the number of available generations (%i)generation parameter cannot be negative_getframecall stack is not deep enoughsys._getframerecursion limit must be greater or equal than 1cannot set the recursion limit to %i at the recursion depth %i: the limit is too lowcannot modify read-only memorycannot delete memorymemoryview slice assignments are currently restricted to ndim = 1no mem for sys.argvcan't assign sys.argvcan't compute path0 from argvcan't prepend path0 to sys.pathcan't create sys.pathcan't assign sys.pathcannot set '__annotations__' attribute of immutable type '%s'typevartuplecannot access free variable '%s' where it is not associated with a value in enclosing scopeO()NO()%.400s constructor takes at most %zd positional argument%s%.400s got multiple values for argument '%U'note must be a str, not '%s'Cannot add note: __notes__ is not a listexc must be an exception, not '%s'state is not a dictionarypdb.set_tracePYTHONBREAKPOINTIgnoring unimportable $PYTHONBREAKPOINT: "%s"_make_union_typevartuple_prepare_subst_paramspec_prepare_subst_paramspec_subst_typevar_substparamspec_module_reprsplitmethodcallerNNNKthe BufferedRWPair object is being garbage-collected_strptime_time_strptime_compile_templatethe result of compiling a replacement string is %.200sStructstructunpack_fromisisssOcalcsizeeast_asian_width%s() got multiple sub-patterns for attribute %R.__name__ is not a unicode object.__objclass__.__qualname__ is not a unicode objectstate argument must be a tupleOK;setstate(): illegal state argument((OK))readinto1peek() should have returned a bytes object, not '%.200s'read() should have returned a bytes object, not '%.200s'file.read() returned not bytes but %.100s_count_elementsexitan instance of Token was expected%R has already been used once%R was created by a different ContextVar%R was created in a different Contextexpected an instance of Token, got %R(On)codec must pass exception instanceordinal not in range(256)reentrant call inside %Rcould not acquire lock for %s at interpreter shutdown, possibly due to daemon threadsfailed to get LC_CTYPE localeZero padding is not allowed in complex format specifier'=' alignment flag is not allowed in complex format specifieri:clock_getresi:clock_gettimeclock_gettime(CLOCK_THREAD_CPUTIME_ID)clock_gettime(CLOCK_PROCESS_CPUTIME_ID)getrusage(RUSAGE_SELF)_SC_CLK_TCK%s is too largetimes()clock()the processor time used is not available or its value cannot be representedk:pthread_getcpuclockidiO:clock_settimewhen trying to write to the signal wakeup fdsetitimersignal only works in main thread of the main interpretersignal handler must be signal.SIG_IGN, signal.SIG_DFL, or a callable object(i)os.chdirsetgroups argument must be a sequencetoo many groupsgroups must be integerssignal number %ld out of range [1; %i]invalid signal number %ld, please use valid_signals()sigtimedwaittimeout must be non-negativeset_inheritablei|$p:set_wakeup_fdset_wakeup_fd only works in main thread of the main interpreterthe fd %i must be in non-blocking modeset_blockingthe number of frames must be in range [1; %lu]U|O:strftimeiiiiiiiii;strftime(): illegal time tuple argument|O:ctimeasctimeiiiiiiiii;asctime(): illegal time tuple argumentpow() 3rd argument not allowed unless all arguments are integers0.0 cannot be raised to a negative powerstrxfrmsiginterruptpidfd_send_signalsiginfo must be None(ii)setreuidsetregidresourceNiNlockfiiLos.lockflseekfpathconfsetresuidsetresgidsleep length must be non-negativeos.removeunsupported langinfo constantstrerror() argument out of range|O:gmtime|O:localtime__bases__can only assign tuple to %s.__bases__, not %scan only assign non-empty tuple to %s.__bases__, not ()%s.__bases__ must be tuple of classes, not '%s'a __bases__ item causes an inheritance cycle__buffer__ returned non-memoryview objectdictionary is emptyOrderedDict changed size during iterationclosethrowsendwrite could not complete without blockingisn_abc_instancecheckreconfigure() argument 'encoding' must be str or None, not %sreconfigure() argument 'errors' must be str or None, not %sreconfigure() argument 'newline' must be str or None, not %sIt is not possible to set the encoding or newline of stream after the first readtruncate of closed filepeekpeek of closed filereadinto of closed fileBufferedRWPairOnunable to get sys.stderrsys.stderr is Nonefile is not a valid file descriptorfile.fileno() is not a valid file descriptori|Opp:register|Op:enableO|iOi:dump_traceback_latertimeout must be greater than 0Timeout (%lu:%02lu:%02lu.%06u)! Timeout (%lu:%02lu:%02lu)! unable to start watchdog thread|Op:dump_traceback... truncated\'%c\x%02x\u%04xexpected a memoryview objectmemoryview's buffer is not this objectmemoryview's buffer has already been releasedObjects/fileobject.cobject.readline() returned non-stringEOF when reading a line((yi))underlying stream is not seekabletelling position disabled by next() calliOOi;illegal decoder statecan't reconstruct logical file position%s with '%s' codec failedencoder must return a tuple (object, integer)codecs.encode()decodingdecoder must return a tuple (object,integer)codecs.decode()getpwuid(): uid not foundgetpwuid(): uid not found: %SisisOOOunable to determine login name(O(OiiNii)) [Previous line repeated %ld more times] [Previous line repeated %ld more time] Exception ignored in: : sys.unraisablehook argument type must be UnraisableHookArgs[Errno %S] %S: %R -> %R[Errno %S] %S: %R[Errno %S] %Scan't translate character '\x%02x' in position %zd: %Ucan't translate character '\u%04x' in position %zd: %Ucan't translate character '\U%08x' in position %zd: %Ucan't translate characters in position %zd-%zd: %U'%U' codec can't decode byte 0x%02x in position %zd: %U'%U' codec can't decode bytes in position %zd-%zd: %U'%U' codec can't encode character '\x%02x' in position %zd: %U'%U' codec can't encode character '\u%04x' in position %zd: %U'%U' codec can't encode character '\U%08x' in position %zd: %U'%U' codec can't encode characters in position %zd-%zd: %U%S (%U, line %ld)%S (%U)%S (line %ld)format(OiiO)pthread_sigmaskpthread_killkisignal.pthread_killiiios.chmodiIIios.chownnegative value for 'count' not allowedNireadvreadv() arg 2 must be a sequencepreadpreadvpreadv2() arg 2 must be a sequencewritevwritev() arg 2 must be a sequencepwritepwritevpwritev() arg 2 must be a sequenceos.truncateftruncateposix_fallocateposix_fadviseFailed to create new mmap for perf trampolineFailed to set mmap for perf trampoline to PROT_READ | PROT_EXECFailed to allocate new code arena structTrampoline cannot be initialized as a custom eval frame is already presentin PyEval_SetProfilein PyEval_SetProfileAllThreadsin PyEval_SetTracein PyEval_SetTraceAllThreadscalled match pattern must be a class%s.__match_args__ must be a tuple (got %s)%s() accepts %d positional sub-pattern%s (%d given)__match_args__ elements must be strings (got %s)expected some sort of expr_context, but got %Rexpected some sort of operator, but got %Rexpected some sort of cmpop, but got %Rrequired field "lineno" missing from expr while traversing 'expr' noderequired field "col_offset" missing from exprrequired field "op" missing from BoolOp while traversing 'BoolOp' nodeexpected some sort of boolop, but got %RBoolOp field "values" must be a list, not a %.200sBoolOp field "values" changed size during iterationrequired field "target" missing from NamedExpr while traversing 'NamedExpr' noderequired field "value" missing from NamedExprrequired field "left" missing from BinOp while traversing 'BinOp' noderequired field "op" missing from BinOprequired field "right" missing from BinOprequired field "op" missing from UnaryOp while traversing 'UnaryOp' nodeexpected some sort of unaryop, but got %Rrequired field "operand" missing from UnaryOprequired field "args" missing from Lambda while traversing 'Lambda' noderequired field "body" missing from Lambdarequired field "test" missing from IfExp while traversing 'IfExp' noderequired field "body" missing from IfExprequired field "orelse" missing from IfExpDict field "keys" must be a list, not a %.200s while traversing 'Dict' nodeDict field "keys" changed size during iterationDict field "values" must be a list, not a %.200sDict field "values" changed size during iterationSet field "elts" must be a list, not a %.200s while traversing 'Set' nodeSet field "elts" changed size during iterationrequired field "elt" missing from ListComp while traversing 'ListComp' nodeListComp field "generators" must be a list, not a %.200sListComp field "generators" changed size during iterationrequired field "elt" missing from SetComp while traversing 'SetComp' nodeSetComp field "generators" must be a list, not a %.200sSetComp field "generators" changed size during iterationrequired field "key" missing from DictComp while traversing 'DictComp' noderequired field "value" missing from DictCompDictComp field "generators" must be a list, not a %.200sDictComp field "generators" changed size during iterationrequired field "elt" missing from GeneratorExp while traversing 'GeneratorExp' nodeGeneratorExp field "generators" must be a list, not a %.200sGeneratorExp field "generators" changed size during iterationrequired field "value" missing from Await while traversing 'Await' node while traversing 'Yield' noderequired field "value" missing from YieldFrom while traversing 'YieldFrom' noderequired field "left" missing from Compare while traversing 'Compare' nodeCompare field "ops" must be a list, not a %.200sCompare field "ops" changed size during iterationCompare field "comparators" must be a list, not a %.200sCompare field "comparators" changed size during iterationrequired field "func" missing from Call while traversing 'Call' nodeCall field "args" must be a list, not a %.200sCall field "args" changed size during iterationCall field "keywords" must be a list, not a %.200sCall field "keywords" changed size during iterationrequired field "value" missing from FormattedValue while traversing 'FormattedValue' noderequired field "conversion" missing from FormattedValueJoinedStr field "values" must be a list, not a %.200s while traversing 'JoinedStr' nodeJoinedStr field "values" changed size during iterationrequired field "value" missing from Constant while traversing 'Constant' noderequired field "value" missing from Attribute while traversing 'Attribute' noderequired field "attr" missing from Attributerequired field "ctx" missing from Attributerequired field "value" missing from Subscript while traversing 'Subscript' noderequired field "slice" missing from Subscriptrequired field "ctx" missing from Subscriptrequired field "value" missing from Starred while traversing 'Starred' noderequired field "ctx" missing from Starredrequired field "id" missing from Name while traversing 'Name' noderequired field "ctx" missing from NameList field "elts" must be a list, not a %.200s while traversing 'List' nodeList field "elts" changed size during iterationrequired field "ctx" missing from ListTuple field "elts" must be a list, not a %.200s while traversing 'Tuple' nodeTuple field "elts" changed size during iterationrequired field "ctx" missing from Tuple while traversing 'Slice' nodeexpected some sort of expr, but got %R while traversing 'keyword' noderequired field "value" missing from keywordrequired field "lineno" missing from keywordrequired field "col_offset" missing from keywordrequired field "arg" missing from arg while traversing 'arg' noderequired field "lineno" missing from argrequired field "col_offset" missing from argarguments field "posonlyargs" must be a list, not a %.200s while traversing 'arguments' nodearguments field "posonlyargs" changed size during iterationarguments field "args" must be a list, not a %.200sarguments field "args" changed size during iterationarguments field "kwonlyargs" must be a list, not a %.200sarguments field "kwonlyargs" changed size during iterationarguments field "kw_defaults" must be a list, not a %.200sarguments field "kw_defaults" changed size during iterationarguments field "defaults" must be a list, not a %.200sarguments field "defaults" changed size during iterationrequired field "target" missing from comprehension while traversing 'comprehension' noderequired field "iter" missing from comprehensioncomprehension field "ifs" must be a list, not a %.200scomprehension field "ifs" changed size during iterationrequired field "is_async" missing from comprehensionrequired field "context_expr" missing from withitem while traversing 'withitem' noderequired field "lineno" missing from pattern while traversing 'pattern' noderequired field "col_offset" missing from patternrequired field "end_lineno" missing from patternrequired field "end_col_offset" missing from patternrequired field "value" missing from MatchValue while traversing 'MatchValue' noderequired field "value" missing from MatchSingleton while traversing 'MatchSingleton' nodeMatchSequence field "patterns" must be a list, not a %.200s while traversing 'MatchSequence' nodeMatchSequence field "patterns" changed size during iterationMatchMapping field "keys" must be a list, not a %.200s while traversing 'MatchMapping' nodeMatchMapping field "keys" changed size during iterationMatchMapping field "patterns" must be a list, not a %.200sMatchMapping field "patterns" changed size during iterationrequired field "cls" missing from MatchClass while traversing 'MatchClass' nodeMatchClass field "patterns" must be a list, not a %.200sMatchClass field "patterns" changed size during iterationMatchClass field "kwd_attrs" must be a list, not a %.200sMatchClass field "kwd_attrs" changed size during iterationMatchClass field "kwd_patterns" must be a list, not a %.200sMatchClass field "kwd_patterns" changed size during iteration while traversing 'MatchStar' node while traversing 'MatchAs' nodeMatchOr field "patterns" must be a list, not a %.200s while traversing 'MatchOr' nodeMatchOr field "patterns" changed size during iterationexpected some sort of pattern, but got %Rrequired field "lineno" missing from type_param while traversing 'type_param' noderequired field "col_offset" missing from type_paramrequired field "end_lineno" missing from type_paramrequired field "end_col_offset" missing from type_paramrequired field "name" missing from TypeVar while traversing 'TypeVar' noderequired field "name" missing from ParamSpec while traversing 'ParamSpec' noderequired field "name" missing from TypeVarTuple while traversing 'TypeVarTuple' nodeexpected some sort of type_param, but got %Rrequired field "lineno" missing from excepthandler while traversing 'excepthandler' noderequired field "col_offset" missing from excepthandler while traversing 'ExceptHandler' nodeExceptHandler field "body" must be a list, not a %.200sExceptHandler field "body" changed size during iterationexpected some sort of excepthandler, but got %Rrequired field "lineno" missing from stmt while traversing 'stmt' noderequired field "col_offset" missing from stmtrequired field "name" missing from FunctionDef while traversing 'FunctionDef' noderequired field "args" missing from FunctionDefFunctionDef field "body" must be a list, not a %.200sFunctionDef field "body" changed size during iterationFunctionDef field "decorator_list" must be a list, not a %.200sFunctionDef field "decorator_list" changed size during iterationFunctionDef field "type_params" must be a list, not a %.200sFunctionDef field "type_params" changed size during iterationrequired field "name" missing from AsyncFunctionDef while traversing 'AsyncFunctionDef' noderequired field "args" missing from AsyncFunctionDefAsyncFunctionDef field "body" must be a list, not a %.200sAsyncFunctionDef field "body" changed size during iterationAsyncFunctionDef field "decorator_list" must be a list, not a %.200sAsyncFunctionDef field "decorator_list" changed size during iterationAsyncFunctionDef field "type_params" must be a list, not a %.200sAsyncFunctionDef field "type_params" changed size during iterationrequired field "name" missing from ClassDef while traversing 'ClassDef' nodeClassDef field "bases" must be a list, not a %.200sClassDef field "bases" changed size during iterationClassDef field "keywords" must be a list, not a %.200sClassDef field "keywords" changed size during iterationClassDef field "body" must be a list, not a %.200sClassDef field "body" changed size during iterationClassDef field "decorator_list" must be a list, not a %.200sClassDef field "decorator_list" changed size during iterationClassDef field "type_params" must be a list, not a %.200sClassDef field "type_params" changed size during iteration while traversing 'Return' nodeDelete field "targets" must be a list, not a %.200s while traversing 'Delete' nodeDelete field "targets" changed size during iterationAssign field "targets" must be a list, not a %.200s while traversing 'Assign' nodeAssign field "targets" changed size during iterationrequired field "value" missing from Assignrequired field "name" missing from TypeAlias while traversing 'TypeAlias' nodeTypeAlias field "type_params" must be a list, not a %.200sTypeAlias field "type_params" changed size during iterationrequired field "value" missing from TypeAliasrequired field "target" missing from AugAssign while traversing 'AugAssign' noderequired field "op" missing from AugAssignrequired field "value" missing from AugAssignrequired field "target" missing from AnnAssign while traversing 'AnnAssign' noderequired field "annotation" missing from AnnAssignrequired field "simple" missing from AnnAssignrequired field "target" missing from For while traversing 'For' noderequired field "iter" missing from ForFor field "body" must be a list, not a %.200sFor field "body" changed size during iterationFor field "orelse" must be a list, not a %.200sFor field "orelse" changed size during iterationrequired field "target" missing from AsyncFor while traversing 'AsyncFor' noderequired field "iter" missing from AsyncForAsyncFor field "body" must be a list, not a %.200sAsyncFor field "body" changed size during iterationAsyncFor field "orelse" must be a list, not a %.200sAsyncFor field "orelse" changed size during iterationrequired field "test" missing from While while traversing 'While' nodeWhile field "body" must be a list, not a %.200sWhile field "body" changed size during iterationWhile field "orelse" must be a list, not a %.200sWhile field "orelse" changed size during iterationrequired field "test" missing from If while traversing 'If' nodeIf field "body" must be a list, not a %.200sIf field "body" changed size during iterationIf field "orelse" must be a list, not a %.200sIf field "orelse" changed size during iterationWith field "items" must be a list, not a %.200s while traversing 'With' nodeWith field "items" changed size during iterationWith field "body" must be a list, not a %.200sWith field "body" changed size during iterationAsyncWith field "items" must be a list, not a %.200s while traversing 'AsyncWith' nodeAsyncWith field "items" changed size during iterationAsyncWith field "body" must be a list, not a %.200sAsyncWith field "body" changed size during iterationrequired field "subject" missing from Match while traversing 'Match' nodeMatch field "cases" must be a list, not a %.200sMatch field "cases" changed size during iteration while traversing 'Raise' nodeTry field "body" must be a list, not a %.200s while traversing 'Try' nodeTry field "body" changed size during iterationTry field "handlers" must be a list, not a %.200sTry field "handlers" changed size during iterationTry field "orelse" must be a list, not a %.200sTry field "orelse" changed size during iterationTry field "finalbody" must be a list, not a %.200sTry field "finalbody" changed size during iterationTryStar field "body" must be a list, not a %.200s while traversing 'TryStar' nodeTryStar field "body" changed size during iterationTryStar field "handlers" must be a list, not a %.200sTryStar field "handlers" changed size during iterationTryStar field "orelse" must be a list, not a %.200sTryStar field "orelse" changed size during iterationTryStar field "finalbody" must be a list, not a %.200sTryStar field "finalbody" changed size during iterationrequired field "test" missing from Assert while traversing 'Assert' nodeImport field "names" must be a list, not a %.200s while traversing 'Import' nodeImport field "names" changed size during iteration while traversing 'ImportFrom' nodeImportFrom field "names" must be a list, not a %.200sImportFrom field "names" changed size during iterationGlobal field "names" must be a list, not a %.200s while traversing 'Global' nodeGlobal field "names" changed size during iterationNonlocal field "names" must be a list, not a %.200s while traversing 'Nonlocal' nodeNonlocal field "names" changed size during iterationrequired field "value" missing from Expr while traversing 'Expr' nodeexpected some sort of stmt, but got %Rrequired field "pattern" missing from match_case while traversing 'match_case' nodematch_case field "body" must be a list, not a %.200smatch_case field "body" changed size during iterationfield 'pattern' is required for match_caseinterpreter not initializedgetitem/proc/self/statThis process (pid=%d) is multi-threaded, use of %s() may lead to deadlocks in the child.N(O)nN(N)N(())N(N)ON(Os)N(OO)N(O)N(ON)character mapping must be in range(256)character mapping must return integer, bytes or None, not %.400scharmapUnpackupdate() takes at most 1 positional argument (%zd given)expected at most 1 arguments, got %zdexpected %s node, got %.400sModule field "body" must be a list, not a %.200s while traversing 'Module' nodeModule field "body" changed size during iterationModule field "type_ignores" must be a list, not a %.200srequired field "lineno" missing from TypeIgnore while traversing 'TypeIgnore' noderequired field "tag" missing from TypeIgnoreexpected some sort of type_ignore, but got %RModule field "type_ignores" changed size during iterationInteractive field "body" must be a list, not a %.200s while traversing 'Interactive' nodeInteractive field "body" changed size during iterationrequired field "body" missing from Expression while traversing 'Expression' nodeFunctionType field "argtypes" must be a list, not a %.200s while traversing 'FunctionType' nodeFunctionType field "argtypes" changed size during iterationrequired field "returns" missing from FunctionTypeexpected some sort of mod, but got %RInvalid UTF-8 sequencebind_textdomain_codesettextdomaindcgettextdgettextgettextsetlocaleunsupported locale settinglocale query failedreadbuffer_encodecharmap_decodecharmap_encodeascii_decodeascii_encodelatin_1_decodelatin_1_encoderaw_unicode_escape_decoderaw_unicode_escape_encodeunicode_escape_decodeunicode_escape_encodeutf_32_ex_decodeNniutf_32_be_decodeutf_32_le_decodeutf_32_decodeutf_16_ex_decodeutf_16_be_decodeutf_16_le_decodeutf_16_decodeutf_7_encodestring is too large to encodelookupgetgrouplistactivate_stack_trampolineperfinvalid backend: %stokenizeriterargument 'order'tobytesorder must be 'C', 'F' or 'A'__getformat__double__getformat__() argument 1 must be 'double' or 'float'IEEE, little-endianIEEE, big-endianinsane float_format or double_formathexadecimal string too long to converthexadecimal value too large to represent as a floatinvalid hexadecimal floating-point stringfloat() argument must be a string or a real number, not '%.200s'utf_8_encodeutf-32utf_32_encodeutf_32_le_encodeutf_32_be_encodeutf-16bindtextdomaindomain must be a non-empty stringos.unsetenvputenvillegal environment variable nameos.putenvos.systemis_symlink() takes no argumentsinitgroupsgetpwnamgetpwnam(): name not found: %Rexecvexec not supported for isolated subinterpretersexecv() arg 2 must be a tuple or listexecv() arg 2 must not be emptyexecv() arg 2 first element cannot be emptyos.execlistxattros.listxattrremovexattros.removexattrargument 'value'setxattrOOy#ios.setxattrgetxattros.getxattros.symlinksymlink: src and dst must be the same typeutime: you may specify either 'times' or 'ns' but not bothutime: 'times' must be either a tuple of two ints or Noneutime: 'ns' must be a tuple of two intsutimeOOOios.utimeos.rmdirlink: src and dst must be the same typeos.linkchmod%s: cannot use dir_fd and follow_symlinks togetherfollow_symlinks%s%s%s unavailable on this platformOIIichownlost builtins moduledumputf_16_encodeutf_16_le_encodeutf_16_be_encoderegister_errorObjects/structseq.c(O(OO))int_curr_symbolcurrency_symbolmon_decimal_pointmon_thousands_sepmon_groupingpositive_signnegative_signint_frac_digitsfrac_digitsp_cs_precedesp_sep_by_spacen_cs_precedesn_sep_by_spacep_sign_posnn_sign_posndecimal_pointthousands_sepgroupingpartial character in shift sequencenon-zero padding bits in shift sequenceill-formed sequenceunexpected special characterutf7unterminated shift sequenceutf_7_decodeUO:BaseExceptionGroup.__new__second argument (exceptions) must be a sequencesecond argument (exceptions) must be a non-empty sequenceItem %d of second argument (exceptions) is not an exceptionCannot nest BaseExceptions in an ExceptionGroupCannot nest BaseExceptions in '%.200s'UnnUUOnnUUUnnUOOOO|OOend_offset must be provided when end_lineno is providedcountsubsection not foundrindex%s first arg must be bytes or a tuple of bytes, not %ssubstring not foundi:getsidi:sched_rr_get_intervali:sched_getscheduleri:sched_getparami:sched_getaffinitycould not allocate a large enough CPU setnO:insertdeque already at its maximum sizeO|O&O&:indexii:tcsetpgrpii:setpgidii:waitpidii:killpgos.killpgin:killos.killiiO:sched_setscheduleriO:sched_setparamiO:sched_setaffinityexpected an iterator of ints, but iterator yielded %Rnegative CPU numberCPU number too largeiii:waitidfloat argument required, not %.200spop from empty bytearraycomplex() can't take second arg if first is a stringcomplex() second arg can't be a stringcomplex() first argument must be a string or a number, not '%.200s'complex() second argument must be a number, not '%.200s'Pickle, copy, and deepcopy support will be removed from itertools in Python 3.14.ONOO(n)O()(OO)O()(O)O(OO)lO(())(Oi)O(OO)(OOO)O(ONO)state is not a tupleO!iIndex out of rangeO!O!invalid argumentsO(()n)O(On)(NN)O(On)NOONO(Nn)nO(OnNn)nO(N)(OO)O(O)(OO)O|OArguments must be iterators.(O)OO(NO)ONOO(NiO)O(OO)OPyUnicode_AsDecodedObject() is deprecated; use PyCodec_Decode() to decode from strPyUnicode_AsDecodedUnicode() is deprecated; use PyCodec_Decode() to decode from str to strPyUnicode_AsEncodedObject() is deprecated; use PyUnicode_AsEncodedString() to encode from str to bytes or PyCodec_Encode() for generic encodingPyUnicode_AsEncodedUnicode() is deprecated; use PyCodec_Encode() to encode from str to str'%.400s' encoder returned '%.400s' instead of 'str'; use codecs.encode() to encode to arbitrary typesNotImplemented should not be used in a boolean contextthe (type, exc, tb) signature of athrow() is deprecated, use the single-arg signature instead.co_lnotab is deprecated, use co_lines instead.str() on a bytes instanceComparison between bytearray and stringstr() on a bytearray instanceBitwise inversion '~' on bool is deprecated and will be removed in Python 3.16. This returns the bitwise inversion of the underlying int object and is usually not what you expect from negating a bool. Use the 'not' operator for boolean negation or ~int(x) if you really want the bitwise inversion of the underlying int.can't do nonzero cur-relative seekscan't do nonzero end-relative seeksinvalid whence (%d, should be %d, %d or %d)negative seek position %Runderlying read() should have returned a bytes object, not '%.200s'iNcan't restore logical file positioniya real numberan integerprec too big%%b requires a bytes-like object, or an object that implements __bytes__, not '%.100s'%%%c format: %s is required, not %.200s%c requires an integer in range(256) or a single byte%c arg not in range(256)not all arguments converted during bytes formattingtext_encodingargument 'skip_file_prefixes'category must be a Warning subclass, not '%s''yield' inside list comprehension'yield' inside set comprehension'yield' inside dict comprehension'yield' inside generator expressionBUG: internal directive bookkeeping brokenO(OiiOii)(OnnNnn)unicode errorvalue error(%s) %U(%s) unknown error'%c' was never closedcannot assign to %scannot delete %sexpression cannot contain assignment, perhaps you meant "=="?cannot assign to keyword argument unpackingmultiple exception types must be parenthesizedexpected one or more exception typesexpected an indented block after 'while' statement on line %diterable unpacking cannot be used in comprehensiondid you forget parentheses around the comprehension target?imaginary number required in complex literalexpected an indented block after 'except*' statement on line %dexpected an indented block after 'except' statement on line %dunknown tokenization errorunexpected EOF in multi-line statement(OnnOOO)EOF(iN(nn)(nn)O)argument 'filename'warn_explicitmodule_globals must be a dict, not '%.200s'_bless_my_loadercannot pickle %.200s objects%.200s.__slotnames__ should be a list or None, not %.200scopyreg._slotnames didn't return a list or Nonecannot pickle '%.200s' object__slotsname__ changed size during iterationO()NNO(()n)NN(O()N)(O(Ns)N)(O(y#)N)__reduce_ex____getnewargs_ex__ should return a tuple, not '%.200s'__getnewargs_ex__ should return a tuple of length 2, not %zdfirst item of the tuple returned by __getnewargs_ex__ must be a tuple, not '%.200s'second item of the tuple returned by __getnewargs_ex__ must be a dict, not '%.200s'__getnewargs__ should return a tuple, not '%.200s'_reduce_exproxyinvalid template_teeteen must be >= 0cannot re-enter the tee iteratorteedataobjectInvalid argumentsPyType_HasFeature((Py_TYPE(((PyObject*)((op))))), ((1UL << 28)))kind == PyUnicode_1BYTE_KINDkind == PyUnicode_1BYTE_KIND || kind == PyUnicode_2BYTE_KIND || kind == PyUnicode_4BYTE_KINDascii->state.ascii == 0compact->utf8 != datadata != ((void *)0)compact->utf8 == datacompact->utf8_length == ascii->lengthcompact->utf8_length == 0maxchar >= 128maxchar <= 255maxchar < 128maxchar >= 0x100maxchar <= 0xFFFFmaxchar >= 0x10000maxchar <= 0x10ffffPyUnicode_READ(((int)(kind)), ((const void*)(data)), (ascii->length)) == 0!_PyObject_IsFreed((PyObject *)type)Py_REFCNT(((PyObject*)((type)))) >= 1PyType_Check(((PyObject*)((type))))!is_readying(type)lookup_tp_dict(type) != ((void *)0)type->tp_traverse != ((void *)0)type->tp_new == ((void *)0)PyDict_Contains(lookup_tp_dict(type), &(_PyRuntime.static_objects.singletons.strings.identifiers._py___new__._ascii.ob_base)) == 0PyType_HasFeature((Py_TYPE(((PyObject*)((op))))), ((1UL << 29)))0 <= mp->ma_used && mp->ma_used <= usable0 <= keys->dk_usable && keys->dk_usable <= usable0 <= keys->dk_nentries && keys->dk_nentries <= usablekeys->dk_usable + keys->dk_nentries <= usablekeys->dk_kind != DICT_KEYS_SPLITkeys->dk_refcnt == 1 || keys == &empty_keys_structkeys->dk_kind == DICT_KEYS_SPLITmp->ma_used <= 30(-2) <= ix && ix <= usableentry->me_hash != -1entry->me_value != ((void *)0)entry->me_hash == hashPy_IS_TYPE(((PyObject*)(((key)))), (&PyUnicode_Type))hash != -1entry->me_value == ((void *)0)(duplicate_check & (1<ma_values->values[index] != ((void *)0)!_PyObject_IsFreed(op)Py_REFCNT(((PyObject*)((op)))) >= 1cannot reuse already awaited __anext__()/asend()anext(): asynchronous generator is already runningcannot clear an executing framethrow() third argument must be a traceback objectinstance exception may not have a separate valueexceptions must be classes or instances deriving from BaseException, not %sthe (type, exc, tb) signature of throw() is deprecated, use the single-arg signature instead.cannot reuse already awaited aclose()/athrow()aclose(): asynchronous generator is already runningathrow(): asynchronous generator is already runningenv.keys() or env.values() is not a list%s=%sexecve: argv must be a tuple or listexecve: argv must not be emptyexecve: environment must be a mapping objectexecve: argv first element cannot be emptyinvalid partial stateOOOO(OOnN)(OnN)Objects/frameobject.c%.200s.__setstate__ argument should be 4-tuple, got %.200sthird item of state must be an integer, got %.200sposition value cannot be negativefourth item of state should be a dict, got a %.200s%.200s.__setstate__ argument should be 3-tuple, got %.200ssecond item of state must be an integer, not %.200sthird item of state should be a dict, got a %.200ss:get_clock_infomonotonicperf_counterprocess_timethread_timeunknown clockadjustableresolutionposix_spawnpposix_spawn%s: argv must be a tuple or list%s: argv must not be empty%s: environment must be a mapping object%s: argv first element cannot be emptyfile_actions must be a sequence or NoneEach file_actions element must be a non-empty tupleOiO&ik;A open file_action tuple must have 5 elementsOi;A close file_action tuple must have 2 elementsOii;A dup2 file_action tuple must have 3 elementsUnknown file_actions identifierOO;A scheduler tuple must have two elementsos.posix_spawnre.compile(%.200R, %S)re.compile(%.200R)symtablestring or bytessymtable() arg 3 must be 'exec' or 'eval' or 'single'sys.excepthookin audit hookError in sys.excepthook: Original exception was: sys.excepthook is missing deallocated BytesIO object has exported buffers__interactivehook__cpython.run_interactivehookFailed calling sys.__interactivehook__ thread is not currentthread still has a framenot the last threadO&|$p:InterpreterID.__init__(iiiiii)except handlerexpected an ASTqualnameconstsvarnamescellvarsfreevarsargcountposonlyargcountkwonlyargcount%U=%Rkeywords dict changed size during iteration%s(%R, %U)%U, %R%U, %S=%R%s(%R%U)<_io.TextIOWrapperreentrant call inside %s.__repr__ name=%R%U encoding=%R> mode=%R<%s><%s name=%R><_io.FileIO [closed]><_io.FileIO fd=%d mode='%s' closefd=%s><_io.FileIO name=%R mode='%s' closefd=%s>%s(%U, %U)namespace%s(%S)manyfew%R is not a generic classToo %s arguments for %R; actual %zd, expected %zdpositionalkeyword-only%U and %U, %U, and %U%U() missing %i required %s argument%s: %U>>> ... type %.100s doesn't define __round__ methodkeyword list must be a dictionarypartialfunctoolsNo such frozen object named %RFrozen object named %R is invalidExcluded frozen object named %RFrozen modules are disabled and the frozen object named %R is not essentialPy_Initialize must be called firstinit_frozensequence item %zd: expected a bytes-like object, %.80s foundjoin() result is too longsequence changed size during iterationreadline of closed filereadline() should have returned a bytes object, not '%.200s'%s(%R, maxlen=%zd)%.200s() must return a deque, not %.200scan only concatenate deque (not "%.200s") to dequederivederive must return an instance of BaseExceptionGroup in exceptiongroup_split_recursiveorig must be an exception instanceexcs must be a list of exception instancesitem %d of excs is not an exceptionorig must be a raised exceptionsubgroupbad ID: Allocated using API '%c', verified using API '%c'bad leading pad bytebad trailing pad bytePy_ExitStatusException() must not be called on successfailed to re-set autoTSSkeyFailed to reinitialize runtime locksCan't reinitialize pending calls lockfailed to create a new locknot main interpretermissing main interpretercan't fork at interpreter shutdownfork not supported for isolated subinterpretersos.forkforkfork not supported for subinterpretersos.forkptyforkpty(Ni)Python %s %s the __main__ module is not frozen_thread.excepthook argument type must be ExceptHookArgs_stderrException in thread in print_chainedinputinput(): lost sys.stdininput(): lost sys.stdoutinput(): lost sys.stderrbuiltins.inputbuiltins.input/result_frozen_importlib_externalabccodecs_collections_abc_sitebuiltinsgenericpathntpathposixpathos.pathosimportlib.utilimportlib.machinery__hello____hello_alias____phello_alias____phello_alias__.spam__phello____phello__.__init____phello__.ham__phello__.ham.__init____phello__.ham.eggs__phello__.spam__hello_only__importlib._bootstrapimportlib._bootstrap_external<__phello__<__phello__.hamabspathbasenamedirnamehassuffixisabsisdirisfileisxfilejoinpathrealpathExecute a module's code without importing it. mod_name -- an absolute module name or package name. Optional arguments: init_globals -- dictionary used to pre-populate the module’s globals dictionary before the code is executed. run_name -- if not None, this will be used for setting __name__; otherwise, __name__ will be set to mod_name + '__main__' if the named module is a package and to just mod_name otherwise. alter_sys -- if True, sys.argv[0] is updated with the value of __file__ and sys.modules[__name__] is updated with a temporary module object for the module being executed. Both are restored to their original values before the function returns. Returns the resulting module globals dictionary. Execute code located at the specified filesystem location. path_name -- filesystem location of a Python script, zipfile, or directory containing a top level __main__.py script. Optional arguments: init_globals -- dictionary used to pre-populate the module’s globals dictionary before the code is executed. run_name -- if not None, this will be used to set __name__; otherwise, '' will be used for __name__. Returns the resulting module globals dictionary. π😀pw_nameuser namepw_passwdpasswordpw_uiduser idpw_gidgroup idpw_gecosreal namepw_dirhome directorypw_shellshell programgetpwuidgetpwallpwdpwd.struct_passwd_symtableS_ISDIRS_ISCHRS_ISBLKS_ISREGS_ISFIFOS_ISLNKS_ISSOCKS_ISDOORS_ISPORTS_ISWHTS_IMODES_IFMTfilemode_statST_MODEST_INOST_DEVST_NLINKST_UIDST_GIDST_SIZEST_ATIMEST_MTIMEST_CTIME__reduce__truthnegposabsinvinvertnot__operatoroperator.methodcalleroperator.itemgetteroperator.attrgetterlocaleconvnl_langinfogetencodingDAY_1DAY_2DAY_3DAY_4DAY_5DAY_6DAY_7ABDAY_1ABDAY_2ABDAY_3ABDAY_4ABDAY_5ABDAY_6ABDAY_7MON_1MON_2MON_3MON_4MON_5MON_6MON_7MON_8MON_9MON_10MON_11MON_12ABMON_1ABMON_2ABMON_3ABMON_4ABMON_5ABMON_6ABMON_7ABMON_8ABMON_9ABMON_10ABMON_11ABMON_12RADIXCHARTHOUSEPCRNCYSTRD_T_FMTD_FMTT_FMTAM_STRPM_STRCODESETT_FMT_AMPMERAERA_D_FMTERA_D_T_FMTERA_T_FMTALT_DIGITSYESEXPRNOEXPR_DATE_FMTfunction object to use in future partial callstuple of arguments to future partial callsdictionary of keyword arguments to future partial calls__setstate____class_getitem__See PEP 585objValue wrapped by a key function.cache_infocache_clear__copy____deepcopy__cmp_to_keymycmpfunctools._lru_list_elemfunctools.KeyWrapperfunctools._lru_cache_wrapperfunctools.partialuser_functiontypedcache_info_type_functoolsget_cache_token_abc_init_reset_registry_reset_caches_get_dump_abc_destroy_abc._abc_datagetweakrefcountgetweakrefs_weakrefWeak-reference support module._idfunc_typingtm_yearyear, for example, 1993tm_monmonth of year, range [1, 12]tm_mdayday of month, range [1, 31]tm_hourhours, range [0, 23]tm_minminutes, range [0, 59]tm_secseconds, range [0, 61])tm_wdayday of week, range [0, 6], Monday is 0tm_ydayday of year, range [1, 366]tm_isdst1 if summer time is in effect, 0 if not, and -1 if unknowntm_zoneabbreviation of timezone nametm_gmtoffoffset from UTC in secondsclock_gettimeclock_gettime_nsclock_settimeclock_settime_nsclock_getrespthread_getcpuclockidsleepgmtimelocaltimectimemktimestrftimestrptimetzsetmonotonic_nsprocess_time_nsthread_time_nsperf_counter_nsget_clock_infotime.struct_timeThe time value as returned by gmtime(), localtime(), and strptime(), and accepted by asctime(), mktime() and strftime(). May be considered as a sequence of 9 integers. Note that several fields' values are not the same as those defined by the C language standard for struct tm. For example, the value of the field tm_year is the actual year, not year - 1900. See individual fields' descriptions for details.acquire_lockacquirerelease_lockreleaselocked_lock__enter____exit___at_fork_reinit_is_owned_acquire_restore_release_save_recursion_countThread-local dummyThread-local dataexc_typeException typeexc_valueException valueexc_tracebackException tracebackThreadstart_newdaemon_threads_allowedallocate_lockallocateexit_threadinterrupt_mainget_identget_native_idstack_size_set_sentinel_excepthook_is_main_interpreterblockingtimeout_localdummy_destroyed_thread_thread._ExceptHookArgs_thread._local_thread._localdummy_thread.RLock_thread.lockgroupindexA dictionary mapping group names to group numbers.The pattern string from which the RE object was compiled.The regex matching flags.groupsThe number of capturing groups in the pattern.fullmatchsubnfindallfinditerscannerlastindexThe integer index of the last matched capturing group.lastgroupThe name of the last matched capturing group.regsThe string passed to match() or search().The regular expression object.The index into the string at which the RE engine started looking for a match.endposThe index into the string beyond which the RE engine will not go.groupdictexpandgetcodesizeascii_iscasedunicode_iscasedascii_tolowerunicode_tolowermaxsplitreplindexgroup_srere.TEMPLATEre.IGNORECASEre.LOCALEre.MULTILINEre.DOTALLre.UNICODEre.VERBOSEre.DEBUGre.ASCII_sre.SRE_Template_sre.SRE_Scannerre.Matchre.Patternfrom_iterable__sizeof____length_hint__dataselectorsinitialbatchedcombinationscombinations_with_replacementgroupbypermutationsaccumulatecompresstimesitertoolsitertools.zip_longestitertools._tee_dataobjectitertools._teeitertools.takewhileitertools.starmapitertools.repeatitertools.productitertools.permutationsitertools.pairwiseitertools.isliceitertools._grouperitertools.groupbyitertools.filterfalseitertools.dropwhileitertools.cycleitertools.combinations_with_replacementitertools.countitertools.compressitertools.combinationsitertools.chainitertools.batcheditertools.accumulatenewlinesline_bufferinggetvaluetellseekablereadablewritable__getstate___io.StringIOinitial_valuenewlineStringIO_io._TextIOBasegetstatesetstatereset_io.IncrementalNewlineDecoder_CHUNK_SIZEbufferwrite_through_finalizingreconfigureflushisatty_io.TextIOWrapperdecodertranslateIncrementalNewlineDecoderiso8859-1_io._BufferedIOBaseraw_dealloc_warn_io.BufferedReader_io.BufferedWriter_io.BufferedRWPair_io.BufferedRandombuffer_sizeBufferedReaderBufferedWriterBufferedRandomTrue if the file is closed.writelinesgetbuffer_io.BytesIO_io._BytesIOBufferinitial_bytesBytesIOTrue if the file is closedclosefdTrue if the file descriptor will be closed by close().String giving the file mode_blksizereadall_io.FileIOopener_checkClosed_checkSeekable_checkReadable_checkWritable_io._IOBase_io._RawIOBasebufferingerrnoappendappendleftclearcopyextendextendleftpopleftremove__reversed__reverserotatemaxlenmaximum size of a deque or None if unboundeddefault_factoryFactory for default value called by __missing__().__missing___collectionscollections._tuplegettercollections._deque_reverse_iteratorcollections._deque_iteratorcollections.defaultdictcollections.dequeregisterunregister_codecsis_tracingclear_traces_get_traces_get_object_tracebackget_traceback_limitget_tracemalloc_memoryget_traced_memoryreset_peak_tracemallocsi_signosignal numbersi_codesignal codesi_errnoerrno associated with this signalsi_pidsending process IDsi_uidreal user ID of sending processsi_statusexit value or signalsi_bandband event for SIGPOLLalarmgetitimerraise_signalstrsignalgetsignalset_wakeup_fdpausesigpendingsigwaitsigwaitinfovalid_signalssignal.struct_siginfowarn_on_full_bufferprotection bitsst_inoinodest_devdevicest_nlinknumber of hard linksst_uiduser ID of ownerst_gidgroup ID of ownerst_sizetotal size, in bytesinteger time of last accessinteger time of last modificationinteger time of last changest_atimest_mtimest_ctimest_atime_nstime of last access in nanosecondsst_mtime_nstime of last modification in nanosecondsst_ctime_nstime of last change in nanosecondsst_blksizeblocksize for filesystem I/Ost_blocksnumber of blocks allocatedst_rdevdevice type (if inode device)f_bsizef_frsizef_blocksf_bfreef_bavailf_filesf_ffreef_favailf_flagf_namemaxf_fsidsysnameoperating system namenodenamename of machine on network (implementation-defined)operating system releaseoperating system versionmachinehardware identifiersched_prioritythe scheduling priorityuseruser timesystemsystem timechildren_useruser time of childrenchildren_systemsystem time of childrenelapsedelapsed time since an arbitrary point in the pastcolumnswidth of the terminal window in charactersheight of the terminal window in charactersthe entry's base filename, relative to scandir() "path" argumentthe entry's full path name; equivalent to os.path.join(scandir_path, entry.name)is_diris_fileis_symlinkis_junction__fspath__accessttynamechdirfchmodfchownlchownchrootctermidgetcwdgetcwdblinklistdirlstatmkdirnicegetprioritysetpriorityreadlinkcopy_file_rangesplicermdirsymlinkumaskunameunlink_exitexecveregister_at_forksched_get_priority_maxsched_get_priority_minsched_getparamsched_getschedulersched_rr_get_intervalsched_setparamsched_setschedulersched_yieldsched_setaffinitysched_getaffinityopenptylogin_ttygetegidgeteuidgetgidgetgroupsgetpidgetpgrpgetppidgetuidgetloginkillpgsetuidseteuidsetgidsetegidsetgroupsgetpgidsetpgrpwait3wait4waitidwaitpidpidfd_opengetsidsetsidsetpgidtcgetpgrptcsetpgrpdevice_encodingdupdup2sendfilefstatpipepipe2mkfifomknodmajorminorunsetenvstrerrorfchdirfsyncsyncfdatasyncWCOREDUMPWIFCONTINUEDWIFSTOPPEDWIFSIGNALEDWIFEXITEDWEXITSTATUSWTERMSIGWSTOPSIGfstatvfsstatvfsconfstrsysconfpathconfabort_path_normpathgetloadavgurandomgetresuidgetresgidcpu_countget_inheritableget_blockingscandirfspathgetrandommemfd_createeventfdeventfd_readeventfd_writewaitstatus_to_exitcodesetnsunsharenstypestatusinitvallengthdir_fdout_fdin_fdfd2inheritablepidoptionspolicycommandsrcdsttarget_is_directorysrc_dir_fddst_dir_fdoffset_srcoffset_dstfile_actionssetpgroupresetidssetsigmasksetsigdefschedulerwhichwhopriorityuidgideffective_idsHAVE_EVENTFDHAVE_FACCESSATHAVE_FCHDIRHAVE_FCHMODHAVE_FCHMODATHAVE_FCHOWNHAVE_FCHOWNATHAVE_FEXECVEHAVE_FDOPENDIRHAVE_FPATHCONFHAVE_FSTATATHAVE_FSTATVFSHAVE_FTRUNCATEHAVE_FUTIMENSHAVE_FUTIMESHAVE_FUTIMESATHAVE_LINKATHAVE_LCHOWNHAVE_LSTATHAVE_LUTIMESHAVE_MEMFD_CREATEHAVE_MKDIRATHAVE_MKFIFOATHAVE_MKNODATHAVE_OPENATHAVE_READLINKATHAVE_RENAMEATHAVE_SYMLINKATHAVE_UNLINKATHAVE_UTIMENSATposix.uname_resultposix.DirEntryposix.ScandirIteratoros.terminal_sizei:getpgidii:wait4i|O&:pidfd_openCS_GNU_LIBC_VERSIONCS_GNU_LIBPTHREAD_VERSIONCS_LFS64_CFLAGSCS_LFS64_LDFLAGSCS_LFS64_LIBSCS_LFS64_LINTFLAGSCS_LFS_CFLAGSCS_LFS_LDFLAGSCS_LFS_LIBSCS_LFS_LINTFLAGSCS_PATHCS_XBS5_ILP32_OFF32_CFLAGSCS_XBS5_ILP32_OFF32_LDFLAGSCS_XBS5_ILP32_OFF32_LIBSCS_XBS5_ILP32_OFF32_LINTFLAGSCS_XBS5_ILP32_OFFBIG_CFLAGSCS_XBS5_ILP32_OFFBIG_LDFLAGSCS_XBS5_ILP32_OFFBIG_LIBSCS_XBS5_ILP32_OFFBIG_LINTFLAGSCS_XBS5_LP64_OFF64_CFLAGSCS_XBS5_LP64_OFF64_LDFLAGSCS_XBS5_LP64_OFF64_LIBSCS_XBS5_LP64_OFF64_LINTFLAGSCS_XBS5_LPBIG_OFFBIG_CFLAGSCS_XBS5_LPBIG_OFFBIG_LDFLAGSCS_XBS5_LPBIG_OFFBIG_LIBSCS_XBS5_LPBIG_OFFBIG_LINTFLAGSPC_ASYNC_IOPC_CHOWN_RESTRICTEDPC_FILESIZEBITSPC_LINK_MAXPC_MAX_CANONPC_MAX_INPUTPC_NAME_MAXPC_NO_TRUNCPC_PATH_MAXPC_PIPE_BUFPC_PRIO_IOPC_SOCK_MAXBUFPC_SYNC_IOPC_VDISABLEPC_ALLOC_SIZE_MINPC_REC_INCR_XFER_SIZEPC_REC_MAX_XFER_SIZEPC_REC_MIN_XFER_SIZEPC_REC_XFER_ALIGNPC_SYMLINK_MAXSC_2_CHAR_TERMSC_2_C_BINDSC_2_C_DEVSC_2_C_VERSIONSC_2_FORT_DEVSC_2_FORT_RUNSC_2_LOCALEDEFSC_2_SW_DEVSC_2_UPESC_2_VERSIONSC_AIO_LISTIO_MAXSC_AIO_MAXSC_AIO_PRIO_DELTA_MAXSC_ARG_MAXSC_ASYNCHRONOUS_IOSC_ATEXIT_MAXSC_AVPHYS_PAGESSC_BC_BASE_MAXSC_BC_DIM_MAXSC_BC_SCALE_MAXSC_BC_STRING_MAXSC_CHARCLASS_NAME_MAXSC_CHAR_BITSC_CHAR_MAXSC_CHAR_MINSC_CHILD_MAXSC_CLK_TCKSC_COLL_WEIGHTS_MAXSC_DELAYTIMER_MAXSC_EQUIV_CLASS_MAXSC_EXPR_NEST_MAXSC_FSYNCSC_GETGR_R_SIZE_MAXSC_GETPW_R_SIZE_MAXSC_INT_MAXSC_INT_MINSC_IOV_MAXSC_JOB_CONTROLSC_LINE_MAXSC_LOGIN_NAME_MAXSC_LONG_BITSC_MAPPED_FILESSC_MB_LEN_MAXSC_MEMLOCKSC_MEMLOCK_RANGESC_MEMORY_PROTECTIONSC_MESSAGE_PASSINGSC_MQ_OPEN_MAXSC_MQ_PRIO_MAXSC_NGROUPS_MAXSC_NL_ARGMAXSC_NL_LANGMAXSC_NL_MSGMAXSC_NL_NMAXSC_NL_SETMAXSC_NL_TEXTMAXSC_NPROCESSORS_CONFSC_NPROCESSORS_ONLNSC_NZEROSC_OPEN_MAXSC_PAGESIZESC_PAGE_SIZESC_PASS_MAXSC_PHYS_PAGESSC_PIISC_PII_INTERNETSC_PII_INTERNET_DGRAMSC_PII_INTERNET_STREAMSC_PII_OSISC_PII_OSI_CLTSSC_PII_OSI_COTSSC_PII_OSI_MSC_PII_SOCKETSC_PII_XTISC_POLLSC_PRIORITIZED_IOSC_PRIORITY_SCHEDULINGSC_REALTIME_SIGNALSSC_RE_DUP_MAXSC_RTSIG_MAXSC_SAVED_IDSSC_SCHAR_MAXSC_SCHAR_MINSC_SELECTSC_SEMAPHORESSC_SEM_NSEMS_MAXSC_SEM_VALUE_MAXSC_SHARED_MEMORY_OBJECTSSC_SHRT_MAXSC_SHRT_MINSC_SIGQUEUE_MAXSC_SSIZE_MAXSC_STREAM_MAXSC_SYNCHRONIZED_IOSC_THREADSSC_THREAD_ATTR_STACKADDRSC_THREAD_ATTR_STACKSIZESC_THREAD_DESTRUCTOR_ITERATIONSSC_THREAD_KEYS_MAXSC_THREAD_PRIORITY_SCHEDULINGSC_THREAD_PRIO_INHERITSC_THREAD_PRIO_PROTECTSC_THREAD_PROCESS_SHAREDSC_THREAD_SAFE_FUNCTIONSSC_THREAD_STACK_MINSC_THREAD_THREADS_MAXSC_TIMERSSC_TIMER_MAXSC_TTY_NAME_MAXSC_TZNAME_MAXSC_T_IOV_MAXSC_UCHAR_MAXSC_UINT_MAXSC_UIO_MAXIOVSC_ULONG_MAXSC_USHRT_MAXSC_VERSIONSC_WORD_BITSC_XBS5_ILP32_OFF32SC_XBS5_ILP32_OFFBIGSC_XBS5_LP64_OFF64SC_XBS5_LPBIG_OFFBIGSC_XOPEN_CRYPTSC_XOPEN_ENH_I18NSC_XOPEN_LEGACYSC_XOPEN_REALTIMESC_XOPEN_REALTIME_THREADSSC_XOPEN_SHMSC_XOPEN_UNIXSC_XOPEN_VERSIONSC_XOPEN_XCU_VERSIONSC_XOPEN_XPG2SC_XOPEN_XPG3SC_XOPEN_XPG4SC_MINSIGSTKSZenable($module, /, file=sys.stderr, all_threads=True) -- Enable the fault handler.disabledisable($module, /) -- Disable the fault handler.is_enabledis_enabled($module, /) -- Check if the handler is enabled.dump_tracebackdump_traceback($module, /, file=sys.stderr, all_threads=True) -- Dump the traceback of the current thread, or of all threads if all_threads is True, into file.dump_traceback_laterdump_traceback_later($module, /, timeout, repeat=False, file=sys.stderr, exit=False) -- Dump the traceback of all threads in timeout seconds, or each timeout seconds if repeat is True. If exit is True, call _exit(1) which is not safe.cancel_dump_traceback_latercancel_dump_traceback_later($module, /) -- Cancel the previous call to dump_traceback_later().register($module, /, signum, file=sys.stderr, all_threads=True, chain=False) -- Register a handler for the signal 'signum': dump the traceback of the current thread, or of all threads if all_threads is True, into file.unregister($module, signum, /) -- Unregister the handler of the signal 'signum' registered by register()._read_null_read_null($module, /) -- Read from NULL, raise a SIGSEGV or SIGBUS signal depending on the platform._sigsegv_sigsegv($module, release_gil=False, /) -- Raise a SIGSEGV signal._fatal_error_c_thread_fatal_error_c_thread($module, /) -- Call Py_FatalError() in a new C thread._sigabrt_sigabrt($module, /) -- Raise a SIGABRT signal._sigfpe_sigfpe($module, /) -- Raise a SIGFPE signal._stack_overflow_stack_overflow($module, /) -- Recursive call to raise a stack overflow.all_threadssignumBus errorIllegal instructionFloating-point exceptionAbortedSegmentation fault_clear_run_exitfuncs_ncallbacksatexitisenabledset_debugget_debugget_countset_thresholdget_thresholdcollectget_objectsget_statsis_trackedis_finalizedget_referrersget_referentsfreezeunfreezeget_freeze_countmarshal_ast_tokenize_warnings.cpython-312-aarch64-linux-gnu.so.abi3.so.so646ansi_x3.4_1968ansi_x3.4_1986ansi_x3_4_1968cp367csasciiibm367iso646_usiso_646.irv_1991iso_ir_6INFNANtracebackname of the thread implementationname of the lock implementationname and version of the thread librarysys.thread_infofirstiterHook to intercept first iterationfinalizerHook to intercept finalizationwidthwidth of the type used for hashing, in bitsmodulusprime number giving the modulus on which the hash function is basedvalue to be used for hash of a positive infinityvalue to be used for hash of a nanimagmultiplier used for the imaginary part of a complex numberalgorithmname of the algorithm for hashing of str, bytes and memoryviewshash_bitsinternal output size of hash algorithmseed_bitsseed size of hash algorithmcutoffsmall string optimization cutoff-d-ioptimize-O or -OO-Bno_user_site-sno_site-Signore_environment-E-v-b-qhash_randomization-R-I-X dev-X utf8-X warn_default_encoding-P-X int_max_str_digitsMajor release numberMinor release numbermicroPatch release numberreleaselevel'alpha', 'beta', 'candidate', or 'final'serialSerial release numberaddaudithookaudit_clear_type_cache_current_frames_current_exceptionsexc_infogetdefaultencodinggetdlopenflagsgetallocatedblocksgetunicodeinternedsizegetfilesystemencodinggetfilesystemencodeerrorsgetrefcountgetrecursionlimitgetsizeof_getframemodulenameis_finalizingsetswitchintervalgetswitchintervalsetdlopenflagssetprofile_setprofileallthreadsgetprofilesetrecursionlimitsettrace_settraceallthreadsgettrace_debugmallocstatsset_coroutine_origin_tracking_depthget_coroutine_origin_tracking_depthset_asyncgen_hooksget_asyncgen_hooksdeactivate_stack_trampolineis_stack_trampoline_activeget_int_max_str_digitsset_int_max_str_digitsmaxdigitsdepth_only_immortalasyncgen_hookssys.flagssys.version_infosys.hash_info_aix_support_asyncio_bisect_blake2_bz2_codecs_cn_codecs_hk_codecs_iso2022_codecs_jp_codecs_kr_codecs_tw_compat_pickle_compression_contextvars_crypt_csv_ctypes_curses_curses_panel_datetime_dbm_decimal_elementtree_gdbm_hashlib_heapq_json_lsprof_lzma_markupbase_md5_msi_multibytecodec_multiprocessing_opcode_osx_support_overlapped_pickle_posixshmem_posixsubprocess_py_abc_pydatetime_pydecimal_pyio_queue_random_scproxy_sha1_sha2_sha3_socket_sqlite3_ssl_statistics_struct_threading_local_tkinter_uuid_weakrefset_winapi_wmi_zoneinfoaifcantigravityargparsearrayasyncioaudioopbase64bdbbinasciibisectbz2cProfilecalendarcgicgitbchunkcmathcmdcodeopcolorsyscompileallconcurrentconfigparsercontextlibcontextvarscopyregcryptcsvctypescursesdataclassesdatetimedbmdifflibdisdoctestemailensurepipenumfcntlfilecmpfileinputfnmatchfractionsftplibgetoptgetpassglobgraphlibgrpgziphashlibheapqhmachtmlhttpidlelibimaplibimghdripaddressjsonlib2to3linecachelogginglzmamailboxmailcapmathmimetypesmmapmodulefindermsilibmsvcrtmultiprocessingnetrcnisnntplibnturl2pathnumbersopcodeoptparseossaudiodevpathlibpdbpickletoolspipespkgutilplistlibpoplibpprintprofilepstatspy_compilepyclbrpydocpydoc_datapyexpatqueuequoprireprlibschedsecretsselectshelveshlexshutilsmtplibsndhdrsocketsocketserverspwdsqlite3sre_compilesre_constantssre_parsesslstatisticsstringprepsubprocesssunausysconfigsyslogtabnannytarfiletelnetlibtempfiletermiostextwrapthisthreadingtimeittkintertokenizetomllibttyturtleturtledemounittesturllibuuuuidvenvwavewebbrowserwinsoundwsgirefxdrlibxmlxmlrpczipappzipfilezlibzoneinfosymbolschildrennestedsymtable entry€‚ƒ„…†‡ˆ‰Š‹ŒŽ‘’“”•–—˜™š›œžŸ ¡¢£¤¥¦§¨©ª«¬­®¯°±²³´µ¶·¸¹º»¼½¾¿ÀÁÂÃÄÅÆÇÈÉÊËÌÍÎÏÐÑÒÓÔÕÖרÙÚÛÜÝÞßàáâãäåæçèéêëìíîïðñòóôõö÷øùúûüýþÿC.UTF-8C.utf8UTF-8stdinstdoutstderrps1ps2last_exclast_typelast_valuelast_tracebacksiphash13sys.legacy_event_handlerfree_tool_idget_toolget_eventsrestart_events_all_eventssys.monitoringPY_STARTPY_RESUMEPY_RETURNPY_YIELDCALLINSTRUCTIONJUMPBRANCHSTOP_ITERATIONRAISEEXCEPTION_HANDLEDPY_UNWINDPY_THROWRERAISEC_RETURNC_RAISEextension_suffixeslock_heldcreate_builtin_frozen_module_names_override_frozen_modules_for_tests_override_multi_interp_extensions_checkexec_dynamicexec_builtinsourcewithdatadeletehamthamt_collision_nodehamt_array_nodehamt_bitmap_nodeerr_msgError messageObject causing the exceptionUnraisableHookArgsrunvarold_valueToken.MISSING_contextvars.Token_contextvars.ContextVar_contextvars.Context0123456789abcdefstrict_errorsImplements the 'strict' error handling, which raises a UnicodeError on coding errors.ignore_errorsImplements the 'ignore' error handling, which ignores malformed data and continues.replace_errorsImplements the 'replace' error handling, which replaces malformed data with a replacement marker.xmlcharrefreplace_errorsImplements the 'xmlcharrefreplace' error handling, which replaces an unencodable character with the appropriate XML character reference.backslashreplace_errorsImplements the 'backslashreplace' error handling, which replaces malformed data with a backslashed escape sequence.namereplacenamereplace_errorsImplements the 'namereplace' error handling, which replaces an unencodable character with a \N{...} escape sequence.__build_class__binbreakpointchrglobalshashhexaiterlenlocalsoctroundsumndigitssepbaseexpclosuredont_inherit_feature_versionfromlistextra_tokens_tokenize.TokenizerIterast.AST_filters_mutatedmessagecategoryregistrymodule_globalsstacklevelskip_file_prefixes__callback____bytes__weakref.CallableProxyTypeweakref.ProxyTypeweakref.ReferenceType__parameters__Type variables in the types.UnionType.__args__types.UnionTypeRepresent a PEP 604 union type E.g. for int | strrsplitjoincapitalizecasefoldtitleexpandtabssplitlinesswapcaseisasciiislowerisupperistitleisspaceisdecimalisdigitisnumericisalphaisalnumisidentifierisprintablezfillformat_map__getnewargs__formatter_field_name_splitsplit the argument as a field nameformatter_parserparse the argument as a format stringkeependstabsizestring helper module%lld%td%jd%X%lX%llX%zX%tX%jX%lx%llx%zx%tx%jx%llu%tu%ju%o%lo%llo%zo%to%jofieldnameiteratorformatteriteratorstr_iteratorstr_ascii_iteratorEncodingMap__bound____constraints____covariant____contravariant____infer_variance____typing_subst____mro_entries____origin__Represents positional arguments.kwargsRepresents keyword arguments.__typing_prepare_subst____value____init_subclass__Function to initialize subclasses.covariantcontravariantinfer_variancetyping.ParamSpecKwargstyping.ParamSpecArgstyping.ParamSpectyping.TypeVarTupletyping.TypeVartyping.Genericparamspecargsparamspeckwargstyping.TypeAliasType__mro____abstractmethods____text_signature____basicsize____itemsize____flags____weakrefoffset____base__mro__prepare____prepare__() -> dict used to create the namespace for the class statement__instancecheck____subclasscheck__the object's class__subclasshook____thisclass__the class invoking super()__self__the instance invoking super(); may be None__self_class__the type of the instance invoking super(); may be None_buffer_wrapper__new__($type, *args, **kwargs) -- Create and return a new object. See help(type) for accurate signature.__getattribute____getattr____repr____repr__($self, /) -- Return repr(self).__hash____hash__($self, /) -- Return hash(self).__call____call__($self, /, *args, **kwargs) -- Call self as a function.__str____str__($self, /) -- Return str(self).__getattribute__($self, name, /) -- Return getattr(self, name).__setattr__($self, name, value, /) -- Implement setattr(self, name, value).__delattr__($self, name, /) -- Implement delattr(self, name).__lt____lt__($self, value, /) -- Return selfvalue.__ge____ge__($self, value, /) -- Return self>=value.__iter____iter__($self, /) -- Implement iter(self).__next____next__($self, /) -- Implement next(self).__get____get__($self, instance, owner=None, /) -- Return an attribute of instance, which is of type owner.__set____set__($self, instance, value, /) -- Set an attribute of instance to value.__delete____delete__($self, instance, /) -- Delete an attribute of instance.__init__($self, /, *args, **kwargs) -- Initialize self. See help(type(self)) for accurate signature.__new__(type, /, *args, **kwargs) -- Create and return new object. See help(type) for accurate signature.__del____buffer____buffer__($self, flags, /) -- Return a buffer object that exposes the underlying memory of the object.__release_buffer____release_buffer__($self, buffer, /) -- Release the buffer object that exposes the underlying memory of the object.__await____await__($self, /) -- Return an iterator to be used in await expression.__aiter____aiter__($self, /) -- Return an awaitable, that resolves in asynchronous iterator.__anext____anext__($self, /) -- Return a value or raise StopAsyncIteration.__add____add__($self, value, /) -- Return self+value.__radd____radd__($self, value, /) -- Return value+self.__sub____sub__($self, value, /) -- Return self-value.__rsub____rsub__($self, value, /) -- Return value-self.__mul____mul__($self, value, /) -- Return self*value.__rmul____rmul__($self, value, /) -- Return value*self.__mod____mod__($self, value, /) -- Return self%value.__rmod____rmod__($self, value, /) -- Return value%self.__divmod____divmod__($self, value, /) -- Return divmod(self, value).__rdivmod____rdivmod__($self, value, /) -- Return divmod(value, self).__pow____pow__($self, value, mod=None, /) -- Return pow(self, value, mod).__rpow____rpow__($self, value, mod=None, /) -- Return pow(value, self, mod).__neg____neg__($self, /) -- -self__pos____pos__($self, /) -- +self__abs____abs__($self, /) -- abs(self)__bool____bool__($self, /) -- True if self else False__invert____invert__($self, /) -- ~self__lshift____lshift__($self, value, /) -- Return self<>value.__rrshift____rrshift__($self, value, /) -- Return value>>self.__and____and__($self, value, /) -- Return self&value.__rand____rand__($self, value, /) -- Return value&self.__xor____xor__($self, value, /) -- Return self^value.__rxor____rxor__($self, value, /) -- Return value^self.__or____or__($self, value, /) -- Return self|value.__ror____ror__($self, value, /) -- Return value|self.__int____int__($self, /) -- int(self)__float____float__($self, /) -- float(self)__iadd____iadd__($self, value, /) -- Return self+=value.__isub____isub__($self, value, /) -- Return self-=value.__imul____imul__($self, value, /) -- Return self*=value.__imod____imod__($self, value, /) -- Return self%=value.__ipow____ipow__($self, value, /) -- Return self**=value.__ilshift____ilshift__($self, value, /) -- Return self<<=value.__irshift____irshift__($self, value, /) -- Return self>>=value.__iand____iand__($self, value, /) -- Return self&=value.__ixor____ixor__($self, value, /) -- Return self^=value.__ior____ior__($self, value, /) -- Return self|=value.__floordiv____floordiv__($self, value, /) -- Return self//value.__rfloordiv____rfloordiv__($self, value, /) -- Return value//self.__truediv____truediv__($self, value, /) -- Return self/value.__rtruediv____rtruediv__($self, value, /) -- Return value/self.__ifloordiv____ifloordiv__($self, value, /) -- Return self//=value.__itruediv____itruediv__($self, value, /) -- Return self/=value.__index____index__($self, /) -- Return self converted to an integer, if self is suitable for use as an index into a list.__matmul____matmul__($self, value, /) -- Return self@value.__rmatmul____rmatmul__($self, value, /) -- Return value@self.__imatmul____imatmul__($self, value, /) -- Return self@=value.__len____len__($self, /) -- Return len(self).__getitem____getitem__($self, key, /) -- Return self[key].__setitem____setitem__($self, key, value, /) -- Set self[key] to value.__delitem____delitem__($self, key, /) -- Delete self[key].__contains____contains__($self, key, /) -- Return bool(key in self).__iadd__($self, value, /) -- Implement self+=value.__imul__($self, value, /) -- Implement self*=value.dictionary for instance variables__weakref__list of weak references to the objecttuple_iteratorstructseqindicesdiscarddifferencedifference_updateintersectionintersection_updateisdisjointissubsetissupersetsymmetric_differencesymmetric_difference_updateunion typeset_iteratorlongrange_iteratorrange_iteratorpickle.PickleBufferWrapper for potentially out-of-band buffersNotImplementedTypeNoneType<<===>=types.SimpleNamespace__dir__() -> list specialized dir() implementationdocmoduledefbuiltin_methodbuiltin_function_or_methodnbytesreadonlyndimshapestridessuboffsetsc_contiguousf_contiguouscontiguoustolisttoreadonly_from_flagsbytes_per_sepordermemory_iteratormanagedbufferpopitemmove_to_endlastodict_keysodict_itemsodict_valuescollections.OrderedDictodict_iteratordictionary that this view refers todict_valuesdict_itemsdict_keysdict_keyiteratordict_valueiteratordict_itemiteratordict_reversevalueiteratordict_reverseitemiteratordict_reversekeyiteratorrealthe real part of a complex numberthe imaginary part of a complex numbernumeratorthe numerator of a rational number in lowest termsdenominatorthe denominator of a rational number in lowest termsconjugateReturns self, the complex conjugate of any int.bit_lengthbit_countas_integer_ratio__trunc__Truncating an Integral returns itself.__floor__Flooring an Integral returns itself.__ceil__Ceiling of an Integral returns itself.is_integerbits_per_digitsize of a digit in bitssizeof_digitsize in bytes of the C type used to represent a digitdefault_max_str_digitsmaximum string conversion digits limitationstr_digits_check_thresholdminimum positive value for int_max_str_digitssys.int_info__getitem__($self, index, /) -- Return self[index].sortlist_reverseiteratorlist_iteratoranext_awaitablecallable_iteratorforceInterpreterID__closure____globals____isabstractmethod____func____wrapped__argdefsf_backf_localsf_linenof_tracef_lastif_globalsf_builtinsf_trace_opcodesf_trace_linesDBL_MAX -- maximum representable finite floatmax_expDBL_MAX_EXP -- maximum int e such that radix**(e-1) is representablemax_10_expDBL_MAX_10_EXP -- maximum int e such that 10**e is representableDBL_MIN -- Minimum positive normalized floatmin_expDBL_MIN_EXP -- minimum int e such that radix**(e-1) is a normalized floatmin_10_expDBL_MIN_10_EXP -- minimum int e such that 10**e is a normalized floatdigDBL_DIG -- maximum number of decimal digits that can be faithfully represented in a floatmant_digDBL_MANT_DIG -- mantissa digitsepsilonDBL_EPSILON -- Difference between 1 and the next representable floatradixFLT_RADIX -- radix of exponentroundsFLT_ROUNDS -- rounding mode used for arithmetic operationssys.float_infoEncoding of the filestderrprintername of the generatorqualified name of the generatorgi_yieldfromobject being iterated by yield from, or Nonegi_runninggi_suspendedname of the coroutinequalified name of the coroutinecr_awaitobject being awaited on, or Nonecr_runningcr_suspendedcr_originname of the async generatorqualified name of the async generatorag_awaitag_suspendedag_runningaclosegeneratorasync_generator_wrapped_valueasync_generator_asendcoroutine_wrapperA wrapper object implementing __await__ for coroutines.async_generator_athrowasync_generatorcoroutineType variables in the GenericAlias.__typing_unpacked_tuple_args____unpacked__generic_alias_iteratortypes.GenericAlias__traceback____context__exception context__cause__exception cause__suppress_context__with_tracebackadd_notegenerator return valueexception codeexception messageexceptionsnested exceptionsmodule namemodule pathname imported from modulePOSIX exception codeexception strerrorexception filenamefilename2second exception filenameattribute nameexception msgexception linenoexception offsetexception textexception end linenoend_offsetexception end offsetprint_file_and_lineexception print_file_and_lineexception encodingexception objectexception startexception endexception reasonUnicodeTranslateErrorUnicode translation error.UnicodeEncodeErrorUnicode encoding error.UnicodeDecodeErrorUnicode decoding error.TabErrorImproper mixture of spaces and tabs.ConnectionResetErrorConnection reset.ConnectionRefusedErrorConnection refused.ConnectionAbortedErrorConnection aborted.BrokenPipeErrorBroken pipe.UnicodeErrorUnicode related error.UnboundLocalErrorLocal name referenced but not bound to a value.RecursionErrorRecursion limit exceeded.NotImplementedErrorMethod or function hasn't been implemented yet.ModuleNotFoundErrorModule not found.KeyErrorMapping key not found.IndexErrorSequence index out of range.IndentationErrorImproper indentation.TimeoutErrorTimeout expired.ProcessLookupErrorProcess not found.PermissionErrorNot enough permissions.NotADirectoryErrorOperation only works on directories.IsADirectoryErrorOperation doesn't work on directories.InterruptedErrorInterrupted by signal.FileNotFoundErrorFile not found.FileExistsErrorFile already exists.ConnectionErrorConnection error.ChildProcessErrorChild process error.I/O operation would block.UserWarningBase class for warnings generated by user code.UnicodeWarningBase class for warnings about Unicode related problems, mostly related to conversion problems.SyntaxWarningBase class for warnings about dubious syntax.RuntimeWarningBase class for warnings about dubious runtime behavior.ResourceWarningBase class for warnings about resource usage.PendingDeprecationWarningBase class for warnings about features which will be deprecated in the future.ImportWarningBase class for warnings about probable mistakes in module importsFutureWarningBase class for warnings about constructs that will change semantically in the future.EncodingWarningBase class for warnings about encodings.DeprecationWarningBase class for warnings about deprecated features.BytesWarningBase class for warnings about bytes and buffer related problems, mostly related to conversion from str or comparing to str.ZeroDivisionErrorSecond argument to a division or modulo operation was zero.OverflowErrorResult too large to be represented.FloatingPointErrorFloating-point operation failed.Base class for warning categories.ValueErrorInappropriate argument value (of correct type).TypeErrorInappropriate argument type.SystemErrorInternal error in the Python interpreter. Please report this to the Python maintainer, along with the traceback, the Python version, and the hardware/OS platform and version.SyntaxErrorInvalid syntax.StopIterationSignal the end from iterator.__next__().StopAsyncIterationSignal the end from iterator.__anext__().RuntimeErrorUnspecified run-time error.ReferenceErrorWeak ref proxy used after referent went away.Base class for I/O related errors.NameErrorName not found globally.MemoryErrorOut of memory.LookupErrorBase class for lookup errors.ImportErrorImport can't find module, or can't find name in module.EOFErrorRead beyond end of file.BufferErrorBuffer error.AttributeErrorAttribute not found.AssertionErrorAssertion failed.ArithmeticErrorBase class for arithmetic errors.SystemExitRequest to exit from the interpreter.KeyboardInterruptProgram interrupted by user.Request that a generator exit.Common base class for all non-exit exceptions.BaseExceptionGroupA combination of multiple unrelated exceptions.BaseExceptionCommon base class for all exceptions__objclass__D.get(k[,d]) -> D[k] if k in D, else d. d defaults to None.D.keys() -> a set-like object providing a view on D's keysD.values() -> an object providing a view on D's valuesD.items() -> a set-like object providing a view on D's itemsD.copy() -> a shallow copy of DD.__reversed__() -> reverse iteratorfgetfdel__set_name__wrapper_descriptorgetset_descriptormember_descriptorclassmethod_descriptormethod_descriptormappingproxymethod-wrapper__complex__co_lnotab_co_code_adaptiveco_varnamesco_cellvarsco_freevarsco_codeco_argcountco_posonlyargcountco_kwonlyargcountco_stacksizeco_flagsco_nlocalsco_constsco_namesco_filenameco_nameco_qualnameco_firstlinenoco_linetableco_exceptiontableco_linesco_positions_varname_from_opargopargline_iteratorpositions_iteratorthe function (or other callable) implementing a methodthe instance to which a method is boundcell_contentsPyCapsulebytes_iterator__alloc__bytearray_iteratorcontinuenonlocalfinallyreturnassertglobalexceptraiseyieldbreakwhilepasswithelifelsefortrynotifisENDMARKERNAMENUMBERSTRINGNEWLINEINDENTDEDENTLPARRPARLSQBRSQBCOLONCOMMASEMIPLUSMINUSSTARSLASHVBARAMPERLESSGREATEREQUALDOTPERCENTLBRACERBRACEEQEQUALNOTEQUALLESSEQUALGREATEREQUALTILDECIRCUMFLEXLEFTSHIFTRIGHTSHIFTDOUBLESTARPLUSEQUALMINEQUALSTAREQUALSLASHEQUALPERCENTEQUALAMPEREQUALVBAREQUALCIRCUMFLEXEQUALLEFTSHIFTEQUALRIGHTSHIFTEQUALDOUBLESTAREQUALDOUBLESLASHDOUBLESLASHEQUALATEQUALRARROWELLIPSISCOLONEQUALEXCLAMATIONOPAWAITASYNCTYPE_IGNORETYPE_COMMENTSOFT_KEYWORDFSTRING_STARTFSTRING_MIDDLEFSTRING_ENDCOMMENTNLutf810devwarn_default_encoding----help--versionbBc:dEhiIJm:OPqRsStuvVW:xX:?-c-merror::BytesWarningdefault::BytesWarningsurrogateescapestrictalwaysneverdefault-,showrefcountfaulthandlerimporttimeno_debug_rangestracemallocperfint_max_str_digitspycache_prefixutf-8ascii.frozen_modulesonoffignorebackslashreplacesurrogatepassxmlcharrefreplacerb__main__check-hash-based-pycshelp-allhelp-envhelp-xoptionsrid\ZVS\)% &{i8&&&SS88wtb1LL11ptZ mrA afR 5_FA"_,+J)> H.7$OC4M7)"gdSP;$,&JG>XP ;)ZLP5/nq00000000f tc`jw qb))))))))!Z^/3RNK5j#[3 jY,UkhpB"4d:oYTOJK w9T8hU2*E0J.u"8x,""YEh[  B&B4<.-\s{/%/B] js  MDDDD04@)=00)/0))00)v1111sEBB= 8)3$.HgA { _?_jeyR`YRL.}DZXMMMMMMMMMMMqMMMTMMMMMMMMMMMMM}gMMi)"H>;81R\wsp<8531.+(& $ 8&8Z]=d<66C~@4F>;ng2|m@p eM+[9C!\;u:d:PI|D;[Mi1' #(-27<{xtqnjgc_[XTPLHD@<840,($  c@qcP@qcP,qjcccccP@ (&$"  (&$"  (&$"   (&$"  qM5;A>;741-*(&$"   e  + PMIEB=>;9y77531/-+)'%#!7531/-+)'%#! SS-9/-+)'%#!  < <       2 (&$" ****************************** *  ********************************(&$" ***************************************   % ) , 0 3 7 : > A                 v y s s p   ~{wsolhd`\XTPLHD@<840,($  $ ` s  J y  dHFDB@><:8642/,)%" < H@6,    c 31/-+)'%#!  31/-+)'%#TRPNLJHFDB@>;851.*'$   k k*(&$"  Q1/-+)'%#!/-+)'%#!  .,*(&$" ,*(&$"  x M"8NO &;RR *>V!V.BZ%Z% n!% M"8NO &;RR *>V!V.BZ  R!  G#!!#!#!#!!#!!#!!!!#!#!#!# ,*(&$" :<@BFHLN,*(&$" :<@BFHLN*(&$"  |*(&$"*"$"  H"           AxOL*-!$'I003^ ////|ltd17ZmX?=Fl>C 2#(- $DJJOJZ]zD"%(8lMS0=444)zzzzzazzzzzzIzzzzzz @zzpzzzzz zzzzzzzz"TT"TTTTT TT'T'T''TTTTTTTTTTTTT,TT"T TT'T'TT'2S~ UZ#BO_PyRuntimeState_Initinit_runtimePyConfig_SetString_PyPreConfig_Readpreconfig_init_allocatorpreconfig_init_utf8_mode_Py_PreInitializeFromPyArgv_PyPreConfig_Write_PyArgv_AsWstrListPy_InitializeFromConfig_PyImport_Initpycore_init_runtimepycore_create_interpreterpyinit_core_reconfigure_Py_HashRandomization_Init_PyConfig_Copyconfig_parse_cmdlineconfig_update_argvconfig_init_pycache_prefixcore_read_precmdlineconfig_init_stdio_encodingconfig_init_int_max_str_digitsconfig_init_tracemallocconfig_init_hash_seed_PyConfig_ReadEnvironment variables that change behavior: PYTHONSTARTUP : file executed on interactive startup (no default) PYTHONPATH : '%lc'-separated list of directories prefixed to the default module search path. The result is sys.path. PYTHONHOME : alternate directory (or %lc). The default module search path uses %s. PYTHONPLATLIBDIR: override sys.platlibdir PYTHONCASEOK : ignore case in 'import' statements (Windows) PYTHONIOENCODING: encoding[:errors] used for stdin/stdout/stderr PYTHONHASHSEED : if this variable is set to 'random', a random value is used to seed the hashes of str and bytes objects. It can also be set to an integer in the range [0,4294967295] to get hash values with a predictable seed. PYTHONMALLOC : set the Python memory allocators and/or install debug hooks on Python memory allocators. Use PYTHONMALLOC=debug to install debug hooks. PYTHONCOERCECLOCALE: if this variable is set to 0, it disables the locale coercion behavior. Use PYTHONCOERCECLOCALE=warn to request display of locale coercion and locale compatibility warnings on stderr. PYTHONBREAKPOINT: if this variable is set to 0, it disables the default debugger. It can be set to the callable of your debugger of choice. These variables have equivalent command-line options (see --help for details): PYTHONDEBUG : enable parser debug mode (-d) PYTHONDEVMODE : enable Python Development Mode (-X dev) PYTHONDONTWRITEBYTECODE: don't write .pyc files (-B) PYTHONFAULTHANDLER: dump the Python traceback on fatal errors (-X faulthandler) PYTHONINSPECT : inspect interactively after running script (-i) PYTHONINTMAXSTRDIGITS: limit the size of int<->str conversions; 0 disables the limit (-X int_max_str_digits=N) PYTHONNODEBUGRANGES: don't include extra location information in code objects (-X no_debug_ranges) PYTHONNOUSERSITE: disable user site directory (-s) PYTHONOPTIMIZE : enable level 1 optimizations (-O) PYTHONPERFSUPPORT: support the Linux "perf" profiler (-X perf) PYTHONPROFILEIMPORTTIME: show how long each import takes (-X importtime) PYTHONPYCACHEPREFIX: root directory for bytecode cache (pyc) files (-X pycache_prefix) PYTHONSAFEPATH : don't prepend a potentially unsafe path to sys.path. PYTHONTRACEMALLOC: trace Python memory allocations (-X tracemalloc) PYTHONUNBUFFERED: disable stdout/stderr buffering (-u) PYTHONUTF8 : control the UTF-8 mode (-X utf8) PYTHONVERBOSE : trace import statements (-v) PYTHONWARNDEFAULTENCODING: enable opt-in EncodingWarning for 'encoding=None' (-X warn_default_encoding) PYTHONWARNINGS : warning control (-W) The following implementation-specific options are available: -X dev : enable Python Development Mode; also PYTHONDEVMODE -X faulthandler: dump the Python traceback on fatal errors; also PYTHONFAULTHANDLER -X frozen_modules=[on|off]: whether to use frozen modules; the default is "on" for installed Python and "off" for a local build -X importtime: show how long each import takes; also PYTHONPROFILEIMPORTTIME -X int_max_str_digits=N: limit the size of int<->str conversions; 0 disables the limit; also PYTHONINTMAXSTRDIGITS -X no_debug_ranges: don't include extra location information in code objects; also PYTHONNODEBUGRANGES -X perf: support the Linux "perf" profiler; also PYTHONPERFSUPPORT=1 -X pycache_prefix=PATH: write .pyc files to a parallel tree instead of to the code tree; also PYTHONPYCACHEPREFIX -X showrefcount: output the total reference count and number of used memory blocks when the program finishes or after each statement in the interactive interpreter; only works on debug builds -X tracemalloc[=N]: trace Python memory allocations; N sets a traceback limit of N frames (default: 1); also PYTHONTRACEMALLOC=N -X utf8[=0|1]: enable (1) or disable (0) UTF-8 mode; also PYTHONUTF8 -X warn_default_encoding: enable opt-in EncodingWarning for 'encoding=None'; also PYTHONWARNDEFAULTENCODINGconfig_run_filename_abspathPyWideStringList_Insertconfig_get_locale_encoding_PyConfig_Write_PyInterpreterState_Enableinit_interpreterinit_interp_settingsinit_threadstategilstate_tss_setdestroy_gilinit_interp_create_gilcreate_giltake_gil_PySys_InitCore_PySys_SetPreliminaryStderr_PyImport_InitCorepycore_init_typespycore_init_builtins_PySys_Create_PyErr_InitTypes_PyExc_InitGlobalObjects_PyContext_Init_PyFloat_InitTypes_PyUnicode_InitTypes_PyLong_InitTypes_PyTypes_InitTypes_PyGC_Initpycore_interp_init_PyUnicode_InitInternDict_PyAtExit_InitCopyright (c) 2001-2023 Python Software Foundation. All Rights Reserved. Copyright (c) 2000 BeOpen.com. All Rights Reserved. Copyright (c) 1995-2001 Corporation for National Research Initiatives. All Rights Reserved. Copyright (c) 1991-1995 Stichting Mathematisch Centrum, Amsterdam. All Rights Reserved. init_global_interned_stringsintern_staticSny]rszzz z zzzz !#$%1234567kkk<=]]]]DEjGjjJKjjjjjjjSdU|W|YZ[\]^_`abcdefghijklmntt_rstuvwxyz{|}~__}}<<\\\{ _PyTrash_get_statePyObject_GC_Trackppp@``h`H` `````````````````P`X``0`x`8`(``````p`(hh8h@hHhhhh0P0x@x(H8XH@``PPPPn_sequence_fieldsn_fieldsn_unnamed_fields__match_args___PyExc_InitState_Py_GetConfigvgetargs1_implPyInterpreterState_Gettok_backup67777 7777777777 7177777777777777777777777777 7 7777777777777777777777777777_PyEval_EvalFrameDefault_Py_HandlePendingtype_traverse@(  UUUUUUUU?33333333*$I$I$qqqE]tEUUUUUUU;;I$I$I8885P^Cy 0 0 0 袋. ,d! p= ףp= ؉؉ %^B{ $I$I$ =B!B|PuPuPqqpyinit_mainpyinit_main_reconfigureinit_stdio_encodinginit_fs_encodinginit_interp_main_PyFaulthandler_Initinit_sys_streamsinit_set_builtins_openinit_import_siteadd_main_module_PyImport_InitExternal<=  PyObject_CallFinalizerFromDealloc @ C0  _PyPathConfig_UpdateGlobalsrPyEval_SaveThreaddrop_gilPyEval_RestoreThread_PyInterpreterState_SetRunningMainPyInterpreterState_Deletezapthreadststate_delete_commongilstate_tss_clear_PyInterpreterState_GetAllocatedBlocks?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZrr"sr sPKicTeZdZdZdZddZdZdZdZdZ d Z d Z d Z d Z d Zy)razipimporter(archivepath) -> zipimporter object Create a new zipimporter instance. 'archivepath' must be a path to a zipfile, or to a specific path inside a zipfile. For example, it can be '/tmp/myimport.zip', or '/tmp/myimport.zip/mydirectory', if mydirectory is a valid directory inside the archive. 'ZipImportError is raised if 'archivepath' doesn't point to a valid Zip archive. The 'archive' attribute of zipimporter objects contains the name of the zipfile targeted. ct|tstdt||s t d|t r|j t t}g} tj|}|jdzdk7r t d| t|}||_||_tj(|ddd|_|j*r|xj*tz c_yy#ttf$r@tj|\}}||k(r t d||}|j|YnwxYw#t $rt#|}|t|<YwxYw)Nzexpected str, not zarchive path is emptypathiiznot a Zip file) isinstancestr TypeErrortyper alt_path_sepreplacepath_sep_bootstrap_external _path_statst_modeOSError ValueError _path_splitappend_zip_directory_cacheKeyError_read_directory_filesarchive _path_joinprefix)selfrr(stdirnamebasenamefiless r __init__zzipimporter.__init__@sY$$0d?@ @ !8tD D << h7D (33D9JJ)h6()9EE /(.E  )44fTrTlC ;; KK8 #K 1Z( (%8$C$CD$I!d?()9EE h' (( /#D)E).  & /s%C, D?,A D;:D;?EENct||}|tj|||St||}t ||rK|j t |}tj|dd}|jj||Sy)zkCreate a ModuleSpec for the specified module. Returns None if the module cannot be found. N) is_packageT)nameloaderr0) _get_module_info _bootstrapspec_from_loader_get_module_path_is_dirr&r ModuleSpecsubmodule_search_locationsr!)r)fullnametarget module_infomodpathrspecs r find_speczzipimporter.find_spechs 'tX6  "..x+V V'tX6GtW%,,z';!,,(48<>//66t< r c&t||\}}}|S)zget_code(fullname) -> code object. Return the code object for the specified module. Raise ZipImportError if the module couldn't be imported. _get_module_coder)r:code ispackager=s r get_codezzipimporter.get_codes $4D(#C i r cHtr|jtt}|}|j|jtzr|t |jtzd} |j |}t|j|S#t$rtdd|wxYw)zget_data(pathname) -> string with file data. Return the data associated with 'pathname'. Raise OSError if the file wasn't found. Nr) rrr startswithr&lenr%r#r _get_data)r)pathnamekey toc_entrys r get_datazzipimporter.get_datas '' h?H   t||h6 73t||h6789C & C(Iy11 &!R% % &s %B B!c&t||\}}}|S)zget_filename(fullname) -> filename string. Return the filename for the specified module or raise ZipImportError if it couldn't be imported. rArCs r get_filenamezzipimporter.get_filenames$4D(#C ir ct||}|td||t||}|rtj|d}n|d} |j |}t|j|jS#t $rYywxYw)zget_source(fullname) -> source string. Return the source code for the specified module. Raise ZipImportError if the module couldn't be found, return None if the archive does contain the module, but has no source for it. Ncan't find module r1 __init__.py.py) r3rr6rr'r%r#rKr&decode)r)r:mirfullpathrNs r get_sourcezzipimporter.get_sourcesdH - : #5h\!BR Rh/ *55dMJHs|H  H-Iy188::  s A== B B cBt||}|td|||S)zis_package(fullname) -> bool. Return True if the module specified by fullname is a package. Raise ZipImportError if the module couldn't be found. rSrT)r3r)r)r:rXs r r0zzipimporter.is_packages/ dH - : #5h\!BR R r cd}tj|tt||\}}}tj j |}|t|tst|}|tj |<||_ |r4t||}tj|j|}|g|_t|ds t |_tj"|j$||t'||j$ tj |}t-j.d|||S#tj |=xYw#t($rt+d|dwxYw)a@load_module(fullname) -> module. Load the module specified by 'fullname'. 'fullname' must be the fully qualified (dotted) module name. It returns the imported module, or raises ZipImportError if it could not be imported. Deprecated since Python 3.10. Use exec_module() instead. zrzipimport.zipimporter.load_module() is deprecated and slated for removal in Python 3.12; use exec_module() instead __builtins__zLoaded module z not found in sys.moduleszimport {} # loaded from Zip {}) _warningswarnDeprecationWarningrBsysmodulesgetr _module_type __loader__r6rr'r&__path__hasattrr]_fix_up_module__dict__execr# ImportErrorr4_verbose_message) r)r:msgrDrEr=modrrYs r load_modulezzipimporter.load_modulesBCs./#3D(#C ikkooh' ;jl;x(C$'CKK ! (h7.99$,,M (z 3/#/  . .s||Xw O s|| $  V++h'C ##$DhPWX   H%  Vxl:STU U VsBD5 E 5E  E%c ddlm}|||S)z5Return the ResourceReader for a module in a zip file.r) ZipReader)importlib.readersrq)r)r:rqs r get_resource_readerzzipimporter.get_resource_readers/x((r c t|j|_|jt|j<y#t$r*tj |jdi|_YywxYw)z)Reload the file data of the archive path.N)r$r&r%r"rpopr)s r invalidate_cacheszzipimporter.invalidate_cachessT )$,,7DK15  .  $ $T\\4 8DK s7:0A-,A-cFd|jt|jdS)Nz)r&rr(rvs r __repr__zzipimporter.__repr__s!&t||nXJt{{m2NNr N)rr r __doc__r.r?rFrOrQrZr0rorsrwryr r r rr.sA "%$P62* ;4 (V)Or z __init__.pycTrUF)z.pycTF)rVFFcD|j|jddzS)N.)r( rpartition)r)r:s r r6r6#s! ;;,,S1!4 44r c0|tz}||jvSrz)rr%)r)rdirpaths r r7r7'sXoG dkk !!r cht||}tD]\}}}||z}||jvs|cSyrz)r6_zip_searchorderr%)r)r:rsuffix isbytecoderErYs r r3r30s? D( +D)9% I&= t{{ " *: r c  tj|}|5|j } |j t d|j }|jt }t|t k7rtd|||ddtk7r |j dd|j }t|tz t z d} |j ||j}|jt}|dkrtd|||||t z}t|t k7rtd|||t|z |z}t|d d } t|d d } || krtd |||| krtd |||| z}|| z } | dkrtd||i} d} |j | |jd}t|dkr td|dddk7rnt|dk7r tdt|dd}t|dd }t|d d}t|dd }t|d d }t|d d}t|dd}t|dd}t|dd}t|dd}t|dd}||z|z} || kDrtd|||| z } |j|}t||k7rtd|| t|j| |z | |z k7rtd|| |dzr|j!}n |j!d}|j)dt*}t-j.||}||||||||f}|| |<| d z }  |j | dddt1j2d! | S#t$rtd||wxYw#t$rtd||wxYw#t$rtd||wxYw#t$rtd||wxYw#t$rtd||wxYw#t$rtd||wxYw#t$rtd||wxYw#t"$r(|j!dj%t&}YqwxYw#|j |wxYw#1swY8xYw)"Nzcan't open Zip file: rr~can't read Zip file: rznot a Zip file: zcorrupt Zip file: zbad central directory size: zbad central directory offset: z&bad central directory size or offset: .EOF read where not expectedsPK  "*zbad local header offset: iasciilatin1/rz!zipimport: found {} names in {!r})_io open_coderrtellseekEND_CENTRAL_DIR_SIZEreadrJSTRING_END_ARCHIVEmaxMAX_COMMENT_LENrfindrEOFErrorrrWUnicodeDecodeError translate cp437_tablerrrr'r4rl)r&fp start_offsetheader_positionbuffer file_sizemax_comment_startdatapos header_size header_offset arc_offsetr-countflagscompresstimedatecrc data_size name_size extra_size comment_size file_offsetr1rts r r$r$OsP ]]7 # wwy n " X--q1"$'')!566{22$'?%A!7GG-.779Djj!347(+;G;)G.577c#&:":;v;"66(+=g[)I.577"+c$i"7#"=(27K*6"R=9M,$'CG;%OV]^^.$'Eg[%QX_`` { *O(=8JA~$'Mg[%Y`ghhEE X(v;?"#@AA"1:.v;"$"#@AA&va|4)&B-8%fRm4%fRm4$VBr]3*6"R=9 *6"R=9 *6"R=9 +F2bM: -fRm< ,VBr]; '*4|C .(+DWK)PW^__z) \779-Dt9 )(+@ )LSZ[[\277;#:;< i@WW,/DWK-PW^__X 5=;;=DL#{{73||C2*55gtD8Y ;dTWXd  m d GGL !g h CUGT Lq P4WK@wOOP X$'>{KL GGL !g sO&S;?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ÇüéâäàåçêëèïîìÄÅÉæÆôöòûùÿÖÜ¢£¥₧ƒáíóúñѪº¿⌐¬½¼¡«»░▒▓│┤╡╢╖╕╣║╗╝╜╛┐└┴┬├─┼╞╟╚╔╩╦╠═╬╧╨╤╥╙╘╒╓╫╪┘┌█▄▌▐▀αßΓπΣσµτΦΘΩδ∞φε∩≡±≥≤⌠⌡÷≈°∙·√ⁿ²■ ctr tjdtdda ddlm} datjd|S#t $r!tjdtdwxYw#dawxYw)Nzzipimport: zlib UNAVAILABLE)can't decompress data; zlib not availableTr decompressFzzipimport: zlib available)_importing_zlibr4rlrzlibr Exceptionrs r _get_decompress_funcrs ##$ABHIIO #   ;<  J##$ABHIIJ sA *A44A77A;c|\}}}}}}}} |dkr tdtj|5} | j|| j d} t | dk7r td| dddk7rtd ||t| d d } t| d d} d| z| z}||z } | j|| j |}t ||k7r t d  ddd|dk(rS t}|dS#t$rtd||wxYw#t$rtd||wxYw#1swY^xYw#t$r td wxYw)Nrznegative data sizerrrrrsPKzbad local file header: rzzipimport: can't read datari) rrrrrrrJrrrr)r&rNdatapathrrrrrrrrrrrrraw_datars r rKrK sMVJHh 9k4s1}122 w 2 T GGK  v;" 89 9 "1: & #:7+!FWU U"6"R=1 #F2bM2 9nz1 {"  T GGK 779% x=I %67 7 &/ 41}J)+  h $$? T #8 !D7S S T  T #8 !D7S S T) B JHIIJsGE DA+E 0D,*E < ED))E ,EE  EE*c$t||z dkS)Nr)abs)t1t2s r _eq_mtimer7s rBw<1 r c\||d}tj|||}|dzdk7}|r{|dzdk7}tjdk7r|stjdk(rt ||} | tj tj | } tj|| ||nSt||\} } | rBtt|dd| rt|dd | k7rtjd |ytj|d d} t| t st#d |d | S) N)r1rrrr~neveralwaysrrrzbytecode is stale for zcompiled module z is not a code object)r _classify_pyc_impcheck_hash_based_pycs_get_pyc_source source_hash_RAW_MAGIC_NUMBER_validate_hash_pyc_get_mtime_and_size_of_sourcerrr4rlmarshalloadsr _code_typer)r)rLrYr:r exc_detailsr hash_based check_source source_bytesr source_mtime source_sizerDs r _unmarshal_coder?sAK - -dHk JE!Jt|q(  & &' 1!;!;x!G*4:L'"..'99  $66+x> *$ 9 " k nT!BZ8,G"42;/;>++,XL9; ==bc #D dJ '*8,6KLMM Kr cN|jdd}|jdd}|S)Ns   )r)sources r _normalize_line_endingsrls' ^^GU +F ^^E5 )F Mr c6t|}t||ddS)NrjT) dont_inherit)rcompile)rLrs r _compile_sourcerss $V ,F 68V$ ??r c ztj|dz dz|dz dz|dz|dz |dz dz|dzdzd d d f S) N i ?r~r)rmktime)drs r _parse_dostimerysY ;; a4 a3 D R a4 TQ B r c |dddvsJ|dd}|j|}|d}|d}|d}t|||fS#tttf$rYywxYw)Nrcor)rr)r%rr# IndexErrorr)r)rrNrruncompressed_sizes r rrs~ BCyJ&&&CRyKK% ||%aLdD)+<<< j) ,s9<AAc|dddvsJ|dd} |j|}t|j|S#t$rYywxYw)Nrr)r%rKr&r#)r)rrNs r rrs[ 9 "" " 9D2KK% y11 s5 AAct||}d}tD]\}}}||z}tjd|jt |d |j |}|d} t|j|} d} |r t|| ||| } n t| | } | |d} | || fcS|rd|} t| ||td||#t$r } | }Yd} ~ Ed} ~ wwxYw#t$rYwxYw)Nz trying {}{}{}r~) verbosityrzmodule load failed: rTrS) r6rr4rlr&rr%rKrrkrr#r)r)r:r import_errorrrrErYrNr=rrDexcrms r rBrBs" D( +DL)9% I&=##OT\\8Xabc , H-I lGT\\95DD'*4(HdSD'w5|lGG+ +/*:2 (7C 84, F #5h\!BR R#'#&L'   s* C"9C  CCC" C.-C.).r{_frozen_importlib_externalrrr_frozen_importlibr4rrrrarr^__all__rpath_separatorsrrkrr"rrdrrr _LoaderBasicsrrr6r7r3r$rrrrKrr__code__rrrrrrrBr r r r s3  9E&   ] +  ' '"22126  [ Cy "dO%33dOZd+ ud+ 5">{J/ : *(%\&P/** + @  & 2 Sr cdZdaddlZddlZddlZddlZddlZejdk(Zer ddl Z ddl Z nddl Z erddgZ ndgZ ede DsJe dZee Zdj%e Z e Dchc]}d| c}Zd Zd ZeezZd ZeZd Zd ZdZerdZndZdZdZdZdZ dZ!erdZ"ndZ"dZ#dNdZ$e%e$jLZ'djQdddzZ)e*jWe)dZ,dZ-dZ.d gZ/ere/jad!ejbZ2d"gZ3e3xZ4Z5dOdd#d$Z6d%Z7d&Z8d'Z9d(Z:d)Z;d*ZdPd-Z?dQd.Z@dRd/ZAd0ZBeCZDdOdeDd1d2ZEd3ZFGd4d5ZGGd6d7ZHGd8d9eHZIGd:d;ZJGd<d=eJeIZKGd>d?eJeHZLGd@dAeJeHZMGdBdCZNGdDdEZOeOZPGdFdGZQGdHdIZRdOdJZSdKZTdLZUdMZVycc}w)Sa^Core implementation of path-based import. This module is NOT meant to be directly imported! It has been designed such that it can be bootstrapped into Python as the implementation of import. As such it requires the injection of specific modules and attributes in order to work. One should use importlib as the public-facing version of this module. Nwin32\/c#8K|]}t|dk(yw)N)len).0seps & r .s 4OS3s8q=Os:)win)cygwindarwinctjjtr/tjjtrdndfd}|Sd}|S)N PYTHONCASEOKs PYTHONCASEOKcbtjj xrtjvS)z^True if filenames must be checked case-insensitively and ignore environment flags are not set.)sysflagsignore_environment_osenvironkeysr _relax_casez%_make_relax_case.._relax_caseCs$yy333Js{{8J Jcy)z5True if filenames must be checked case-insensitively.Frrr rz%_make_relax_case.._relax_caseGsr)rplatform startswith_CASE_INSENSITIVE_PLATFORMS#_CASE_INSENSITIVE_PLATFORMS_STR_KEY)rrs @r _make_relax_caser#<sN ||:; << " "#F G C!C K   rc>t|dzjddS)z*Convert a 32-bit integer to little-endian.little)intto_bytes)xs r _pack_uint32r+Os FZ  ) )!X 66rcNt|dk(sJtj|dS)z/Convert 4 bytes in little-endian to an integer.r&r'rr( from_bytesdatas r _unpack_uint32r1T# t9>> >>$ ))rcNt|dk(sJtj|dS)z/Convert 2 bytes in little-endian to an integer.r'r-r/s r _unpack_uint16r5Yr2rc|syt|dk(r|dSd}g}ttj|D]\}}|j t s|j t r$|jtxs|}t|zg}T|j dr9|j|jk7r|}|g}|j||xs|}|j||Dcgc]}|s|jt}}t|dk(r|ds |tzS|tj|zScc}w)Replacement for os.path.join().r rrr ) rmapr_path_splitrootr path_sep_tupleendswithrstrippath_separatorspath_sepcasefoldappendjoin) path_partsrootpathnew_roottailps r _path_joinrH`s( z?a a= !#"5"5zBNHd"">2h6G6G6W7?4 4(""3'==?h&7&7&99$D 6DKK%'4 D!C48=4a1)4= t9>$q'(? "hmmD))) >s 0E8Ec|tj|Dcgc]}|r|jtc}Scc}w)r7)r>rAr<r=)rBparts r rHrH~s>}}*4>*4$#kk/:*4>? ?>s9c`tfdtD}|dkrdfSd||dzdfS)z Replacement for os.path.split().c3@K|]}j|ywN)rfind)rrGrDs r r z_path_split..s 3?aDJJqM?srr Nr)maxr=)rDis` r _path_splitrQs> 3? 33A1u4x 8T!a%&\ !!rc,tj|S)z~Stat the path. Made a separate function to make it easier to override in experiments (e.g. cache stat results). )rstatrDs r _path_statrUs 88D>rc\ t|}|jdz|k(S#t$rYywxYw)z1Test whether the path is the specified mode type.Fi)rUOSErrorst_mode)rDmode stat_infos r _path_is_mode_typer[s=t$     (T 11 s  ++ct|dS)zReplacement for os.path.isfile.i)r[rTs r _path_isfiler]s dH --rcF|stj}t|dS)zReplacement for os.path.isdir.i@)rgetcwdr[rTs r _path_isdirr`s zz| dH --rc|sytj|djdd}t|dkDxr$|j dxs|j dS)Replacement for os.path.isabs.Frrrrz\\)rr9replacerr r;)rDrCs r _path_isabsrdsT""4(+33C>4y1}Q$//&"9"PT]]4=PQrc,|jtS)rb)r r=rTs r rdrds//rct|s=tD]}|jd|}tt j |S|S)z Replacement for os.path.abspath..)rdr= removeprefixrHrr_)rDr s r _path_abspathrisB t "C$$qY/D##**,-- rc|dt|}tj|tjtjztj z|dz} t j|d5}|j|dddtj||y#1swY xYw#t$r' tj|#t$rYwxYwwxYw)zBest-effort function to write data to a path atomically. Be prepared to handle a FileExistsError if concurrent writing of the temporary file is attempted.rgwbN) idropenO_EXCLO_CREATO_WRONLY_ioFileIOwritercrWunlink)rDr0rYpath_tmpfdfiles r _write_atomicrys qD #H (**s{{*S\\94%< IB ZZD !T JJt " Hd#" !   JJx      sHB/2B#B/#B,(B// C9CC CCCCi r4r's __pycache__zopt-z.pyz.pywz.pyc) optimizationc<|/tjdt| d}t||rdnd}t j |}t |\}}|jd\}}}tjj} | tddj|r|n||| g} |:tjjdk(rd}ntjj}t|}|dk7r+|j!st#|d | dt$|} | t&dz} tj(Qt+|}|dd k(r|dt,vr|d d}t/tj(|j1t,| St/|t2| S) aGiven the path to a .py file, return the path to its .pyc file. The .py file does not need to exist; this simply returns the path to the .pyc file calculated as if the .py file were imported. The 'optimization' parameter controls the presumed optimization level of the bytecode file. If 'optimization' is not None, the string representation of the argument is taken and verified to be alphanumeric (else ValueError is raised). The debug_override parameter is deprecated. If debug_override is not None, a True value is the same as setting 'optimization' to the empty string while a False value is equivalent to setting 'optimization' to '1'. If sys.implementation.cache_tag is None then NotImplementedError is raised. NzFthe debug_override parameter is deprecated; use 'optimization' insteadz2debug_override or optimization must be set to Noner rrg$sys.implementation.cache_tag is Nonerz is not alphanumericr r4) _warningswarnDeprecationWarning TypeErrorrfspathrQ rpartitionrimplementation cache_tagNotImplementedErrorrAroptimizestrisalnum ValueError_OPTBYTECODE_SUFFIXESpycache_prefixrir=rHlstrip_PYCACHE) rDdebug_overrider{messageheadrFbaser resttagalmost_filenamefilenames r cache_from_sourcers$!01C E  #JGG$ $+r ::d DT"JD$ooc*OD#t   & &C {!"HIIgg$cBCO 99   "L99--L|$Lr##% //CDE E,-Qtf\NC!21!55H %T" 7c>d1g_<8D    KK (   dHh //rc$tjj tdt j |}t |\}}d}tjKtjjt}|j|tzr|t|d}d}|s+t |\}}|tk7rttd||jd}|dvrtd||d k(rm|j!dd d }|jt"std t"|tt"d}|j%std |d|j'dd} t)|| t*dzS)anGiven the path to a .pyc. file, return the path to its .py file. The .pyc file does not need to exist; this simply returns the path to the .py file calculated to correspond to the .pyc file. If path does not conform to PEP 3147/488 format, ValueError will be raised. If sys.implementation.cache_tag is None then NotImplementedError is raised. Nr}FTz not bottom-level directory in rg>r4zexpected only 2 or 3 dots in rr4z5optimization portion of filename does not start with zoptimization level z is not an alphanumeric valuer)rrrrrrrQrr<r=r r>rrrcountrsplitrr partitionrHSOURCE_SUFFIXES) rDrpycache_filenamefound_in_pycache_prefix stripped_pathpycache dot_countr{ opt_level base_filenames r source_from_cacher(s ##+!"HII ::d D(.D # %**11/B ??=83 4M*+,D&* # "#D) g h z)H $x)* * &&s+I89I8LMNN a'..sA6r: &&t,%%)H./ / T,   "2<2BC223 3$..s3A6M dMOA,>> ??rct|dk(ry|jd\}}}|r|jdddk7r|S t|}t |r|S|S#tt f$r|dd}Y%wxYw)zConvert a bytecode file path to a source path (if possible). This function exists purely for backwards-compatibility for PyImport_ExecCodeModuleWithFilenames() in the C API. rNrgpy)rrlowerrrrr]) bytecode_pathr_ extension source_paths r _get_sourcefilerPs =Q&11#6D!Y 9??$R+t3)' 6 '{3;FF  ,)#CR( )s AA10A1c|jttr t|S|jtt r|Sy#t$rYywxYwrM)r;tuplerrrr)rs r _get_cachedrcsW/0 $X. .   5!23 4 #   s A AAc^ t|j}|dz}|S#t$rd}YwxYw)z3Calculate the mode permissions for a bytecode file.rk)rUrXrW)rDrYs r _calc_moderos=$''  EMD K s  ,,cZdfd }ttj}nd}|||S)zDecorator to verify that the module being requested matches the one the loader can handle. The first argument (self) must define _name which the second argument is compared against. If the comparison fails then ImportError is raised. c| |j}n,|j|k7rtd|jd||||g|i|S)Nz loader for z cannot handle name)r ImportError)selfrargskwargsmethods r _check_name_wrapperz(_check_name.._check_name_wrappersR <99D YY$ !%D28<> >dD242622rc dD]&}t||st||t||(|jj |jy)N) __module____name__ __qualname____doc__)hasattrsetattrgetattr__dict__update)newoldrcs r _wrapz_check_name.._wrapsBP3(C'#w*?@Q LL   -rrM) _bootstrapr)rrrs` r _check_namer{s33   .  v& rc,|dd}|tk7r*d|d|}tjd|t|fi|t |dkr&d|}tjd|t |t |dd}|d zrd |d |}t|fi||S) aTPerform basic validity checking of a pyc header and return the flags field, which determines how the pyc should be further validated against the source. *data* is the contents of the pyc file. (Only the first 16 bytes are required, though.) *name* is the name of the module being imported. It is used for logging. *exc_details* is a dictionary passed to ImportError if it raised for improved debugging. ImportError is raised when the magic number is incorrect or when the flags field is invalid. EOFError is raised when the data is found to be truncated. Nr&zbad magic number in z: {}z(reached EOF while reading pyc header of zinvalid flags z in ) MAGIC_NUMBERr_verbose_messagerrEOFErrorr1)r0r exc_detailsmagicrrs r _classify_pycrs !HE (5)<##D'2'1[11 4y2~>''(=>H33D$?O  ! !,"5"5hqk"B CCrloadersubmodule_search_locationsc|!d}t|dr4 |j|}n!tj|} t |}tj|||}d|_ |?tD]1\}}|jt|s!|||}||_ ny|tur(t|dr# |j|}|rg|_n||_|j gk(r+|r)t#|d}|j j%||S#t$rYwxYw#t $rYwxYw#t$rYewxYw)a=Return a module spec based on a file location. To indicate that the module is a package, set submodule_search_locations to a list of directory paths. An empty list is sufficient, though its not otherwise useful to the import system. The loader must take a spec as its only __init__() arg. Nz get_filenameoriginT is_packager)rrrrrrirWr ModuleSpec _set_fileattr_get_supported_file_loadersr;rr _POPULATEr rrQr@) rlocationrrspec loader_classsuffixesr dirnames r spec_from_file_locationr"si 6> * !..t4::h' $X.H  vh ?DD~&A&C "L(  x1%dH5$  'D "Y. 6< ( 9#..t4 68D3*D' &&", !(+A.G  + + 2 27 ; K]      8  s4D D':D6 D$#D$' D32D36 EEct|tsyt}|jdd}|jd|}|||ury| t dt |d|}||dfvr6|||urt nt}|dtjdt|}|J|!||k7rtjdt|S|S)zCHelper function for _warnings.c See GH#97850 for details. N __loader____spec__z+Module globals is missing a __spec__.loaderrz-Module globals; __loader__ != __spec__.loader) rdictobjectgetrrAttributeErrorr~rr)module_globalsmissingrr spec_loaderexcs r _bless_my_loaderr hs nd +hG    d 3F   j' 2D ~ 7? \JK K$'2Kwo% >$/7$:. CCD D 9    "" " f 3 ;   rcZeZdZdZdZdZexrdevZe dZ e dZ e d dZ y) WindowsRegistryFinderz>Meta path finder for modules declared in the Windows registry.z;Software\Python\PythonCore\{sys_version}\Modules\{fullname}zASoftware\Python\PythonCore\{sys_version}\Modules\{fullname}\Debugz_d.pydc tjtj|S#t$r'tjtj|cYSwxYwrM)winregOpenKeyHKEY_CURRENT_USERrWHKEY_LOCAL_MACHINErs r _open_registryz$WindowsRegistryFinder._open_registrysG B>>&":":C@ @ B>>&";";SA A Bs#&-AAc8|jr |j}n |j}|j|dtj ddz} |j |5}tj|d}ddd|S#1swYSxYw#t$rYywxYw)Nz%d.%dr4)fullname sys_versionr ) DEBUG_BUILDREGISTRY_KEY_DEBUG REGISTRY_KEYformatr version_infor(r$ QueryValuerW)clsr* registry_keyrhkeyfilepaths r _search_registryz&WindowsRegistryFinder._search_registrys ??11L++L!!8.58H8H!8L.L"N ##C(D!,,T26) )  s0B B6B B B B BBNc|j|}|y t|tD]B\}}|j t |s!t j|||||}|cSy#t$rYywxYw)Nr)r6rUrWr r;rrspec_from_loader)r2r*rDtargetr5rrrs r find_speczWindowsRegistryFinder.find_specs''1    x !< = FH  x1!22839(H3M:B3D !>  s A11 A=<A=NN)rrrrr.r- _MS_WINDOWSEXTENSION_SUFFIXESr, staticmethodr( classmethodr6r:rrr r"r"sgH  'A8/A#AKBB     rr"c(eZdZdZdZdZdZdZy) _LoaderBasicszSBase class of common code needed by both SourceLoader and SourcelessFileLoader.ct|j|d}|jddd}|jdd}|dk(xr|dk7S)zConcrete implementation of InspectLoader.is_package by checking if the path returned by get_filename has a filename of '__init__.py'.rrgrr4__init__)rQrrr)rr*r filename_base tail_names r r z_LoaderBasics.is_packages]t00:;A> Q/2 '',Q/  *FyJ/FFrcyz*Use default semantics for module creation.Nrrrs r create_modulez_LoaderBasics.create_modulerc|j|j}|td|jdtj t ||j y)zExecute the module.Nzcannot load module z when get_code() returns None)get_coderrr_call_with_frames_removedexecr)rmodulers r exec_modulez_LoaderBasics.exec_modulesS}}V__- < 3FOO3FG889 9,,T4Irc.tj||S)zThis method is deprecated.)r_load_module_shimrr*s r load_modulez_LoaderBasics.load_modules++D(;;rN)rrrrr rIrPrTrrr rArAsG9J.>$5$0/" !34h3>!@4 $ , "6 ( + #33O]4?A0(?L=H JJ (2?    # ! M !d  ==5L)), D ##$9;G''M,E(&"&"2"23D3?#AK(k<P-k<.1,.?A $$[-F'  sY EE D< B!D''D98D9< EE EE E('E(=H HHN) rrrrYr[r_r]rcrhrLrrr rVrVs, 0/ +79OSrrVcdeZdZdZdZdZdZefdZedZ dZ edZ xZ S) FileLoaderzgBase file loader class which implements the loader protocol methods that require file system usage.c ||_||_y)zKCache the module name and the path to the file found by the finder.Nr)rr*rDs r rCzFileLoader.__init__s  rcj|j|jk(xr|j|jk(SrM __class__rrothers r __eq__zFileLoader.__eq__,%//10 / 1rcXt|jt|jz SrMhashrrDrs r __hash__zFileLoader.__hash__DIIdii00rc*tt| |S)zdLoad a module from a file. This method is deprecated. Use exec_module() instead. )superrwrT)rr*r{s r rTzFileLoader.load_modulesZ28<? @s4y)Tyy{*)D#&$yy{'&*)'&sA?%B ?B Bcddlm}||S)Nr) FileReader)importlib.readersr)rrOrs r get_resource_readerzFileLoader.get_resource_readers0$r) rrrrrCr~rrrTrrbr __classcell__)r{s@r rwrw|sX" 11 = =#  rrwc(eZdZdZdZdZdddZy)SourceFileLoaderz>Concrete implementation of SourceLoader using the file system.cJt|}|j|jdS)z!Return the metadata for the path.)rrl)rUst_mtimest_size)rrDrss r r[zSourceFileLoader.path_statss  bjj99rc@t|}|j|||S)N_mode)rr])rrrr0rYs r r_z SourceFileLoader._cache_bytecodes!+&}}]D}==rrkrct|\}}g}|r8t|s-t|\}}|j||r t|s-t|D]$}t ||} t j |& t|||tjd|y#t$rYWt$r"}tjd||Yd}~yd}~wwxYw#t$r!}tjd||Yd}~yd}~wwxYw)zWrite bytes data to a file.zcould not create {!r}: {!r}Nz created {!r}) rQr`r@reversedrHrmkdirFileExistsErrorrWrrry) rrDr0rparentrrBrJrs r r]zSourceFileLoader.set_datas&t, [0&v.LFD   d #[0Z(D-F  &!) - $e ,  ' ' =#  ++,I,2C9   -  ' '(Et(+ - - -s6&B">#C" C-C5CC D#C??DN)rrrrr[r_r]rrr rrsH: > -2-rrceZdZdZdZdZy)SourcelessFileLoaderz-Loader which handles sourceless file imports.c|j|}|j|}||d}t|||tt |dd||S)Nrr)rr)rrbrrrm)rr*rDr0rs r rLzSourcelessFileLoader.get_codes_  *}}T"  dHk2 t RS !  rcy)z'Return None as there is no source code.NrrSs r rczSourcelessFileLoader.get_sourcerN)rrrrrLrcrrr rrs7 rrcPeZdZdZdZdZdZdZdZdZ dZ d Z e d Z y ) rz]Loader for extension modules. The constructor is designed to work with FileFinder. c ||_||_yrMr)rrrDs r rCzExtensionFileLoader.__init__s  rcj|j|jk(xr|j|jk(SrMrzr|s r r~zExtensionFileLoader.__eq__rrcXt|jt|jz SrMrrs r rzExtensionFileLoader.__hash__rrctjtj|}tj d|j |j |S)z(Create an uninitialized extension modulez&extension module {!r} loaded from {!r})rrMrcreate_dynamicrrrD)rrrOs r rIz!ExtensionFileLoader.create_modules@55   '##$LDII / rctjtj|tj d|j |j y)zInitialize an extension modulez(extension module {!r} executed from {!r}N)rrMr exec_dynamicrrrDrrOs r rPzExtensionFileLoader.exec_modules6,,T->->G##$NDII /rcdt|jdtfdtDS)z1Return True if the extension module is a package.rc3.K|] }d|zk(yw)rCNr)rsuffix file_names r r z1ExtensionFileLoader.is_package..s#5!3v V 33!3s)rQrDanyr=)rr*rs @r r zExtensionFileLoader.is_packages0 *1- 5!355 5rcy)z?Return None as an extension module cannot create a code object.NrrSs r rLzExtensionFileLoader.get_coderrcy)z5Return None as extension modules have no source code.NrrSs r rczExtensionFileLoader.get_sourcerrc|jSrrTrSs r rz ExtensionFileLoader.get_filename#rrN)rrrrrCr~rrIrPr rLrcrrrrr rrsC 11/ 5 rrcVeZdZdZdZdZdZdZdZdZ dZ d Z d Z d Z d Zd Zy)_NamespacePatha&Represents a namespace package's path. It uses the module name to find its parent module, and from there it looks up the parent's __path__. When this changes, the module's own path is recomputed, using path_finder. For top-level modules, the parent module's path is sys.path.rc||_||_t|j|_|j |_||_yrM)_name_pathr_get_parent_path_last_parent_path_epoch _last_epoch _path_finderrrrD path_finders r rCz_NamespacePath.__init__4s:  !&t'<'<'>!?;;'rcT|jjd\}}}|dk(ry|dfS)z>Returns a tuple of (parent-module-name, parent-path-attr-name)rgr )rrD__path__)rr)rrdotmes r _find_parent_path_namesz&_NamespacePath._find_parent_path_names;s3**//4R "9 z!!rcb|j\}}ttj||SrM)rrrmodules)rparent_module_namepath_attr_names r rz_NamespacePath._get_parent_pathEs--1-I-I-K*Ns{{#56GGrcZt|j}||jk7s|j|jk7r_|j |j |}|)|j|jr|j|_ ||_|j|_|jSrM) rrrrrrrrrr)r parent_pathrs r _recalculatez_NamespacePath._recalculateIsD1134 $00 0DKK4CSCS4S$$TZZ=DDKK$722!%!@!@DJ%0D "#{{D zzrc4t|jSrM)iterrrs r __iter__z_NamespacePath.__iter__WsD%%'((rc(|j|SrMr)rindexs r __getitem__z_NamespacePath.__getitem__Zs  "5))rc"||j|<yrMr)rrrDs r __setitem__z_NamespacePath.__setitem__]s  5rc4t|jSrM)rrrs r __len__z_NamespacePath.__len__`s4$$&''rc"d|jdS)Nz_NamespacePath()rrs r __repr__z_NamespacePath.__repr__cs a00rc&||jvSrMrritems r __contains__z_NamespacePath.__contains__fst((***rc:|jj|yrM)rr@rs r r@z_NamespacePath.appendis $rN)rrrrrrCrrrrrrrrrr@rrr rr)sFF("H )*!(1+ rrc<eZdZdZdZdZdZdZdZdZ dZ y ) NamespaceLoaderc(t||||_yrM)rrrs r rCzNamespaceLoader.__init__qs#D$ < rcy)NTrrSs r r zNamespaceLoader.is_packagetsrcy)Nr rrSs r rczNamespaceLoader.get_sourcewsrc tddddS)Nr zrNT)rf)rgrSs r rLzNamespaceLoader.get_codezsr:vDAArcyrGrrHs r rIzNamespaceLoader.create_module}rJrcyrMrrs r rPzNamespaceLoader.exec_modules rcntjd|jtj||S)zbLoad a namespace module. This method is deprecated. Use exec_module() instead. z&namespace module loaded with path {!r})rrrrRrSs r rTzNamespaceLoader.load_modules1 ##$L$(JJ 0++D(;;rc2ddlm}||jS)Nr)NamespaceReader)rrr)rrOrs r rz#NamespaceLoader.get_resource_readers5tzz**rN) rrrrCr rcrLrIrPrTrrrr rrps+=B9  <+rrcteZdZdZedZedZedZed dZ ed dZ edZ y) PathFinderz>Meta path finder for sys.path and package __path__ attributes.c8ttjjD]A\}}| t |stj|=%t |ds2|j Ctxjdz c_ddl m }|j y)z}Call the invalidate_caches() method on all path entry finders stored in sys.path_importer_caches (where implemented).Ninvalidate_cachesrrMetadataPathFinder) listrpath_importer_cacheitemsrdrrrrimportlib.metadatar)rfinderrs r rzPathFinder.invalidate_cachess|!!8!8!>!>!@ALD&~[%6++D1!45((* B "9,,.rctj*tjstjdttjD] } ||cSy#t $rYwxYw)z.Search sys.path_hooks for a finder for 'path'.Nzsys.path_hooks is empty)r path_hooksr~r ImportWarningr)rDhooks r _path_hookszPathFinder._path_hookssY >> %cnn NN4m DNND Dz!#   sA A'&A'c|dk(r tj} tj|}|S#t$rYywxYw#t $r(|j |}|tj|<Y|SwxYw)zGet the finder for the path entry from sys.path_importer_cache. If the path entry is not in the cache, find the appropriate finder and cache it. If no finder is available, store None. r N)rr_FileNotFoundErrorrrKeyErrorr)r2rDrs r _path_importer_cachezPathFinder._path_importer_caches 2: zz|  3,,T2F %    3__T*F,2C # #D )  3s1A ==-A10A1Nc:g}|D]v}t|ts|j|}|(|j||}|=|j|cS|j }| t d|j|xtj|d}||_|S)z?Find the loader or namespace_path for this module/package name.Nzspec missing loader) rrrr:rrrrrr ) r2r*rDr9namespace_pathentryrrportionss r _get_speczPathFinder._get_specs EeS)--e4F!''&9<;;*K::#%&;<< %%h/#&((48D.[^[h[h2i/ Krc2ddlm}|j|i|S)a  Find distributions. Return an iterable of all Distribution instances capable of loading the metadata for packages matching ``context.name`` (or all names if ``None`` indicated) along the paths in the list of directories ``context.path``. rr)rrfind_distributions)rrrs r r zPathFinder.find_distributionss  :4!44dEfEErrMr;) rrrrr>rrr?rrr:r rrr rrs}H//"  *8. F FrrcFeZdZdZdZdZdZd dZdZe dZ d Z y) FileFinderzFile-based finder. Interactions with the file system are cached for performance, being refreshed when the directory the finder is handling has been modified. c g}|D]\}|jfd|D!||_|r|dk(rtj|_nt ||_d|_t|_t|_ y)zInitialize with the path to search on and a variable number of 2-tuples containing the loader and the file suffixes the loader recognizes.c3&K|]}|f ywrMr)rrrs r r z&FileFinder.__init__..%sC(FF+(srgrN) r_loadersrr_rDri _path_mtimeset _path_cache_relaxed_path_cache)rrDloader_detailsloadersrrs @r rCzFileFinder.__init__sp . FH NNC(C C!/ ts{ DI%d+DI5#&5 rcd|_y)zInvalidate the directory mtime.rN)rrs r rzFileFinder.invalidate_caches0s rc2|||}t||||S)Nr)r)rrr*rDsmslr9rs r rzFileFinder._get_spec4s&h-&xfBFH HrNcd}|jdd} t|jxstjj }||jk7r|j||_tr|j}|j}n|j}|}||vrit|j|}|jD]9\} } d| z} t|| } t| s#|j!| || |g|cSt#|}|jD]a\} } t|j|| z} t&j)d| d|| z|vs@t| sL|j!| || d|cS|r6t&j)d t&j+|d} |g| _| Sy#t $rd}YwxYw#t$$rYywxYw) zoTry to find a spec for the specified module. Returns the matching spec, or None if not found. Frgr4rrCNz trying {}) verbosityzpossible namespace for {})rrUrDrr_rrWr _fill_cacherrrrrHrr]rr`rrrr r)rr*r9 is_namespace tail_modulercache cache_module base_pathrr init_filename full_pathrs r r:zFileFinder.find_spec9s  ))#.q1  tyy8CJJL9BBE D$$ $    $D  =,,E&,,.L$$E&L 5 "499k:I(, $ *V 3 &y-@  *>>,)i[Z`aa )6 +95 $(MM FL &tyy+2FG   ' ' Y! ' Lf$- *>>,)*.88%2   ' '(CY O((48D/8kD +KQ E 8  s#5F>(G> G  G  GGcT|j} tj|xstj}tjjdst||_ nXt}|D]B}|jd\}}}|r|d|j}n|}|j|D||_ tjjtr$|D chc]} | jc} |_yy#tt t f$rg}YwxYwcc} w)zDFill the cache of potential modules and packages for this directory.rrgN)rDrlistdirr_rPermissionErrorNotADirectoryErrorrrr rrrraddr!r) rrDcontentslower_suffix_contentsrrrrnew_namefns r rzFileFinder._fill_cachelsyy {{4#73::<8H||&&u-"8}D %(E ! $(NN3$7!c6"&q(89H#H%))(3 ! 5D  << " "#> ?=E'FXr X'FD $ @/"?4FG H 0(Gs+D (D% D"!D"cfd}|S)aA class method which returns a closure to use on sys.path_hook which will return an instance using the specified loaders and the path called on the closure. If the path called on the closure is not a directory, ImportError is raised. cFt|s td||gS)z-Path hook for importlib.machinery.FileFinder.zonly directories are supportedrT)r`r)rDr2rs r path_hook_for_FileFinderz6FileFinder.path_hook..path_hook_for_FileFinders)t$!"BNNt-n- -rr)r2rr.s`` r path_hookzFileFinder.path_hooks . ('rc"d|jdS)Nz FileFinder(rrTrs r rzFileFinder.__repr__sTYYM++rrM) rrrrrCrrr:rr?r/rrrr r r s<)"H 1fG>((",rr c2|jd}|jd}|s-|r |j}n||k(r t||}n t||}|s t |||}|rt ||_ ||d<||d<||d<||d<y#t$rYywxYw)Nrr)r__file__ __cached__)rrrrrricached Exception)nsrpathname cpathnamerrs r _fix_up_moduler9s VVL !F 66* D  [[F  ")$9F%dH5F &tXfE ' 2DK :!<!:$<    s5B BBcpttjf}ttf}t t f}|||gS)z_Returns a list of file-based module loaders. Each item is a tuple (loader, suffixes). )rrextension_suffixesrrrr) extensionssourcebytecodes r r r s9 %d&=&=&??J  .F#%66H  ))rc|ayrM)r)_bootstrap_modules r _set_bootstrap_modulerAs"Jrct|t}tjj t j |gtjjty)z)Install the path-based import components.N) rAr rrrr r/ meta_pathr@r)r@supported_loaderss r _installrEsG+,35NN://1BCDEMM$r)rkrM)NNN)rr)T)Wrrrrrrr~rrr<ntrr$posixr=allr>rr:rA_pathseps_with_colonr"%_CASE_INSENSITIVE_PLATFORMS_BYTES_KEYr!r#rr+r1r5rHrQrUr[r]r`rdrirytype__code__rr)rr(r.rorrrr@r;r=rDEBUG_BYTECODE_SUFFIXESOPTIMIZED_BYTECODE_SUFFIXESrrrrrrrrrrrrrrrrr r"rArVrwrrrrr_NamespaceLoaderrr r9r rArE)ss0r rQs,  ||w& SkOeO 4O 4444 1 '''/*)89A!A39'-#(:% E"E!F  7 * * *<? "2. .R0 ,-(( ) pq(+g5 NN<:  '6",T,,.H8II5C0C0L%@PG&  >BL8 0 9 D H C47@CL-d00f<<Z6d?Z7d@Z8dAZ9y)FaSCore implementation of import. This module is NOT meant to be directly imported! It has been designed such that it can be bootstrapped into Python as the implementation of import. As such it requires the injection of specific modules and attributes in order to work. One should use importlib as the public-facing version of this module. cd |jS#t$rt|jcYSwxYwN) __qualname__AttributeErrortype)objs  _object_namers2& &Cy%%%&s //Nc dD]&}t||st||t||(|jj |jy)z/Simple substitute for functools.update_wrapper.) __module____name__r__doc__N)hasattrsetattrgetattr__dict__update)newoldreplaces r_wrapr(sBH 3 C'#w"7 8ILL %c,tt|Sr)rsysnames r _new_moduler0s 49T?rc eZdZy)_ListNr r rrrrr7rrc.eZdZdZdZdZddZddZy)_WeakValueDictionaryctj|Gfddtj}||_|jy)NcBeZdZdZfdZfdZefdZxZS)/_WeakValueDictionary.__init__..KeyedRef)keycLt||||j}||_|Sr)super__new__remover&)robr&self __class__s rr)z7_WeakValueDictionary.__init__..KeyedRef.__new__Js%wtR= rc:t|||jyr)r(__init__r*)r,r+r&r-s rr/z8_WeakValueDictionary.__init__..KeyedRef.__init__Os T[[1rc}|]|jr&|jj|jytj |j |jyyr) _iterating_pending_removalsappendr&_weakref_remove_dead_weakrefdata)wrr, self_weakrefs rr*z6_WeakValueDictionary.__init__..KeyedRef.removeRsN$~#..55bff= 55diiH $r) r r r __slots__r)r/ staticmethodr* __classcell__)r-r8s@rKeyedRefr%Fs(I   2 I Irr<)r4ref _KeyedRefclear)r,r<r8s @rr/z_WeakValueDictionary.__init__@s5||D)  Ix|| I." rc>g|_t|_i|_yr)r2setr1r6r,s rr?z_WeakValueDictionary.clear`s!#% rc|jj}|j} |}tj ||#t$rYywxYwr)r2popr6 IndexErrorr4r5)r,rDdr&s r_commit_removalsz%_WeakValueDictionary._commit_removalsesV$$(( II e  ) )!S 1   sA AANc|jr|j |j|}|x}|S|S#t$r|cYSwxYwr)r2rGr6KeyError)r,r&defaultr7os rgetz_WeakValueDictionary.getosW  ! !  ! ! # 3BT "  N s: AAc |j|}|=|jr|j|j |||j|<|S|S#t$rd}YNwxYwr)r6rIr2rGr>)r,r&rJrKs r setdefaultz_WeakValueDictionary.setdefault|sm  # A 9%%%%'!^^GS9DIIcNNH A sA A%$A%r)r r rr/r?rGrLrNrrrr"r">s@ 2  rr"c"eZdZdZdZdZdZy)_BlockingOnManagerz;A context manager responsible to updating ``_blocking_on``.c ||_||_yr) thread_idlock)r,rRrSs rr/z_BlockingOnManager.__init__s" rctj|jt|_|jj |j y)zCMark the running thread as waiting for self.lock. via _blocking_on.N) _blocking_onrNrRr blocked_onr3rSrBs r __enter__z_BlockingOnManager.__enter__s4'11$..%'J tyy)rcN|jj|jy)z6Remove self.lock from this thread's _blocking_on list.N)rVr*rSr,argskwargss r__exit__z_BlockingOnManager.__exit__s tyy)rN)r r rr r/rWr\rrrrPrPsE **rrPc eZdZy)_DeadlockErrorNrrrrr^r^r rr^c||vry|D]W}|j|x}s||vry|j||Dcgc]}|j}}t||||sWyycc}w)aCheck if 'target_id' is holding the same lock as another thread(s). The search within 'blocking_on' starts with the threads listed in 'candidate_ids'. 'seen_ids' contains any threads that are considered already traversed in the search. Keyword arguments: target_id -- The thread id to try to reach. seen_ids -- A set of threads that have already been visited. candidate_ids -- The thread ids from which to begin. blocking_on -- A dict representing the thread/blocking-on graph. This may be the same object as the global '_blocking_on' but it is a parameter to reduce the impact that global mutable state has on the result of this function. TF)seen_ids candidate_ids blocking_on)rLaddowner_has_deadlocked) target_idr`rarbtidcandidate_blocking_onrSedgess rreres M!)4)==%=  H_  S)>>(=(=> 9xu' )!$  ?sA#c.eZdZdZdZdZdZdZdZy) _ModuleLockzA recursive lock implementation which is able to detect deadlocks (e.g. thread 1 trying to take locks A then B, and thread 2 trying to take locks B then A). ctj|_tj|_||_d|_g|_g|_yr) _threadRLockrS allocate_lockwakeuprrdcountwaitersr,rs rr/z_ModuleLock.__init__sE*MMO ++-     rcrttjt|jgt S)N)rfr`rarb)rerm get_identrArdrUrBs r has_deadlockz_ModuleLock.has_deadlock s0 '')U ::,$  rcVtj}t||5 |j5|jgk(s|j |k(r4||_|jj d ddddddy|jrtd||jjdr|jj dddd|jj|jj#1swY>xYw#1swYyxYw)z Acquire the module lock. If a potential deadlock is detected, a _DeadlockError is raised. Otherwise, the lock is always acquired and True is returned. TNzdeadlock detected by F) rmrurPrSrqrdr3rvr^rpacquirerrreleaser,rgs rrxz_ModuleLock.acquire0s ! T *YYzzR'4::+<&)  ))$/# + *D((*,/DTH-MNN{{**51 ++D1Yb ##%  ##%uY + *s0DAD1DAD=DD DD(ctj}|j5|j|k7r t dt |j dkDsJ|j jt |j sSd|_t |jdkDr4|jj|jjdddy#1swYyxYw)Ncannot release un-acquired lock) rmrurSrd RuntimeErrorlenrqrDrrrpryrzs rryz_ModuleLock.releasets! YYzzS "#DEEtzz?Q& && JJNN tzz?! t||$q(LL$$&KK'')YYs B7C!!C*c8d|jdt|S)Nz _ModuleLock() at ridrBs r__repr__z_ModuleLock.__repr__sdii]%4z::rN) r r rr r/rvrxryrrrrrkrks# 6p B&H *;rrkc(eZdZdZdZdZdZdZy)_DummyModuleLockzVA simple _ModuleLock equivalent for Python builds without multi-threading support.c ||_d|_yNr})rrqrss rr/z_DummyModuleLock.__init__s  rc.|xjdz c_y)NT)rqrBs rrxz_DummyModuleLock.acquires a rcb|jdk(r td|xjdzc_y)Nr}r|r)rqr~rBs rryz_DummyModuleLock.releases& ::?@A A a rc8d|jdt|S)Nz_DummyModuleLock(rrrBs rrz_DummyModuleLock.__repr__s"499-uRXJ??rN)r r rr r/rxryrrrrrrs  @rrceZdZdZdZdZy)_ModuleLockManagerc ||_d|_yr)_name_lockrss rr/z_ModuleLockManager.__init__s  rclt|j|_|jjyr)_get_module_lockrrrxrBs rrWz_ModuleLockManager.__enter__s"%djj1  rc8|jjyr)rryrYs rr\z_ModuleLockManager.__exit__s rN)r r rr/rWr\rrrrrsrrcJtj t|}|?t t |}n t |}|fd}tj||t|<tj|S#t$rd}YdwxYw#tjwxYw)zGet or create the module lock for a given module name. Acquire/release internally the global import lock to protect _module_locks.Nctj tj||urt|=tj y#tj wxYwr)_imp acquire_lock _module_locksrL release_lock)r=rs rcbz_get_module_lock..cbsI!!#(%((.#5)$/%%'D%%'s A A) rrrrIrmrrkr4r=r)rrSrs rrrs    &(D <'-"4(! (#+,,tR"8M$   K1 D , s) A;AB ; B B B  B B"czt|} |j|jy#t$rYywxYw)zAcquires then releases the module lock for a given module name. This is used to ensure a module is completely initialized, in the event it is being imported by another thread. N)rrxryr^)rrSs r_lock_unlock_modulers= D !D      s . ::c||i|S)a.remove_importlib_frames in import.c will always remove sequences of importlib frames that end with a call to this function Use it instead of a normal call in places where including the importlib frames introduces unwanted noise into the traceback (e.g. when executing module code) r)frZkwdss r_call_with_frames_removedrs d d rr) verbosityctjj|k\r?|jdsd|z}t |j |tj yy)z=Print the message to stderr if -v/PYTHONVERBOSE is turned on.)#zimport z# )fileN)rflagsverbose startswithprintformatstderr)messagerrZs r_verbose_messagersJ yyI%!!"23WnG ngnnd##**5&rc*fd}t||S)z1Decorator to verify the named module is built-in.cZ|tjvrt|d|||S)N is not a built-in moduler)rbuiltin_module_names ImportErrorr,fullnamefxns r_requires_builtin_wrapperz4_requires_builtin.._requires_builtin_wrappers8 333 3 ,EF#+- -4""rr)rrs` r_requires_builtinrs#  #S) $$rc*fd}t||S)z/Decorator to verify the named module is frozen.c`tj|st|d|||S)Nz is not a frozen moduler)r is_frozenrrs r_requires_frozen_wrapperz2_requires_frozen.._requires_frozen_wrappers6~~h' ,CD#+- -4""rr)rrs` r_requires_frozenrs#  "C( ##rcd}tj|tt||}|tj vr2tj |}t ||tj |St|S)zLoad the specified module into sys.modules and return it. This method is deprecated. Use loader.exec_module() instead. zgthe load_module() method is deprecated and slated for removal in Python 3.12; use exec_module() instead) _warningswarnDeprecationWarningspec_from_loaderrmodules_exec_load)r,rmsgspecmodules r_load_module_shimr sa  3C NN3*+ Hd +D3;;X& dF{{8$$T{rct|dd}t|ddx}r t|S |j} |j}d|d|dS#t$rd}Y#wxYw#t$r|d|dcYSd|d|d cYSwxYw) z,The implementation of ModuleType.__repr__(). __loader__N__spec__? ()>)r_module_repr_from_specr r__file__)rloaderrrfilenames r _module_reprrs V\4 0Fvz400t0%d++6??$|155  5 >dXQ' 'dXRz4 4 5s( A A AAA;/ A;:A;ceZdZdZdddddZdZdZedZejdZed Z ed Z e jd Z y) ModuleSpecaThe specification for a module, used for loading. A module's spec is the source for information about the module. For data associated with the module, including source, use the spec's loader. `name` is the absolute name of the module. `loader` is the loader to use when loading the module. `parent` is the name of the package the module is in. The parent is derived from the name. `is_package` determines if the module is considered a package or not. On modules this is reflected by the `__path__` attribute. `origin` is the specific location used by the loader from which to load the module, if that information is available. When filename is set, origin will match. `has_location` indicates that a spec's "origin" reflects a location. When this is True, `__file__` attribute of the module is set. `cached` is the location of the cached bytecode file, if any. It corresponds to the `__cached__` attribute. `submodule_search_locations` is the sequence of path entries to search when importing submodules. If set, is_package should be True--and False otherwise. Packages are simply modules that (may) have submodules. If a spec has a non-None value in `submodule_search_locations`, the import system will consider modules loaded from the spec as packages. Only finders (see importlib.abc.MetaPathFinder and importlib.abc.PathEntryFinder) should modify ModuleSpec instances. N)origin loader_state is_packagec|||_||_||_||_|rgnd|_g|_d|_d|_yNF)rrrrsubmodule_search_locations_uninitialized_submodules _set_fileattr_cached)r,rrrrrs rr/zModuleSpec.__init__WsD   (0:"')+&# rc<d|jd|jg}|j|jd|j|j|jd|j|j j ddj|dS)Nzname=zloader=zorigin=zsubmodule_search_locations=(z, ))rrrr3rr-r join)r,rZs rrzModuleSpec.__repr__ds }%'@A ;; " KK'$++1 2  * * 6 KK5d6U6U5VW X..))*!DIIdO+>rcr|j} |j|jk(xr{|j|jk(xr`|j|jk(xrE||jk(xr4|j|jk(xr|j |j k(S#t $r tcYSwxYwr)rrrrcached has_locationrNotImplemented)r,othersmsls r__eq__zModuleSpec.__eq__ls.. "II+<KK5<</<KK5<</<E<<<<KK5<</ < %%););;  =  "! ! "sBB$$B65B6c|jH|j<|jr0tttj |j|_|jSr)rrr_bootstrap_externalNotImplementedError _get_cachedrBs rrzModuleSpec.cachedxsJ << {{&4+=+=&.--2>>t{{K ||rc||_yr)r)r,rs rrzModuleSpec.cacheds  rcn|j|jjddS|jS)z The name of the module's parent..r})rr rpartitionrBs rparentzModuleSpec.parents4  * * 299'',Q/ /99 rc|jSr)rrBs rrzModuleSpec.has_locations!!!rc$t||_yr)boolr)r,values rrzModuleSpec.has_locations!%[r) r r rr r/rrpropertyrsetterrrrrrrr2s"H04$  ? " ]]""))rrrrc4| t|dd}|sEt|dr9tttj}| |||S|rgnd}||||S|!t|dr |j |}nd}t||||S#t $rd}YwxYw) z5Return a module spec based on various loader methods.N_ORIGIN get_filename)r)rrrFr)rr rrspec_from_file_locationrrr)rrrrrsearchs rrrs ~D1 gfn5  &% %"5"M"M  *4? ?!t&tFBHJ J 6< ( "#..t4 J dF6j II  "!  "s&B BBc |j}||S|j}| |j} |j}|| t |dd}|s||} |j } t|j}t|||}|dn||k(|_ ||_ ||_ |S#t$rYwxYw#t$rYwxYw#t$rd}YwxYw#t$rd}Y~wxYw#t$rd}YywxYw)NrrF) rrr rrr __cached__list__path__rrrr)rrrrrlocationrrs r_spec_from_moduler s5  K ??D ~ &&F??~  VY5F(.F""*%)&//%:" dF6 2D"*"289KDDK&@D# KG          *%)"*sW B B/ B> CC B,+B,/ B;:B;> C  C  CC C.-C.Foverridec||s t|dd |j|_|s t|ddn|j}|X|j Lt tt j}|j|}|j |_ ||_d|_ ||_ |s t|dd |j|_ ||_|s t|dd|j  |j |_|j"rP|s t|dd |j$|_ |s t|dd |j& |j&|_|S|S#t$rY=wxYw#t$rYwxYw#t$rYwxYw#t$rYwxYw#t$rYwxYw#t$rYwxYw#t$rY|SwxYw)Nr r __package__rrr)rrr rrrrrNamespaceLoaderr)_pathrrrr rrrrrr)rrr rrs r_init_module_attrsrs GFJ5= "iiFO76<6> >..:&.--"5"E"E(00A#>> $ #'  &F 76=$7? !%F  76:t4<  * * 6 "&"A"A  wvz48@ "&++ wv|T:B{{&(, F% M6M   8           "  "  & Ms}EE#/E2F$FF>F. E E # E/.E/2 E>=E> F  F  FF F+*F+. F;:F;cd}t|jdr|jj|}n!t|jdr td|t |j }t |||S)z+Create a module based on the provided spec.N create_module exec_modulezBloaders that define exec_module() must also define create_module())r rrrrrrrrs rmodule_from_specr&soFt{{O,**40 m ,=> > ~TYY'tV$ Mrcx|jdn |j}|jY|j}|d|dSt6t |tj rd|dt |jdSd|d|dS|jrd|d|jdSd|jd|jdS)z&Return the repr to use for the module.rrrz (namespace) from rrr) rrrr isinstancerrrr)rrrs rrr7s))#3D {{ >dXQ' '  +6#6#F#FGdX%7V\\8J7K1M MdXRz4 4   dXVDKK?!< <dii]"T[[M< q%A"vz4(0 "FO M6M; 99 #[[__TYY/F%+CKK "           M sC%C3;EAE*(E93A%E E'&E'* E65E69 FFc|jSt|jds=t|jd}tj |t t |St|}d|_ |tj|j< |j#|j2td|j|jj|tjj!|j}|tj|j<t#d|j|jd|_|S# tj|j=#t$rYwxYwxYw#d|_wxYw)NrrTrrzimport {!r} # {!r}F)rr rrrrrr _initializingrrrrrrrIrDr)rrrs r_load_unlockedr!sH {{t{{M2"4;;/0144C NN3 .,T2 2 d #F D#!' DII {{"22:%&6TYYGG ''/+!' DII-tyy$++F" M!  KK *    #sJ3E<A E A'E< E9E*)E9* E63E95E66E99E<< Fcnt|j5t|cdddS#1swYyxYw)zReturn a new module object, loaded by the spec's loader. The module is not added to its parent. If a module is already in sys.modules, that existing module gets clobbered. N)rrr!rs rrrs$ DII &d# ' & &s +4ceZdZdZdZed dZedZedZ ee dZ ee dZ ee d Z eeZy) BuiltinImporterzMeta path import for built-in modules. All methods are either class or static methods to avoid the need to instantiate the class. zbuilt-inNc^tj|rt|||jSy)Nr)r is_builtinrr)clsrpathtargets r find_speczBuiltinImporter.find_specs$ ??8 $#Hc#++F Frc|jtjvr$t|jd|jt t j |S)zCreate a built-in modulerr)rrrrrrcreate_builtinr#s rrzBuiltinImporter.create_modulesK 99C44 4 -FG#'99. .()<)>499eL6~~1MENNH3MM1#x/C(F1CC/#e>HH>~~-=u~~=-%BT:DHD:vz222(2OV__h4OO2"6:6GG6vz222(2OV__h4OO2"6:6GG6$$$$$K&sK99 LLNc|rttddsy |j}||k7r |j dr |dd}|s|d}nd }|j d |}|r!tj||}||d }||fSd}tj||d }||fS#t$r!tjdk(rdndx}|_YwxYw) N _stdlib_dirr7win32\/r}) rr find_frozenrrrBrrrCrrrD) r(rr)r*info_rHr?rrrIs rr+zFrozenImporter.find_spechs()9)98D <"5(#'*{{+02008UK&4D!3!34    + + 2 21f = rct|j} |jj}|r||_|S#t $rY|SwxYw)zSet __file__, if able.)rrrrrr)rrrs rrzFrozenImporter.create_modulesTTYY' +((11H"*     s8 AAc|j}|j}ttj|}t ||j yr)rrrrget_frozen_objectexecr)rrrcodes rrzFrozenImporter.exec_modules4yy()?)?F T6??#rct||}tj|}|J|\}}}||_t |j dd|rg|_|j||S)z_Load a frozen module. This method is deprecated. Use exec_module() instead. Nr)rrrWr=r@rDrrJ)r(rrrXrYrHr?s rrzFrozenImporter.load_modulesq#31)!5(& V T*  FO 6" rc,tj|S)z-Return the code object for the frozen module.)rr\r1s rr2zFrozenImporter.get_code%%h//rcy)z6Return None as frozen modules do not have source code.Nrr1s rr5zFrozenImporter.get_sourcer3rc,tj|S)z.Return True if the frozen module is a package.)rrAr1s rrzFrozenImporter.is_packagerarrr7)r r rr rr8rJrBr+r:rrrrr2r5rrrrr:r:sGB%B%H  0:  $$ $0000rr:ceZdZdZdZdZy)_ImportLockContextz$Context manager for the import lock.c,tjy)zAcquire the import lock.N)rrrBs rrWz_ImportLockContext.__enter__ rc,tjy)z>#uqy )D 4y5NOO 7D#dV1TF --rctj}| td|stj dt |tj v}|D]q}t5 |j}||||} ddd1|s<|tj vr*tj |} |j} | |cS| cS|cSy#t$r YdddwxYw#1swYgxYw#t$r|cYcSwxYw)zFind a module's spec.Nz5sys.meta_path is None, Python is likely shutting downzsys.meta_path is empty) r meta_pathrrrrrrer+rr) rr)r*rt is_reloadfinderr+rrrs r _find_specrws I*+ + /?  #I  ! 5",, !tV4 "  !4T* (%H '# ' 36/"  " ! " !&  K  sBC C) C' C& C CCCC# & C65C6ct|tstdt||dkr t d|dkDr(t|ts td|s t d|s|dk(r t dyy)zVerify arguments are "sane".zmodule name must be str, not r}zlevel must be >= 0z__package__ not set to a stringz6attempted relative import with no known parent packagezEmpty module nameN)rstr TypeErrorr ValueErrorrrrnros r _sanity_checkr}s dC 7T |DEE qy-.. qy'3'=> >() ) EQJ,--4rzNo module named z{!r}cVd}|jdd}d}|r|tjvr t|||tjvrtj|Stj|} |j}|j}|jdd}t||}|tt |||r|jj t|} |r|jj |r#tj|} t|| | S| S#t $rt |d|d}t||dwxYw#|r|jjwwxYw#t $r&d|d}tj!|t"Y| SwxYw) Nrr}z; z is not a packagerzCannot set an attribute on z for child module )rrrrrr_ERR_MSG_PREFIXModuleNotFoundErrorrrwrr3r!rDrrrr) rimport_r)r parent_spec parent_modulerchildrrs r_find_and_load_unlockedrs D __S !! $FK  $ %gv 6 3;; ;;t$ $ F+  @ ))D$,, $Q' dD !D |!_$5dX">TJJ   1 1 8 8 ? <#D)F5599;  F+  / M5& 1 M6M5 @$%dXRz9JKC%c54 ? @ 5599; //z9KE9UC NN3 . M /s*2 D. E E9.&EE69+F('F(ctjj|t}|tust t |ddddrat |5tjj|t}|turt ||cdddS dddt||d|d}t|||S#1swY+xYw)zFind and load the module.rNr Fz import of z halted; None in sys.modulesr) rrrL_NEEDS_LOADINGrrrrr)rrrrs r_find_and_loadrEs [[__T> 2F.  D1?EJ  %[[__T>:F'.tW=& %'& D! ~tf$@A!'55 M& %s 8B==Cc`t||||dkDr t|||}t|tS)a2Import and return the module based on its name, the package the call is being made from, and the level adjustment. This function represents the greatest common denominator of functionality between import_module and __import__. This includes setting __package__ if the loader did not. r})r}rrr _gcd_importr|s rrr_s2$' qyT7E2 $ ,,r recursivec |D]}t|ts8|r|jdz}nd}td|dt |j|dk(r*|rSt |ds`t ||j|dzt ||r|jd |} t|||S#t$r>}|j|k(r)tjj|tYd }~d }~wwxYw) zFigure out what __import__ should return. The import_ parameter is a callable which takes the name of module to import. It is required to decouple the function from assuming importlib's import implementation is desired. z.__all__z ``from list''zItem in z must be str, not *__all__TrrN)rryr rzrr _handle_fromlistrrrrrrrLr)rfromlistrrxwhere from_nameexcs rrrns!S!*4'hug.##'7#3#3"467 7 #X!; +/1#!??+1QC0I )'9=0 M' HH )KKOOI~>J s B,, C353C.-C..C3c\|jd}|jd}|@|<||jk7r-tjd|d|jdtd|S| |jStjdt d|d }d |vr|j d d }|S) zCalculate what __package__ should be. __package__ is not guaranteed to be defined or could be set to None to represent that its proper value is unknown. r rz __package__ != __spec__.parent (z != r) stacklevelzYcan't resolve package from __spec__ or __package__, falling back on __name__ and __path__r rrr})rLrrrrrr)globalsrnrs r_calc___package__rskk-(G ;;z "D  4;; 6 NN&kdkk_A?-!  = {{?$  4*% W $((-a0G Nrc|dk(r t|}n||ni}t|}t|||}|s|dk(rt|jddS|s|St|t|jddz }tj |j dt|j |z St|drt||tS|S)aImport a module. The 'globals' argument is used to infer where the import is occurring from to handle relative imports. The 'locals' argument is ignored. The 'fromlist' argument specifies what should exist as attributes on the module being imported (e.g. ``from module import ``). The 'level' argument represents the package location to import from in a relative import (e.g. ``from ..pkg import mod`` would have a 'level' of 2). r}Nrr) rr partitionrrrr r r) rrlocalsrrorglobals_rncut_offs r __import__rs zT"%17r#H-T7E2  A:t~~c2156 6M$i#dnnS&9!&<"==G;;v/LFOO0DW0LMN N  $+>> rcbtj|}|td|zt|S)Nzno built-in module named )r%r+rr!)rrs r_builtin_from_namers3  $ $T *D |5<== $ rc,|a|att}tjj D]z\}}t ||s|tj vrt}ntj|rt}nIt||}t|||tusj|j||tjt}dD]@}|tjvr t|} ntj|} t||| Bt!ay)zSetup importlib by importing needed built-in modules and injecting them into the global namespace. As sys is needed for sys.modules access and _imp is needed to load built-in modules, those two modules must be explicitly passed in. )rmrr4N)rrrritemsrrr%rr:r rrJr rrr"rU) sys_module _imp_module module_typerrrr self_module builtin_namebuiltin_modules r_setuprs D Cs)K ))+ f fk *s///(%'$VV4D tV ,'%%f-,++h'K< s{{ */ =N [[6N \>: =()Lrct||tjjttjjt y)z0Install importers for builtin and frozen modulesN)rrrtr3r%r:)rrs r_installrs0 :{#MM)MM(rc\ddl}|a|jtjt y)z9Install importers that require external filesystem accessr}N)_frozen_importlib_externalrrrrr )rs r_install_external_importersr s$&4'' H(=>rr7rr)NNrr}):r rrmrr4rrrrrr"rrUrPr~r^rerkrrrrrrrrrrrrr rrrrrr!rr%r:rerrrwr}r_ERR_MSGrobjectrrrrrrrrrrrrrrs,&   & D II\  **, \ (V`;`;F@@*   "J"016%$&6*a)a)H.2dJ:'T27FR"=,<"H)Z $1111h~0~0F  .*Z . % V #'T4 ->C"J6"J %*P)?rdZddlZddlZddlZddlZddlZddgZeeZ Gdde Z Gdde Z dd Z dd Zefd ZGd d eZddZ ddZefdZdZddZedk(rMeej4dkredej8yej4d=eej4dyy)aZrunpy.py - locating and running Python code using the module namespace Provides support for locating and running Python scripts using the Python module namespace instead of the native filesystem. This allows Python code to play nicely with non-filesystem based PEP 302 importers when locating support scripts as well as when importing modules. N run_modulerun_pathc"eZdZdZdZdZdZy) _TempModulezCTemporarily replace a module in sys.modules with an empty namespacec@||_t||_g|_yN)mod_name ModuleTypemodule _saved_moduleselfr s __init__z_TempModule.__init__s   * c|j} |jjtj||j tj|<|S#t $rY*wxYwr)r r appendsysmodulesKeyErrorr r s r __enter__z_TempModule.__enter__!sZ==     % %ckk(&; <!%  H    s,A A%$A%c|jr2|jdtj|j<g|_ytj|j=g|_yNr)r rrr rargss r__exit__z_TempModule.__exit__*sL   )-););A)>CKK &  DMM*rN)__name__ __module__ __qualname____doc__rrrrrrrsM  rrceZdZdZdZdZy)_ModifiedArgv0c>||_tx|_|_yr)valueobject _saved_value _sentinel)rr%s rrz_ModifiedArgv0.__init__2s -3X5DNrc|j|jur tdtjd|_|j tjd<y)NzAlready preserving saved valuer)r'r( RuntimeErrorrargvr%)rs rrz_ModifiedArgv0.__enter__6sA   DNN 2?@ @HHQKjj rc`|j|_|jtjd<yr)r(r%r'rr+rs rrz_ModifiedArgv0.__exit__<s ^^ '' rN)rrrrrrr!rrr#r#1s6! (rr#c ||j||d}|}d} n2|j}|j}|j} | |j}|j||| d|||t |||S)z)Helper to run code in nominated namespaceN)r__file__ __cached__r __loader__ __package____spec__)updateloaderorigincachedparentexec) code run_globals init_globalsr mod_specpkg_name script_namer4fnamer6s r _run_coder@As<(  H("'$*!%$*%-"* , { rc .||n |j}t|5}t|5|jj}t |||||||ddddddj S#1swY!xYw#1swYj SxYw)z5Helper to run code in new namespace with sys modifiedN)r5rr#r __dict__r@copy) r9r;r r<r=r>r? temp_module mod_globalss r_run_module_coderF[s$+KE X +~e/D!((11 $ \Hh  =0E      0E/D     s" A<(A0A<0A9 5A<<Bc |jdr|d|jd\}}}|rc t|t j j|}|6t|ds*ddl m }dj||}|t| tjj|}| |d|z|j,0|dk(s|j'dr|d |dz} t/| |S|j0} | |d|z | j3|} | |d|z||| fS#t$rE}|j-|j|k7r|j|jdzsYd}~Fd}~wwxYw#tt t"t$f$rT} d}|j'd r|d |dd d |d z }||j|t)| j*| | d} ~ wwxYw#|$r&}|t j vr||d|dd}~wwxYw#t$r}|t||d}~wwxYw)N.z#Relative module names not supported__path__r)warnz{mod_name!r} found in sys.modules after import of package {pkg_name!r}, but prior to execution of {mod_name!r}; this may result in unpredictable behaviour)r r=z:Error while finding module specification for {!r} ({}: {})z.pyz . Try using 'z' instead of 'z' as the module name.zNo module named %s__main__z .__main__z%Cannot use package as __main__ modulez; z- is a package and cannot be directly executedz0%r is a namespace package and cannot be executedzNo code object available for %s) startswith rpartition __import__ ImportErrornamerrgethasattrwarningsrJformatRuntimeWarning importlibutil find_specAttributeError TypeError ValueErrorendswithtypersubmodule_search_locations_get_module_detailsr4get_code) r errorr=_eexistingrJmsgspecex pkg_main_namer4r9s rr`r`is39::((-NHa  x ;;??8,  *(E %#FHxFH  $ % I~~''1 |(8344 &&2 z !X%6%6{%C?@ @ G${2M&}e< < [[F ~FCKLM M&x( |5@AA T4 g vv~!&&H"4 ++AFFSL9  & J ?IK   U # mHSbM?3 z!68 9CCJJxb):):B?@bHI" Gs{{*9:HFG G G &F1IA%&s` D:F ,G;H): F:FF G8$AG33G8;H&!H!!H&) I 2II ceZdZdZy)_ErrorzBError that _run_module_as_main() should report without a tracebackN)rrrr r!rrrkrksLrrkcx |s|dk7rt|t\}}}ntt\}}}tj dj}|rjtjd<t|ddS#t$r4}tjd|}tj |Yd}~d}~wwxYw)aRuns the designated module in the __main__ namespace Note that the executed module will have full access to the __main__ namespace. If this is not desirable, the run_module() function should be used to run the module code in a fresh namespace. At the very least, these variables in __main__ will be overwritten: __name__ __file__ __cached__ __loader__ __package__ rLz: Nr) r`rk_get_main_module_detailsr executableexitrrBr5r+r@)r alter_argvr<r9excrf main_globalss r_run_module_as_mainrss Z/':8V'L $Hh'?'G $Hh;;z*33Loo T< ++ ..#.  s/A<< B9*B44B9cft|\}}}||}|rt||||St|i|||S)u"Execute a module's code without importing it. mod_name -- an absolute module name or package name. Optional arguments: init_globals -- dictionary used to pre-populate the module’s globals dictionary before the code is executed. run_name -- if not None, this will be used for setting __name__; otherwise, __name__ will be set to mod_name + '__main__' if the named module is a package and to just mod_name otherwise. alter_sys -- if True, sys.argv[0] is updated with the value of __file__ and sys.modules[__name__] is updated with a temporary module object for the module being executed. Both are restored to their original values before the function returns. Returns the resulting module globals dictionary. )r`rFr@)r r;run_name alter_sysr<r9s rrrsI* 38<HhlHhGGr<8DDrc:d}tj|}tj|= t||tj|<S#t$r3}|t |vr |d|dtj d|d}~wwxYw#|tj|<wxYw)NrLz can't find z module in r)rrr`rPstrpath)rb main_name saved_mainrqs rrmrms IY'J I,"9-", I  C (#((1+78=@ A  ", Is# A B.A==BBBcHddlm}tjj |}t j |5}||}ddd;t j |5}t|j|d}ddd|S|S#1swYHxYw#1swY|SxYw)Nr) read_coder8) pkgutilr}osryabspathio open_codecompileread)r?r} code_pathfr9s r_get_code_from_filers|!&I i A| ! | \\) $1668UF3D% K4K ! % Ks B #B BB!c \|d}|jdd}ddlm}||}tj|}t |t drt|}t|||||Stjjd| t\}}}t|5} t|5| jj } t#|| ||||j%cdddcddd tjj'|S#t($rYSwxYw#1swYnxYw dddn #1swYnxYw tjj'|y#t($rYywxYw# tjj'|w#t($rYwwxYwxYw)uExecute code located at the specified filesystem location. path_name -- filesystem location of a Python script, zipfile, or directory containing a top level __main__.py script. Optional arguments: init_globals -- dictionary used to pre-populate the module’s globals dictionary before the code is executed. run_name -- if not None, this will be used to set __name__; otherwise, '' will be used for __name__. Returns the resulting module globals dictionary. Nz rHr) get_importer)r=r>)rNr~rrfsdecode isinstancer^rrFrryinsertrmrr#r rBr@rCremover\) path_namer;rur=rimporterr9r r<rDrEs rrrs{""3'*H$I&H I&I(DJ'#9-lH)1yJ J 9% (@'A $HhX&+ *)0099  {L$,hBBF$&+*'&   *  +**'&&   *    *  s E:& D>24D(& D>/ E:9D D%$D%(D1 -D>5 E:>EE: E++ E76E7:F+<FF+ F(%F+'F((F+rLz!No module specified for execution)file)NNNNN)T)NNF)NN)r rimportlib.machineryrWimportlib.utilrr__all__r^r r&rr#r@rFrPr` Exceptionrkrsrrmrrrlenr+printstderrr!rrrs  *  #Y  & . (V ( /3&*)-4)-,0/3 )4; zMYM+8'+(-E<$/,& 0f z 388}q 1 C HHQKCHHQK( rdZddlmZddlmZddlmZddlmZmZmZm Z m Z ddlm Z ddlm Z ddlm Z dd lmZdd lmZdd lmZdd lmZd Zy)z9The machinery of importlib: finders, loaders, hooks, etc.) ModuleSpec)BuiltinImporter)FrozenImporter)SOURCE_SUFFIXESDEBUG_BYTECODE_SUFFIXESOPTIMIZED_BYTECODE_SUFFIXESBYTECODE_SUFFIXESEXTENSION_SUFFIXES)WindowsRegistryFinder) PathFinder) FileFinder)SourceFileLoader)SourcelessFileLoader)ExtensionFileLoader)NamespaceLoaderc*ttztzS)zAReturns a list of all recognized module suffixes for this process)rr r  all_suffixesrs . .1C CCrN)__doc__ _bootstraprrr_bootstrap_externalrrrr r r r r rrrrrrrrrs8?"'&))7++1540DrdZddlmZddlmZddlmZddlmZddlmZddlm Z ddlm Z dd lm Z dd lm Z dd lm Z dd lmZd dlZd dlZd dlZdZdZddZddZGddZGddej.ZGddeZy)z-Utility code for constructing importers, etc.)Loader)module_from_spec) _resolve_name)spec_from_loader) _find_spec) MAGIC_NUMBER)_RAW_MAGIC_NUMBER)cache_from_source) decode_source)source_from_cache)spec_from_file_locationNc6tjt|S)zBReturn the hash of *source_bytes* as used in hash-based pyc files.)_imp source_hashr ) source_bytess rrs   -| <<c|jds|S|stdt|dd}|D]}|dk7rn|dz }t||d||S)z2Resolve a relative module name to an absolute one..zno package specified for z% (required for relative module names)rrN) startswith ImportErrorreprr)namepackagelevel characters r resolve_namersw ??3  5d4j\BAAB B E      efw 66rc|tjvr t||Stj|}|y |j}|t |d|S#t $rt |ddwxYw)aReturn the spec for the specified module. First, sys.modules is checked to see if the module was already imported. If so, then sys.modules[name].__spec__ is returned. If that happens to be set to None, then ValueError is raised. If the module is not in sys.modules, then sys.meta_path is searched for a suitable spec with the value of 'path' given to the finders. None is returned if no spec could be found. Dotted names do not have their parent packages implicitly imported. You will most likely need to explicitly import all parent packages in the proper order for a submodule to get the correct spec. N.__spec__ is None.__spec__ is not set)sysmodulesr__spec__ ValueErrorAttributeError)rpathmodulespecs r_find_spec_from_pathr*'s 3;;$%%T" > ??D| D6):!;<<K  Fv%9:; E Fs AA-c|jdr t||n|}|tjvr@|j dd}|rt |dg} |j }nd}t||Stj|}|y |j}|t|d |S#t$r}td|d|||d}~wwxYw#t$rt|d dwxYw) aReturn the spec for the specified module. First, sys.modules is checked to see if the module was already imported. If so, then sys.modules[name].__spec__ is returned. If that happens to be set to None, then ValueError is raised. If the module is not in sys.modules, then sys.meta_path is searched for a suitable spec with the value of 'path' given to the finders. None is returned if no spec could be found. If the name is for submodule (contains a dot), the parent module is automatically imported. The name and package arguments work the same as importlib.import_module(). In other words, relative module names (with leading dots) work. rr__path__)fromlistz __path__ attribute not found on z while trying to find )rNr r!) rrr"r# rpartition __import__r,r&ModuleNotFoundErrorrr$r%) rrfullname parent_nameparent parent_pather(r)s r find_specr6Fs"/3ooc.B|D'*Hs{{"))#.q1  zlCF P$oo K(K00X& > ??D| D6):!;<<K%" P)6{oF,,4<9?GINOP P Fv%9:; E Fs$ B' C ' C 0CC  C%c2eZdZdZdZdZdZedZy)+_incompatible_extension_module_restrictionsagA context manager that can temporarily skip the compatibility check. NOTE: This function is meant to accommodate an unusual case; one which is likely to eventually go away. There's is a pretty good chance this is not what you were looking for. WARNING: Using this function to disable the check can lead to unexpected behavior and even crashes. It should only be used during extension module development. If "disable_check" is True then the compatibility check will not happen while the context manager is active. Otherwise the check *will* happen. Normally, extensions that do not support multiple interpreters may not be imported in a subinterpreter. That implies modules that do not implement multi-phase init or that explicitly of out. Likewise for modules import in a subinterpeter with its own GIL when the extension does not support a per-interpreter GIL. This implies the module does not have a Py_mod_multiple_interpreters slot set to Py_MOD_PER_INTERPRETER_GIL_SUPPORTED. In both cases, this context manager may be used to temporarily disable the check for compatible extension modules. You can get the same effect as this function by implementing the basic interface of multi-phase init (PEP 489) and lying about support for multiple interpreters (or per-interpreter GIL). c$t||_yN)bool disable_check)selfr<s r__init__z4_incompatible_extension_module_restrictions.__init__s!-0rcNtj|j|_|Sr:)r'_override_multi_interp_extensions_checkoverrideoldr=s r __enter__z5_incompatible_extension_module_restrictions.__enter__s?? N rcJ|j}|`tj|yr:)rBrr@)r=argsrBs r__exit__z4_incompatible_extension_module_restrictions.__exit__shh H 44S9rc"|jrdSdS)Nr)r<rCs rrAz4_incompatible_extension_module_restrictions.overrides''r.Q.rN) __name__ __module__ __qualname____doc__r>rDrGpropertyrArrr8r8ws*>1: //rr8ceZdZdZdZdZy) _LazyModulezKA subclass of the module type which triggers loading upon attribute access.ctj|d}|j}|d5tj|dtur#|drtj||cdddSd|d<tj|d}|j}|d}|}i}|j D]2\} } | |vr| || <t || t || k7s.| || <4|jj||tjvr7t |t tj|k7rtd|d |j|tj|_dddt!||S#1swYxYw) z8Trigger the load of the module and return the attribute.r$lock __class__ is_loadingNT__dict__zmodule object for z. substituted in sys.modules during a lazy load)object__getattribute__ loader_staterQritemsidloader exec_moduler"r#r%updatetypes ModuleTyperTgetattr) r=attrr$rYrV original_name attrs_then attrs_now attrs_updatedkeyvalues rrXz_LazyModule.__getattribute__s**4<,, & !&&t[9[H  -!224>" !.2 \*!224D !) **5 $ " "+//"3JC*,-2 c*IcN+r*S//BB-2 c* #4++D1!CKK/$x2ckk-&@#AA(+=m=NO1*122  .!&!1!1W"ZtT""[" !s8E=*A-E=BE==Fc>|j|t||y)z/Trigger the load and then perform the deletion.N)rXdelattr)r=rbs r __delattr__z_LazyModule.__delattr__s d#drN)rJrKrLrMrXrkrOrrrQrQsU1#frrQcBeZdZdZedZedZdZdZ dZ y) LazyLoaderzKA loader that creates a module which defers loading until attribute access.c2t|ds tdy)Nr]z loader must define exec_module())hasattr TypeError)r\s r__check_eager_loaderzLazyLoader.__check_eager_loadersv}->? ?.rc4jfdS)z>Construct a callable which returns the eager loader made lazy.c |i|Sr:rO)rFkwargsclsr\s rz$LazyLoader.factory..ss64+B6+B'Cr)_LazyLoader__check_eager_loader)rur\s``rfactoryzLazyLoader.factorys   (CCrc4|j|||_yr:)rwr\)r=r\s rr>zLazyLoader.__init__s !!&) rc8|jj|Sr:)r\ create_module)r=r)s rr{zLazyLoader.create_modules{{((..rc(ddl}|j|j_|j|_i}|jj |d<|j |d<|j|d<d|d<||j_t|_y)zMake the module load lazily.rNrVrTrSFrU) threadingr\r$ __loader__rVcopyrTRLockrYrQ)r=r(r}rYs rr]zLazyLoader.exec_modules !% KK  #)??#7#7#9 Z $*$4$4 [!(0 V%* \"'3$&rN) rJrKrLrM staticmethodrw classmethodrxr>r{r]rOrrrmrms>U@@DD /'rrmr:)rM_abcr _bootstraprrrr_bootstrap_externalrr r r r r rr"r_rrr*r6r8r`rQrmrOrrrsq3(%("-22.28 = 7>*b././b<%""<~''''r 6dZdZdZdZdZdZdZdZdZd Z d Z d Z d Z d Z dZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZ dZ!dZ"e"Z#d Z$d!Z%d"Z&d#Z'd$Z(d!Z)d"Z*d#Z+d%Z,d&Z-d'Z.d Z/dZ0dZ1dZ2dZ3dZ4dZ5dZ6d Z7d'Z8d&Z9dZ:d(Z;d)Zd,Z?ed-fed.fed/fed0fe d1fed2fed3ffe)d4ffe*d5ffe+e!zd.fe!d6fe+d7ffe-d4ffe.d5ffe/e"zd.fe"d6fe/d7ffe1d4ffe2d5ffe3e$zd8fe$d9fe3d7fff Z@d:ZAd&ZBdZCd#ZDd'ZEd ZFdZGdZHd"ZIdZJd)ZKdZLdZMdZNd ZOdZPd!ZQd(ZR dd;lSy<#eT$rYyS_IMODErs &=c |dzS)zLReturn the portion of the file's mode that describes the file type. ir rs rS_IFMTrs (?ri@i i`iiiic&t|tk(S)z(Return True if mode is from a directory.)rS_IFDIRrs rS_ISDIRr2 $<7 ""rc&t|tk(S)zrrc&t|tk(S)z0Return True if mode is from a FIFO (named pipe).)rS_IFIFOrs rS_ISFIFOr$Brrc&t|tk(S)z,Return True if mode is from a symbolic link.)rS_IFLNKrs rS_ISLNKr'Frrc&t|tk(S)z%Return True if mode is from a socket.)rS_IFSOCKrs rS_ISSOCKr*Js $<8 ##rcy)z#Return True if mode is from a door.Fr rs rS_ISDOORr,N rcy)z*Return True if mode is from an event port.Fr rs rS_ISPORTr/Rr-rcy)z'Return True if mode is from a whiteout.Fr rs rS_ISWHTr1Vr-riii@i8 iiiii ls-bdcprwSxtTcg}tD]8}|D] \}}||z|k(s|j|'|jd:dj|S)z;Convert a file's mode to a string of the form '-rwxrwxrwx'.r:)_filemode_tableappendjoin)rpermtablebitchars rfilemoderNsX D ICczS  D! KK  ! 774=r)*N)U__doc__ST_MODEST_INOST_DEVST_NLINKST_UIDST_GIDST_SIZEST_ATIMEST_MTIMEST_CTIMErrrrrr r#r&r)S_IFDOORS_IFPORTS_IFWHTrrrr!r$r'r*r,r/r1S_ISUIDS_ISGIDS_ENFMTS_ISVTXS_IREADS_IWRITES_IEXECS_IRWXUS_IRUSRS_IWUSRS_IXUSRS_IRWXGS_IRGRPS_IWGRPS_IXGRPS_IRWXOS_IROTHS_IWOTHS_IXOTH UF_NODUMP UF_IMMUTABLE UF_APPEND UF_OPAQUE UF_NOUNLINK UF_COMPRESSED UF_HIDDEN SF_ARCHIVED SF_IMMUTABLE SF_APPEND SF_NOUNLINK SF_SNAPSHOTrGrNFILE_ATTRIBUTE_ARCHIVEFILE_ATTRIBUTE_COMPRESSEDFILE_ATTRIBUTE_DEVICEFILE_ATTRIBUTE_DIRECTORYFILE_ATTRIBUTE_ENCRYPTEDFILE_ATTRIBUTE_HIDDENFILE_ATTRIBUTE_INTEGRITY_STREAMFILE_ATTRIBUTE_NORMAL"FILE_ATTRIBUTE_NOT_CONTENT_INDEXEDFILE_ATTRIBUTE_NO_SCRUB_DATAFILE_ATTRIBUTE_OFFLINEFILE_ATTRIBUTE_READONLYFILE_ATTRIBUTE_REPARSE_POINTFILE_ATTRIBUTE_SPARSE_FILEFILE_ATTRIBUTE_SYSTEMFILE_ATTRIBUTE_TEMPORARYFILE_ATTRIBUTE_VIRTUAL_stat ImportErrorr rrrs                     ######$                               ss s s s s s s s gos s ss s gos s ss s gos s s/8    "'%)"%#    s DDD^dZddlZddlZddlZddlZddlZddlZejejga da da da dZ dZdZdZdZdZdd Zd Zd Zd Zd ZdZdZddZddZdZdZdZdZdZ dZ!dZ"dZ#ejHjJse#dZ&e'dk(re&yy)a Append module search paths for third-party packages to sys.path. **************************************************************** * This module is automatically imported during initialization. * **************************************************************** This will append site-specific paths to the module search path. On Unix (including Mac OSX), it starts with sys.prefix and sys.exec_prefix (if different) and appends lib/python/site-packages. On other platforms (such as Windows), it tries each of the prefixes directly, as well as with lib/site-packages appended. The resulting directories, if they exist, are appended to sys.path, and also inspected for path configuration files. If a file named "pyvenv.cfg" exists one directory above sys.executable, sys.prefix and sys.exec_prefix are set to that directory and it is also checked for site-packages (sys.base_prefix and sys.base_exec_prefix will always be the "real" prefixes of the Python installation). If "pyvenv.cfg" (a bootstrap configuration file) contains the key "include-system-site-packages" set to anything other than "false" (case-insensitive), the system-level prefixes will still also be searched for site-packages; otherwise they won't. All of the resulting site-specific directories, if they exist, are appended to sys.path, and also inspected for path configuration files. A path configuration file is a file whose name has the form .pth; its contents are additional directories (one per line) to be added to sys.path. Non-existing directories (or non-directories) are never added to sys.path; no directory is added to sys.path more than once. Blank lines and lines beginning with '#' are skipped. Lines starting with 'import' are executed. For example, suppose sys.prefix and sys.exec_prefix are set to /usr/local and there is a directory /usr/local/lib/python2.5/site-packages with three subdirectories, foo, bar and spam, and two path configuration files, foo.pth and bar.pth. Assume foo.pth contains the following: # foo package configuration foo bar bletch and bar.pth contains: # bar package configuration bar Then the following directories are added to sys.path, in this order: /usr/local/lib/python2.5/site-packages/bar /usr/local/lib/python2.5/site-packages/foo Note that bletch is omitted because it doesn't exist; bar precedes foo because bar.pth comes alphabetically before foo.pth; and spam is omitted because it is not mentioned in either path configuration file. The readline module is also automatically configured to enable completion for systems that support it. This can be overridden in sitecustomize, usercustomize or PYTHONSTARTUP. Starting Python in isolated mode (-I) disables automatic readline configuration. After these operations, an attempt is made to import a module named sitecustomize, which can perform arbitrary additional site-specific customizations. If this import fails with an ImportError exception, it is silently ignored. Ncptjjrt|tjyy)Nfile)sysflagsverboseprintstderr)messages _tracer \s" yy gCJJ'ctjj|} tjj|}|tjj |fS#t$rY,wxYwN)ospathjoinabspathOSErrornormcase)pathsdirs r makepathras[ '',, C ggooc"   % %%    sA A*)A*c<ttjjD]~}d} |jj }|dvr! tjj|j|_ tjj|j|_y#t $r4 |jjj }n#t $rYnwxYwYwxYw#t ttf$rYwxYw#t ttf$rYwxYw)zESet all module __file__ and __cached__ attributes to an absolute pathN>_frozen_importlib_frozen_importlib_external)setrmodulesvalues __loader__ __module__AttributeError__spec__loaderrrr__file__r TypeError __cached__)m loader_modules r abs_pathsr*js ##% &  LL33M  S S  4AJ 77??1<<8AL!'   ! 1 1 < < !   3   3   sYB* .C*9.D* C'4 CC' C!C' C!!C'&C'*DDDDcg}t}tjD]7}t|\}}||vs|j ||j |9|tjdd|S)zK Remove duplicate entries from sys.path along with making them absoluteN)rrrrappendadd)L known_pathsrdircases r removeduppathsr1sa A%Kxx } W + % HHSM OOG $CHHQK rct}tjD]A} tjj |rt |\}}|j |C|S#t$rYQwxYw)zEReturn a set containing all existing file system items from sys.path.)rrrrexistsrr-r&)ditem_itemcases r _init_pathinfor8s` A ww~~d#&tn 8h  H   s>A!! A-,A-c | t}d}nd}tjj||} tj|}t |ddtjzst |ddtjzrtd|ytd| tj|5}|j}ddd jd }t%|j'd D]\} } | j)d r| j+dk(r, | j)dr t-| J| j/} t1|| \} } | |vrOtjj3| r0t4jj7| |j9| |rd}|S#t $rYywxYw#1swY xYw#t $rYywxYw#t$rFddl}j|j#}td |d |j#YWwxYw#t:$r} t=d| dd|dt4j>ddl }|jC| D]5}|j'D] } t=d| zt4j>"7t=dt4j>Yd} ~ d} ~ wwxYw)zProcess a .pth file within the site-packages directory: For each line in the file, either combine it with sitedir to a path and add that to known_paths, or execute it if it starts with 'import '. NTFst_flagsrst_file_attributeszSkipping hidden .pth file: zProcessing .pth file: z utf-8-sigz Cannot read z# as UTF-8. Using fallback encoding #)zimport zimport zError processing line r4z of z: rz z Remainder of file ignored)"r8rrrlstatrgetattrstat UF_HIDDENFILE_ATTRIBUTE_HIDDENr io open_codereaddecodeUnicodeDecodeErrorlocale getencoding enumerate splitlines startswithstripexecrstriprr3rr,r- Exceptionr r tracebackformat_exception)sitedirnamer/resetfullnamestf pth_contentrInlinerr0excrRrecords r addpackager_s $& ww||GT*H XXh  Z #dnn 4 )1 -0J0J J,XL9: #H< 01 \\( #q&&(K$ D"((5 [335q94 ??3   ::<2   67T ;;=D#GT2LCk)bggnnS.A$(:.  e $ #  D !((););)=> h\***0*<*<*>)AC D D,  *1Q%tH:SAzz # #44S9"--/D$t)#**50: /cjj A  snG"G7GGG+)H=A2H= G  G GG G('G(+A H:9H:= KB KKctd|| t}d}nd}t|\}}||vr0tjj ||j | tj|}|Dcgc]&}|jdr|jds|(}}t|D]}t||||rd}|S#t$rYywxYwcc}w)zTAdd 'sitedir' argument to sys.path if missing and handle .pth files in 'sitedir'zAdding directory: NTFz.pth.)r r8rrrr,r-rlistdirrendswithrMsortedr_)rTr/rV sitedircasenamesrUs r addsitedirrgs { +,$& #G,G[ + %   $ 7#$ Ded f%dooc.BeE Du 7D+.    Ds#C <+C CCcbtjjryttdr:ttdr*t j t j k7ryttdr:ttdr*t jt jk7ryy)a,Check if user site directory is safe for inclusion The function tests for the command line flag (including environment var), process uid/gid equal to effective uid/gid. None: Disabled for security reasons False: Disabled by user (command line option) True: Safe and enabled FgetuidgeteuidNgetgidgetegidT) rr no_user_sitehasattrrrjrirlrkrr check_enableusersiterpsk yyr8Y!7 ::<299; &r8Y!7 ::<299; & rc tjjdd}|r|Stjdvryd}tj dk(r,tjjdxsd}||dStjdk(r=tj r-|dd tj d tjdd zS|dd S) NPYTHONUSERBASE>wasivxworks emscriptencttjjtjj|Sr)rr expanduserr)argss r joinuserz_getuserbase..joinuser&s$ww!!"'',,"566rntAPPDATA~PythondarwinLibraryz%d.%dz.local)renvirongetrplatformrU _framework version_info)env_baserybases r _getuserbaserszz~~.5H ||887 ww$zz~~i(/Ch'' ||xCNNY#"2"22A"668 8 C ""rc tj}tjdk(r(tjj dd}|d|dStj dk(rtjr|dS|d|d d|d d S) Nrzrar>z\Pythonz\site-packagesr~z/lib/python/site-packagesz /lib/pythonrr<z/site-packages)rrrrUwinverreplacerr)userbaseversion ver_nodots r _get_pathr5sG ww$JJ&&sB/ 8I;o>> ||xCNN455Z{71:,a |> JJrc.t tatS)zReturns the `user base` directory path. The `user base` directory can be used to store data. If the global variable ``USER_BASE`` is not initialized yet, this function will also set it. ) USER_BASErrorr getuserbaserBs N rcXt}t|datSt|atS)zReturns the user-specific site-packages directory path. If the global variable ``USER_SITE`` is not initialized yet, this function will also set it. F)r USER_SITEENABLE_USER_SITEr)rs r getusersitepackagesrOs7}H  $  "(+I rctdt}tr+tjj |r t |||S)zAdd a per user site-package to sys.path Each user has its own python directory with site-packages in the home directory. zProcessing user site-packages)r rrrrisdirrg)r/ user_sites r addusersitepackagesr`s7 *+#%IBGGMM)49k* rc g}t}|t}|D]}|r||vr |j|tjdk(rt j g}t j dk7r|jd|D]I}tjj||dt jddzd}|j|K|j||jtjj|dd|S)aReturns a list containing all global site-packages directories. For each directory present in ``prefixes`` (or the global ``PREFIXES``), this function will find its `site-packages` subdirectory depending on the system environment, and will return a list of full paths. N/libz python%d.%drz site-packagesLib) rPREFIXESr-rsepr platlibdirr,rrr)prefixes sitepackagesseenprefixlibdirslibdirrs r getsitepackagesrosL 5D4   66S=~~&G~~&u%!ww||FF$1C4D4DRa4H$H$35##D) "    '    VUO L M#$ rctdt|D].}tjj |s#t ||0|S)zAdd site-packages to sys.pathzProcessing global site-packages)r rrrrrg)r/rrTs r addsitepackagesrs< ,-"8, 77== ! w ,- rctjdk(rd}nd}tjd|t_tjd|t_y)zDefine new builtins 'quit' and 'exit'. These are objects which make the interpreter exit when called. The repr of each object contains a hint at how it works. \zCtrl-Z plus ReturnzCtrl-D (i.e. EOF)quitexitN)rr _sitebuiltinsQuitterbuiltinsrr)eofs r setquitrsA vv~"!!))&#6HM!))&#6HMrcLtjdtjt_tjddt_gg}}t tdd}|s=ttdr-tjjtj}|ra|jddg|jtjj|tj|tjgtjd d ||t_y) z)Set 'copyright' and 'credits' in builtins copyrightcreditsz Thanks to CWI, CNRI, BeOpen.com, Zope Corporation and a cast of thousands for supporting Python development. See www.python.org for more information. _stdlib_dirNr%z LICENSE.txtLICENSElicensez'See https://www.python.org/psf/license/)r_Printerrrrrr@rnrrdirnamer%extendrpardircurdirr)filesdirsheres r setcopyrightrs&// S]]KH$--i:TUHb4E 3 t ,D GB +wwr{{+  mY/0 RWW\\$ 2D"))DE$--1 tHrc>tjt_yr)r_Helperrhelprorr sethelperrs!))+HMrc d}|t_y)ajEnable default readline configuration on interactive prompts, by registering a sys.__interactivehook__. If the readline module can be imported, the hook will set the Tab key as completion key and register ~/.python_history as history file. This can be overridden in the sitecustomize or usercustomize module, or in a PYTHONSTARTUP file. cddl} ddlddl}t dd}|d|vrj dnj d j jdk(rgtjjtjjdd jfd }|j|yy#t$rYywxYw#t$rYwxYw#t$rYBwxYw) Nr__doc__r>libeditzbind ^I rl_completez tab: completer|z.python_historycH jy#t$rYywxYwr)write_history_filer)historyreadlinesr write_historyzCenablerlcompleter..register_readline..write_historys*//8s  !!)atexitr rlcompleter ImportErrorr@parse_and_bindread_init_filerget_current_history_lengthrrrrwread_history_fileregister)rr readline_docrrrs @@r register_readlinez,enablerlcompleter..register_readlines    xB7  # \(A  # #$9 :  # #O 4   # # %  . . 0A 5 ggll277#5#5c#:#46G **73  OOM *+ 6)       "  s5CC!(C0 CC! C-,C-0 C<;C<N)r__interactivehook__)rs r enablerlcompleterrs.+`0CrcBtj}tjdk(r#d|vrtjdx}t_ntj }tj jtj j|}tj j|}dt_ d}tdtj j||tj j||fDd}|r|}d}t|d5} | D]q} d| vs| jd\} } } | jj} | j} | d k(r| j}a| d k(sg| t_ s ddd|xt_t_t%|tj g|dk(r&t&j)d tj |Stj gad a|S#1swYzxYw) Nr~__PYVENV_LAUNCHER__z pyvenv.cfgc3^K|]%}tjj|r|'ywr)rrisfile).0conffiles r zvenv.. s. &ww~~h' &s+-truezutf-8)encoding=zinclude-system-site-packageshomerF)rrrr_base_executable executablerrr_homenextropen partitionrNlowerr exec_prefixrrinsertr)r/envrexe_dir site_prefix conf_basenamecandidate_conf virtual_conf system_siterYr\keyr6values r venvrs **C ||x$9S$@,.JJ7L,MM S)^^ ggoobggooj9:G''//'*KCI M  Wm4 [-8&   N%  , 1Q$;$(NN3$7MCE))+++-C!KKME<<&+kkm $) 2(32 S_  cjj\2 & OOAszz *  |H$  12 1s$ H/AH HHc ddl}y#t$r}|jdk(rnYd}~yd}~wwxYw#t$r}tj j r%t jt jn?tjjd|jjd|dYd}~yYd}~yd}~wwxYw)z,Run custom site specific code, if available.rN sitecustomizez9Error in sitecustomize; set PYTHONVERBOSE for traceback: :  ) rrrUrQrrr excepthookexc_infor write __class____name__)rr]errs r execsitecustomizer3/   xx?*  / 99   NNCLLN + JJ  ''. / / ,/) ,'/,/ CA9B;;Cc ddl}y#t$r}|jdk(rnYd}~yd}~wwxYw#t$r}tj j r%t jt jn?tjjd|jjd|dYd}~yYd}~yd}~wwxYw)z,Run custom user specific code, if available.rN usercustomizez9Error in usercustomize; set PYTHONVERBOSE for traceback: rr) rrrUrQrrrrrr rrr)rr]rs r execusercustomizer Grrctjdd}t}|tjk7r tt |}t t at|}t|}ttttjjs ttt r t!yy)zAdd standard site-specific directories to the module search path. This function is called automatically when this module is imported, unless the python interpreter was started with the -S flag. N)rrr1r*rrrprrrrrrisolatedrrr ) orig_pathr/s r mainr [s I "KCHH  {#K/1%k2K!+.K IN K 99  rcd}tjdd}|st}t}t dtj D]}t d|dt dd}t d|d ||d t d |d ||d t d t tjd g}d|vr|jtd|vr|jt|rt tjj|t rtjd yt durtjdyt tjdytjdyd dl}t |j|tjd tjfztjdy)Na %s [--user-base] [--user-site] Without arguments print some useful information With arguments print the value of USER_BASE and/or USER_SITE separated by '%s'. Exit codes with --user-base or --user-site: 0 - user site directory is enabled 1 - user site directory is disabled by user 2 - user site directory is disabled by super user or for security reasons >2 - unknown error r<z sys.path = [z ,]cH| tjj|ryy)Nr3z doesn't exist)rrr)rs r r3z_script..existssBGGMM$$7&rz USER_BASE: z ()z USER_SITE: zENABLE_USER_SITE: rz --user-basez --user-siteFr )rargvrrr rrrr,rrrpathseprtextwrapdedent)rrx user_baserrr3bufferrs r _scriptr}si D 88AB>?@  r__main__r)(rrrrrrDrArrrrrrr rr*r1r8r_rgrprrrrrrrrrrrrrr r rno_siterrrorr rsEN   JJ (   ( &.&  ?D4@#0 K " B 7 *,90v4n/(/(> yyF4l z Ir dZddlZddlZddlZddlmZeee Z ejZ gdZ dZdZde vrIdZdZdd l dd lmZe j)d ddlZ dd lmZddlZe j3ee[nUd e vrId ZdZdd l dd lmZe j)d ddlZddlZe j3ee[ dd lmZnedeej8d<ddlmZmZm Z m!Z!m"Z"m#Z#m$Z$m%Z%[ edre&Z'dZ(e)Z*e(dde(dde(dde(dde(dde(dde(d d!e(d"d#e(d$d%e(d&d'e(d(d)e(d*d+e(d,d-e(d.d/e(d.d0e(d1de*Z+e)Z*e(dde*Z,e)Z*e(d2d3e(d4de(d5de(d6d7e(d6d8e(d9d:e*j[ee(d;d<e(d=de(d>de(d?d@edAredBr e(dCdAe*Z.e)Z*e(dde(dde(dde(dDdEe(dFdedGr e(dHde(dde(dIde(dJde(dde(d1de(dKde*Z/[*[['[(dZ0dLZ1dMZ2ddOZ3dPZ4dQZ5e j3gdRe6Z7ddSZ8e j)dTe9ehe+kr)e:ehe.kr"ddNddUdVZ;dZdWZ?e j)dXdYZ@dZZAd[ZBd\ZCd]ZDd^ZEe j3gd_dd`ZFddaZGddblmHZHmIZIGdcddeHZJdeZKeKZL[KddfZMed k7ZNe j3dgeNr/dhZOeJeLjeOeQeOeQZR[OddiZSe j3djdkZTeT\ZUZV[TedlrKedmsCednr;dZWdLxZXZYe j3gdodpZZdqZ[drZ\dsZ]dtZ^e j3gduedmrdvZ_dwZ`e j3dxdygedzrd{Zad|Zbe j3d}d~gejdk7rddZdGddZee j)dddZfdZgeds egZhdeh_iGddejZked k(rGddZldZmyy#e$rYwxYw#e$rYwxYw#e$rYWwxYw#e$rY3wxYw)aNOS routines for NT or Posix depending on what system we're on. This exports: - all functions from posix or nt, e.g. unlink, stat, etc. - os.path is either posixpath or ntpath - os.name is either 'posix' or 'nt' - os.curdir is a string representing the current directory (always '.') - os.pardir is a string representing the parent directory (always '..') - os.sep is the (or a most common) pathname separator ('/' or '\\') - os.extsep is the extension separator (always '.') - os.altsep is the alternate pathname separator (None or '/') - os.pathsep is the component separator used in $PATH etc - os.linesep is the line separator in text files ('\r' or '\n' or '\r\n') - os.defpath is the default search path for executables - os.devnull is the file path of the null device ('/dev/null', etc.) Programs that import and use 'os' stand a better chance of being portable between different platforms. Of course, they must then only use functions that are defined by all platforms (e.g., unlink and opendir), and leave all pathname manipulation to os.path (e.g., split and join). N)_check_methods)altsepcurdirpardirseppathseplinesepdefpathnamepathdevnullSEEK_SETSEEK_CURSEEK_ENDfsencodefsdecode get_exec_pathfdopenextsepc|tvSN)globals)r s _existsr)s 79 c t|jS#t$r+t|Dcgc] }|ddk7s |ncc}wc}cYSwxYw)Nr_)list__all__AttributeErrordir)modulens r_get_exports_listr$,sH7FNN## 7v;6;a!A$#+;667sA  AA A  A posix )*)_exitr()_have_functionsntz zno os specific module foundzos.path)rrrrr rrr r)c`|tvr&|tvrtjt|yyyr)_globalsr)_setadd)strfns r_addr1hs' (N!7 HHXb\ ""8NrHAVE_FACCESSATaccess HAVE_FCHMODATchmod HAVE_FCHOWNATchown HAVE_FSTATATstatHAVE_FUTIMESATutime HAVE_LINKATlink HAVE_MKDIRATmkdir HAVE_MKFIFOATmkfifo HAVE_MKNODATmknod HAVE_OPENATopenHAVE_READLINKATreadlink HAVE_RENAMEATrenameHAVE_SYMLINKATsymlink HAVE_UNLINKATunlinkrmdirHAVE_UTIMENSAT HAVE_FCHDIRchdir HAVE_FCHMOD HAVE_FCHOWNHAVE_FDOPENDIRlistdirscandir HAVE_FEXECVEexecveHAVE_FTRUNCATEtruncate HAVE_FUTIMENS HAVE_FUTIMESHAVE_FPATHCONFpathconfstatvfsfstatvfs HAVE_FSTATVFS HAVE_LCHFLAGSchflags HAVE_LCHMODlchown HAVE_LCHOWN HAVE_LUTIMES HAVE_LSTAT MS_WINDOWSFctj|\}}|stj|\}}|rQ|rOtj|s: t||t }t |trtt d}||k(ry t||y#t$rYEwxYw#t$r|rtj|sYywxYw)amakedirs(name [, mode=0o777][, exist_ok=False]) Super-mkdir; create a leaf directory and all intermediate ones. Works like mkdir, except that any intermediate path segment (not just the rightmost) will be created if it does not exist. If the target directory already exists, raise an OSError if exist_ok is False. Otherwise no exception is raised. This is recursive. )exist_okASCIIN) r splitexistsmakedirsFileExistsErrorr isinstancebytesr?OSErrorisdir)r modermheadtailcdirs rrqrqsD!JD$ ZZ% d T[[.  TH - dE ")D 4<  dD    tzz$/  0s$ B B# B B #!CCct|tj|\}}|stj|\}}|r.|r+ t|tj|\}}|r|r)yyyy#t$rYywxYw)aremovedirs(name) Super-rmdir; remove a leaf directory and all empty intermediate ones. Works like rmdir except that, if the leaf directory is successfully removed, directories corresponding to rightmost path segments will be pruned away until either the whole path is consumed or an error occurs. Errors during this latter phase are ignored -- they generally mean that a directory was not empty. N)rNr roru)r rxrys r removedirsr|sx $KD!JD$ ZZ% d 4  $KZZ% d 4$4$   s A// A;:A;ctj|\}}|r"|r tj|s t|t ||tj|\}}|r|r t |yyy#t $rYywxYw)a<renames(old, new) Super-rename; create directories as necessary and delete any left empty. Works like rename, except creation of any intermediate directories needed to make the new pathname good is attempted first. After the rename, directories corresponding to rightmost path segments of the old name will be pruned until either the whole path is consumed or a nonempty directory is found. Note: this function can fail with the new directory structure made if you lack permissions needed to unlink the leaf directory or file. N)r rorprqrIr|ru)oldnewrxrys rrenamesrstCJD$ T[[. 3CJD$   t t   s& A44 B?B)rqr|rc#Ktjd||||t|g}tjtj }}|r|j }t|tr|'g}g}g} t|} d} | 5 t| } |tur&| jdxr| j }n| j}|r|j!| j"n|j!| j"|s8|r6|rd}n | j%}| }|r| j!| jyy#t$r} ||| Yd} ~ d} ~ wwxYw#t$rYnHwxYw#t$r} ||| d} Yd} ~ n*d} ~ wwxYw#t$rd}YwxYw#t$rd}YwxYwdddn #1swYnxYw| r|r=|||ft'|D]'}|||}|s ||r|j!|)n5|j!|||ft'| D]}|j!||r w)a& Directory tree generator. For each directory in the directory tree rooted at top (including top itself, but excluding '.' and '..'), yields a 3-tuple dirpath, dirnames, filenames dirpath is a string, the path to the directory. dirnames is a list of the names of the subdirectories in dirpath (including symlinks to directories, and excluding '.' and '..'). filenames is a list of the names of the non-directory files in dirpath. Note that the names in the lists are just names, with no path components. To get a full path (which begins with top) to a file or directory in dirpath, do os.path.join(dirpath, name). If optional arg 'topdown' is true or not specified, the triple for a directory is generated before the triples for any of its subdirectories (directories are generated top down). If topdown is false, the triple for a directory is generated after the triples for all of its subdirectories (directories are generated bottom up). When topdown is true, the caller can modify the dirnames list in-place (e.g., via del or slice assignment), and walk will only recurse into the subdirectories whose names remain in dirnames; this can be used to prune the search, or to impose a specific order of visiting. Modifying dirnames when topdown is false has no effect on the behavior of os.walk(), since the directories in dirnames have already been generated by the time dirnames itself is generated. No matter the value of topdown, the list of subdirectories is retrieved before the tuples for the directory and its subdirectories are generated. By default errors from the os.scandir() call are ignored. If optional arg 'onerror' is specified, it should be a function; it will be called with one argument, an OSError instance. It can report the error to continue with the walk, or raise the exception to abort the walk. Note that the filename is available as the filename attribute of the exception object. By default, os.walk does not follow symbolic links to subdirectories on systems that support them. In order to get this functionality, set the optional argument 'followlinks' to true. Caution: if you pass a relative pathname for top, don't change the current working directory between resumptions of walk. walk never changes the current directory, and assumes that the client doesn't either. Example: import os from os.path import join, getsize for root, dirs, files in os.walk('python/Lib/email'): print(root, "consumes ") print(sum(getsize(join(root, name)) for name in files), end=" ") print("bytes in", len(files), "non-directory files") if 'CVS' in dirs: dirs.remove('CVS') # don't visit CVS directories zos.walkNFTfollow_symlinks)sysauditfspathr islinkjoinpoprstuplerVrunext StopIteration_walk_symlinks_as_filesis_dir is_junctionappendr is_symlinkreversed)toptopdownonerror followlinksstackrrdirsnondirs walk_dirs scandir_iterrorcontentryr walk_intordirnamenew_paths rwalkrsUxIIigw < C[ME;; DF iik c5 !I    J    $Z 0#"&==!&e!D!`UM^M^M`I`!& KK +NN5::.6#$( /).)9)9);J )3N  !((4W1 " "  )*D ##F#$ '/*/J /IZZZ   tW$ $#D>W- fX&6LL** LL#tW- .$Y/ X&0o sA3I6 E IG E+G>FAGF-'!GI E( E#I#E((I+ E74E:5G6E77E:: F FGFG F*'G)F**G- F;8G:F;;G> IG 5IA Irrdir_fdc#Ktjd|||||t|}td|||dffg}t |t } |rt |||||Ed{|r|r+|j\}}|tk(r t||r*yy75#|r+|j\}}|tk(r t||r*wwxYww)aDirectory tree generator. This behaves exactly like walk(), except that it yields a 4-tuple dirpath, dirnames, filenames, dirfd `dirpath`, `dirnames` and `filenames` are identical to walk() output, and `dirfd` is a file descriptor referring to the directory `dirpath`. The advantage of fwalk() over walk() is that it's safe against symlink races (when follow_symlinks is False). If dir_fd is not None, it should be a file descriptor open to a directory, and top should be relative; top will then be relative to that directory. (dir_fd is always supported for fwalk.) Caution: Since fwalk() yields file descriptors, those are only valid until the next iteration step, so you should dup() them if you want to keep them for a longer period. Example: import os for root, dirs, files, rootfd in os.fwalk('python/Lib/email'): print(root, "consumes", end="") print(sum(os.stat(name, dir_fd=rootfd).st_size for name in files), end="") print("bytes in", len(files), "non-directory files") if 'CVS' in dirs: dirs.remove('CVS') # don't visit CVS directories zos.fwalkTN) rrr _fwalk_walkrsrt_fwalkr _fwalk_closeclose) rrrrrrisbytesactionvalues rfwalkrsB *c7G_fMSkfc3=>?S%( !!%'7OTTT % \)%LU % \)%Ls<ACBBB#+CCB,CCCc #K|j\}}|tk(r t|y|tk(r|y|tk(sJ|\}}} } |s#| t | d|} n| j d} t | ttz||jtf|sB|r tj jsytj t syt!} g}g}|s|rdng}| D]b} | j"}|r t%|} | j'r%|j||#|j| n|j|d|r ||fn|jt||fftj*dd|"|j-fd|dddDy|j-fdt/|ddd|dddDy#t$r} |r||| Yd} ~ yd} ~ wwxYw#t$r6 | j)r|j|n#t$rYnwxYwY[wxYww) NFrr)rrc3>K|]}td|z|dffywFNr).0r topfdtoppaths r z_fwalk..2s-(&DueWt^T4HI&sc3DK|]\}}td|z||ffywrr)rr rrrs rrz_fwalk..6s2C#AKD%ueWt^T5IJ#As )rrr _fwalk_yieldrr9rEO_RDONLY O_NONBLOCKrurstS_ISDIRst_moder samestatrVr rrrrextendzip)rrrrrrrisrootdirfdtopnamerorig_sterrrrrentriesr rrs @@rrrsT   \ ! %L  | #K $$$16.w "="7E%PG#jjj?G(Z"7FE  lE*+bjj9==$u+6U^ !_$"E::D~ <<>KK%*u-NN4( & 4%/ / LL,$(GH I))GWRa[1 ? LL( 2J( ( LLC#&tDbDz74R4=#AC C_ "   8 '')t,  s{A I >G; BI AH$BI ; H HI HI  I(!I  I IIIII II rct||y)zpexecl(file, *args) Execute the executable file with argument list args, replacing the current process. N)execvfileargss rexeclr<s  $rc.|d}t||dd|y)zexecle(file, *args, env) Execute the executable file with argument list args and environment env, replacing the current process. rN)rXrrenvs rexeclerCs r(C 4crC rct||y)zexeclp(file, *args) Execute the executable file (which is searched for along $PATH) with argument list args, replacing the current process. N)execvprs rexeclprKs  4rc.|d}t||dd|y)zexeclpe(file, *args, env) Execute the executable file (which is searched for along $PATH) with argument list args and environment env, replacing the current process. rN)execvpers rexeclperRs r(C D$s)S!rct||y)zexecvp(file, args) Execute the executable file (which is searched for along $PATH) with argument list args, replacing the current process. args may be a list or tuple of strings. N_execvpers rrr[s  T4rct|||y)zexecvpe(file, args, env) Execute the executable file (which is searched for along $PATH) with argument list args and environment env, replacing the current process. args may be a list or tuple of strings. Nrrs rrrcs T4r)rrrrrrc| t}||f}nt}|f}t}tj|r ||g|yd}t |}t dk7rt|}tt|}|D]"}tj||} ||g|$|| #ttf$r } | } Yd} ~ Ad} ~ wt$r} | } || }Yd} ~ Xd} ~ wwxYw)Nr*) rXrenvironr rrr rmaprFileNotFoundErrorNotADirectoryErrorru) rrr exec_funcargrest saved_exc path_listr!fullnameelast_excs rrrns  + ' ||D$!!Ic"I t|~), 99S$'  h ) ) N"#56 H H   s$ BC )B00 C <CC cddl}|t}|j5|jdt |j d}tr2 |d}| td|}|t|tr t|}dddt}|jtS#t $rd}YjwxYw#tt f$rYdwxYw#1swYLxYw)zReturns the sequence of directories that will be searched for the named executable (similar to a shell) when launching a process. *env* must be an environment variable dict or None. If *env* is None, os.environ will be used. rNignorePATHsPATHz*env cannot contain 'PATH' and b'PATH' keys)warningsrcatch_warnings simplefilter BytesWarningget TypeErrorsupports_bytes_environ ValueErrorKeyErrorrsrtrr ror)rrr path_listbs rrrs {  "h 5 I " ' \ ($DFF& $Iu)E$Y/ ) #, ??7 ##' I  i(   # "sRC B#C  B4,C # B1.C 0B11C 4CC CC  C)MutableMappingMappingcTeZdZdZdZdZdZdZdZdZ dZ d Z d Z d Z d Zy )_EnvironcJ||_||_||_||_||_yr) encodekey decodekey encodevalue decodevalue_data)selfdatarrrrs r__init__z_Environ.__init__s'""&& rc |j|j|}|j|S#t$r t|dwxYwr)rrrrrkeyrs r __getitem__z_Environ.__getitem__sN *JJt~~c23E&& *3-T ) *s 1Ac~|j|}|j|}t||||j|<yr)rrputenvrrs r __setitem__z_Environ.__setitem__s7nnS!  'sE 3rc|j|}t| |j|=y#t$r t|dwxYwr)runsetenvrr)rr encodedkeys r __delitem__z_Environ.__delitem__sD^^C(  * :& *3-T ) *s ,Ac#jKt|j}|D]}|j|ywr)rrr)rkeysrs r__iter__z_Environ.__iter__s-DJJC..% %s13c,t|jSr)lenrrs r__len__z_Environ.__len__s4::rctdjfdjjD}d|dS)Nz, c3nK|],\}}j|dj|.yw)z: N)rr)rrrrs rrz$_Environ.__repr__..s>$ 0 U~~c"%R(8(8(?'B C0s25z environ({z}))rritems)rformatted_itemss` r__repr__z_Environ.__repr__s=))$ "jj..0$  O,C00rct|Sr)dictrs rcopyz _Environ.copys Dzrc||vr|||<||Srrs r setdefaultz_Environ.setdefaults d?DICyrc(|j||Sr)update)rothers r__ior__z_Environ.__ior__s E rcjt|tstSt|}|j ||SrrsrNotImplementedrrrr rs r__or__z_Environ.__or__s,%)! !4j 5 rcjt|tstSt|}|j ||Srr#r%s r__ror__z_Environ.__ror__s,%)! !5k 4 rN)__name__ __module__ __qualname__rrrr rrrrrr!r&r(rrrrrs>' *& 1 rrctdk(r:d}|t}fd}i}tjD]\}}||||<n&t j fdfd}}t}t ||||S)Nr*cht|ts!tdt|jz|S)Nstr expected, not %s)rsr/rtyper)rs r check_strz!_createenviron..check_str s,eS) 6e9M9M MNNLrc0|jSr)upper)rencodes rrz!_createenviron..encodekeys#;$$& &rct|ts!tdt|jz|j dS)Nr.surrogateescape)rsr/rr/r)r4rencodings rr4z_createenviron..encodes:eS) 6e9M9M MNN<<*;< .decodes<<*;< s rgetenvbrE=s||C))r)rDrEcvtjtjfd}fd}||fS)Ncbt|}t|tr|jS|S)aEncode filename (an os.PathLike, bytes, or str) to the filesystem encoding with 'surrogateescape' error handler, return bytes unchanged. On Windows, use 'strict' error handler if the file system encoding is 'mbcs' (which is the default encoding). )rrsr/r4filenamer8errorss rrz_fscodec..fsencodeIs/ (# h $??8V4 4Orcbt|}t|tr|jS|S)aDecode filename (an os.PathLike, bytes, or str) from the filesystem encoding with 'surrogateescape' error handler, return str unchanged. On Windows, use 'strict' error handler if the file system encoding is 'mbcs' (which is the default encoding). )rrsrtr:rHs rrz_fscodec..fsdecodeUs/ (# h &??8V4 4Or)rr;getfilesystemencodeerrors)rrr8rJs @@r_fscodecrMEs6((*H  * * ,F   X rforkspawnvr)P_WAITP_NOWAIT P_NOWAITOc:t|ttfs td|r|ds t dt }|s | |||n ||||yy|tk(r|S t|d\}}t|rt|S#t dYyxYw)Nzargv must be a tuple or a listrz"argv first element cannot be empty) rsrrrrrNr(rQwaitpid WIFSTOPPEDwaitstatus_to_exitcode)rwrrrfuncpidwpidstss r _spawnvefr\rs$ .<= =47AB Bf ;t$tS)%x #CO cc?-c22 c s B Bc(t|||dtS)aspawnv(mode, file, args) -> integer Execute file with arguments from args in a subprocess. If mode == P_NOWAIT return the pid of the process. If mode == P_WAIT return the process's exit code if it exits normally; otherwise return -SIG, where SIG is the signal that killed it. N)r\rrwrrs rrOrOstT477rc(t||||tS)a:spawnve(mode, file, args, env) -> integer Execute file with arguments from args in a subprocess with the specified environment. If mode == P_NOWAIT return the pid of the process. If mode == P_WAIT return the process's exit code if it exits normally; otherwise return -SIG, where SIG is the signal that killed it. )r\rXrwrrrs rspawnverastT377rc(t|||dtS)a8spawnvp(mode, file, args) -> integer Execute file (which is looked for along $PATH) with arguments from args in a subprocess. If mode == P_NOWAIT return the pid of the process. If mode == P_WAIT return the process's exit code if it exits normally; otherwise return -SIG, where SIG is the signal that killed it. N)r\rr^s rspawnvprcstT488rc(t||||tS)a\spawnvpe(mode, file, args, env) -> integer Execute file (which is looked for along $PATH) with arguments from args in a subprocess with the supplied environment. If mode == P_NOWAIT return the pid of the process. If mode == P_WAIT return the process's exit code if it exits normally; otherwise return -SIG, where SIG is the signal that killed it. )r\rr`s rspawnvperestT388r)rOrarcrect|||S)aspawnl(mode, file, *args) -> integer Execute file with arguments from args in a subprocess. If mode == P_NOWAIT return the pid of the process. If mode == P_WAIT return the process's exit code if it exits normally; otherwise return -SIG, where SIG is the signal that killed it. )rOr^s rspawnlrgsdD$''rc.|d}t|||dd|S)a:spawnle(mode, file, *args, env) -> integer Execute file with arguments from args in a subprocess with the supplied environment. If mode == P_NOWAIT return the pid of the process. If mode == P_WAIT return the process's exit code if it exits normally; otherwise return -SIG, where SIG is the signal that killed it. rN)rar`s rspawnleris$2htT49c22rrgrircct|||S)aWspawnlp(mode, file, *args) -> integer Execute file (which is looked for along $PATH) with arguments from args in a subprocess with the supplied environment. If mode == P_NOWAIT return the pid of the process. If mode == P_WAIT return the process's exit code if it exits normally; otherwise return -SIG, where SIG is the signal that killed it. )rcr^s rspawnlprkstT4((rc.|d}t|||dd|S)a]spawnlpe(mode, file, *args, env) -> integer Execute file (which is looked for along $PATH) with arguments from args in a subprocess with the supplied environment. If mode == P_NOWAIT return the pid of the process. If mode == P_WAIT return the process's exit code if it exits normally; otherwise return -SIG, where SIG is the signal that killed it. rN)rer`s rspawnlperms$2hdD"Is33rrkrmvxworksct|tstdt|z|dvrt d|z|dk(s| t dddl}|dk(r6|j |dd|j|}t|j|S|j |dd|j| }t|j|S) Nz&invalid cmd type (%s, expected string))rwzinvalid mode %rrz+popen() does not support unbuffered streamsrpT)shelltextstdoutbufsize)rrrsstdinru) rsr/rr/r subprocessPopenPIPE _wrap_closertrv)cmdrw bufferingrwprocs rpopenr~s#s#DtCyPQ Q z !.56 6 >Y.JK K 3;##C*.T+5??,5$7Dt{{D1 1##C*.T*4//,5$7Dtzz40 0rc0eZdZdZdZdZdZdZdZy)rzc ||_||_yr)_stream_proc)rstreamr}s rrz_wrap_close.__init__ s!DLDJrc|jj|jj}|dk(rytdk(r|S|dzS)Nrr*)rrrwaitr )r returncodes rrz_wrap_close.closesC LL   *JQt|!!!Q&rc|Srrrs r __enter__z_wrap_close.__enter__Krc$|jyrrrrs r__exit__z_wrap_close.__exit__ JJLrc.t|j|Sr)getattrr)rr s r __getattr__z_wrap_close.__getattr__s4<<. .rc,t|jSr)iterrrs rrz_wrap_close.__iter__s % %rN) r)r*r+rrrrrrrrrrzrz s   '   / &rrzr~ct|tstdt|zddl}d|vr|j |}|j ||||g|i|S)Nz&invalid fd type (%s, expected integer)rb)rsintrr/io text_encodingrE)fdrwr|r8rkwargsrs rrr$s\ b# @48KLL  $##H- 2772tY B4 B6 BBrcpt|ttfr|St|} |j |}t|ttfr|Stdj|jt|j#t $r&t |drtd|jzwxYw)aaReturn the path representation of a path-like object. If str or bytes is passed in, it is returned unchanged. Otherwise the os.PathLike interface is used to get the path representation. If the path representation is not str or bytes, TypeError is raised. If the provided path is not str, bytes, or os.PathLike, TypeError is raised. __fspath__z/expected str, bytes or os.PathLike object, not z7expected {}.__fspath__() to return str or bytes, not {}) rsr/rtr/rr hasattrrr)format)r path_type path_reprs r_fspathr/s$e % T I9((. )c5\*!!' (:(:(,Y(@(@"BC C 9 9l + #%.%7%789 9 9s B/B5rcTeZdZdZej dZedZee Z y)PathLikezCAbstract base class for implementing the file system path protocol.ct)z9Return the file system path representation of the object.)NotImplementedErrorrs rrzPathLike.__fspath__Ws "!rc6|tur t|dStS)Nr)rrr$)clssubclasss r__subclasshook__zPathLike.__subclasshook__\s (?!(L9 9rN) r)r*r+__doc__abcabstractmethodr classmethodr GenericAlias__class_getitem__rrrrrSs>M"" $L1rrc*eZdZdZdZdZdZdZy)_AddedDllDirectoryc.||_||_||_yr)r _cookie_remove_dll_directory)rr cookieremove_dll_directorys rrz_AddedDllDirectory.__init__gsDI!DL)=D &rcH|j|jd|_yr)rrr rs rrz_AddedDllDirectory.closeks  & &t|| 4DIrc|Srrrs rrz_AddedDllDirectory.__enter__nrrc$|jyrrrs rrz_AddedDllDirectory.__exit__prrcR|jrdj|jSy)Nzz)r rrs rrz_AddedDllDirectory.__repr__rs!yy299$))DD*rN)r)r*r+rrrrrrrrrrfs >    +rrc\ddl}|j|}t|||jS)aOAdd a path to the DLL search path. This search path is used when resolving dependencies for imported extension modules (the module itself is resolved through sys.path), and also by ctypes. Remove the directory by calling close() on the returned object or using it in a with statement. rN)r*_add_dll_directoryrr)r r*rs radd_dll_directoryrws5 &&&t,!    $ $  r)iF)TNF).TNr)rpr)rprN)nrrrr9r_collections_abcrr/rrrbuiltin_module_names_namesrrr$r r r%r(r ImportError posixpathr r)rr*ntpathmodulesos.pathrrrrr rrr rr,r1setr-supports_dir_fdsupports_effective_idsr. supports_fdsupports_follow_symlinksrrrrqr|robjectrrrErVrrrrrrrrrrrrrrrrr<rr@rrBrrtrDrErMrrrPrQrRr\rOrarcrergrirkrmplatformr~rzrrrr)ABCrrrrrrrs0 +DI ! !  7 f DG w ) NN$U+,  V^ DG w  NN$R()  & 3 44 I     yH# 5D H%G$G$F# G$F#G$H%G$F# J'H% I&H%G$ G$O 5D H%! 5DG$G$G$ I& I&H%HHTN J'G$G$ J'ygj1 _i(K 5D H%, G$F#I&G$x ]G$F#G$F#F# G$F##     @&,445!(X'tv$x FFO2sww2$4<++" %U!               sHS S+S7 TS('S(+S43S47T?TT  T `dZdZdZdZdZdZdZdZdZddl Z ddl Z ddl Z ddl Z dd l gd Z d Zd Zd ZdZdZdZe j(je_dZdZdZdZdZdZdZdZdadadZ ddl m!Z"dZ$dddZ%d Z&e jNd!k(Z(d$d"Z)d#Z*y#e#$rdZ"Y-wxYw)%aCommon operations on Posix pathnames. Instead of importing this module directly, import os and refer to this module as os.path. The "os.path" name is an alias for this module on Posix systems; on other systems (e.g. Windows), os.path provides the same operations in a manner specific to that platform, and is an alias to another module (e.g. ntpath). Some of this can actually be useful on non-Posix systems too, e.g. for manipulation of the pathname component of URLs. .../:z /bin:/usr/binNz /dev/null)*)(normcaseisabsjoin splitdrive splitrootsplitsplitextbasenamedirname commonprefixgetsizegetmtimegetatimegetctimeislinkexistslexistsisdirisfileismount expanduser expandvarsnormpathabspathsamefile sameopenfilesamestatcurdirpardirseppathsepdefpathaltsepextsepdevnullrealpathsupports_unicode_filenamesrelpath commonpath isjunctionc&t|tryy)N/r) isinstancebytespaths _get_sepr7)s$c,tj|S)z6Normalize case of pathname. Has no effect under Posixosfspath)ss r6rr4s 99Q<r8cdtj|}t|}|j|S)zTest whether a path is absolute)r;r<r7 startswith)r=r%s r6r r <s' ! A 1+C << r8cjtj|}t|}|} |s|dd|zttj|D]7}|j |r|}|r|j |r||z }0|||zz }9 |S#t ttf$rtjd|g|wxYw)zJoin two or more pathname components, inserting '/' as needed. If any component is an absolute path, all previous path components will be discarded. An empty last part will result in a path that ends with a separator.Nrr ) r;r<r7mapr?endswith TypeErrorAttributeError BytesWarning genericpath_check_arg_types)apr%r5bs r6r r Gs ! A 1+C D  !HsNRYY"A||C T]]3/ a # K ~| 4$$VQ33 s AB-B2ctj|}t|}|j|dz}|d|||d}}|r"||t |zk7r|j |}||fS)zSplit a pathname. Returns tuple "(head, tail)" where "tail" is everything after the final slash. Either part may be empty.Nr;r<r7rfindlenrstrip)rIr%iheadtails r6r r dsk ! A 1+C  qA2A!"$D CI %{{3 :r8ctj|}t|trd}d}nd}d}t j ||d|S)Nr1.rr)r;r<r2r3rF _splitext)rIr%r)s r6rrusD ! A!U  Cv 66r8c:tj|}|dd|fS)zJSplit a pathname into drive and path. On Posix, drive is always empty.Nrr:)rIs r6r r s  ! A Ra5!8Or8ctj|}t|trd}d}nd}d}|dd|k7r|||fS|dd|k7s|dd|k(r|||ddfS||dd|ddfS) aSplit a pathname into drive, root and tail. On Posix, drive is always empty; the root may be empty, a single slash, or two slashes. The tail contains anything after the root. For example: splitroot('foo/bar') == ('', '', 'foo/bar') splitroot('/foo/bar') == ('', '/', 'foo/bar') splitroot('//foo/bar') == ('', '//', 'foo/bar') splitroot('///foo/bar') == ('', '/', '//foo/bar') r1r8rNrL)r;r<r2r3)rIr%emptys r6r r s ! A!U!u|eQ 1Q3!Aa&C-c1QR5  aeQqrU""r8cttj|}t|}|j|dz}||dS)z)Returns the final component of a pathnamerLN)r;r<r7rN)rIr%rQs r6rrs5 ! A 1+C  qA QR5Lr8ctj|}t|}|j|dz}|d|}|r"||t |zk7r|j |}|S)z-Returns the directory component of a pathnamerLNrM)rIr%rQrRs r6rrsZ ! A 1+C  qA Ra5D CI %{{3 Kr8c.tj|y)zQTest whether a path is a junction Junctions are not a part of posix semanticsFr:r4s r6r/r/sIIdO r8cZ tj|y#ttf$rYywxYw)zCTest whether a path exists. Returns True for broken symbolic linksFT)r;lstatOSError ValueErrorr4s r6rrs0   Z s **c tj|}tj|jrytj|}t|tr t|d}n t|d}t|} tj|}|j}|j}||k7ry|j}|j}||k(ryy#t t f$rYywxYw#t t f$rYywxYw)z$Test whether a path is a mount pointF..rT)r;rastatS_ISLNKst_moderbrcr<r2r3r r+st_devst_ino)r5s1parents2dev1dev2ino1ino2s r6rrs XXd^ << # 99T?D$dE"dD! f F XXf  99D 99D t| 99D 99D t| 7 Z  Z s#CC(C%$C%(C:9C:crtj|}t|trd}nd}|j |s|St |}|j |d}|dkr t|}|dk(rZdtjvr4 ddl } |jtjj}natjd}nM ddl }|d|}t|trtj|} |j!|}|j}|t"j$dk(r|St|trtj&|}d}nd }|j)|}|||dzxs|S#t$r|cYSwxYw#t$r|cYSwxYw#t$r|cYSwxYw#t$r|cYSwxYw) zOExpand ~ and ~user constructions. If user or $HOME is unknown, do nothing.~~rLrHOMENvxworksr1r)r;r<r2r3r?r7findrOenvironpwd ImportErrorgetpwuidgetuidpw_dirKeyErrorfsdecodegetpwnamsysplatformfsencoderP) r5tilder%rQryuserhomenamepwentroots r6rrs 99T?D$ ??5 ! 4.C #qA1u IAv  #  << 4;; zz&)H  Aay dE ";;t$D LL&E <<CLLI5 $;;x(t$H tABx  (D(I        K  K sHE5-F F:F(5 FF FF F%$F%( F65F6c,tj|}t|trRd|vr|Sts ddl}|j d|jatj}d}d}ttdd}nPd|vr|Sts ddl}|j d |ja tj}d }d }tj}d} |||}|s |S|jd\}}|jd } | j|r| j|r| d d } |:tj tjtj"| } n|| } ||d} |d|| z}t%|}|| z }#t&$r|}YwxYw)zZExpand shell variables of form $var and ${var}. Unknown variables are left unchanged.$rNs\$(\w+|\{[^}]*\}){}environb$z\$(\w+|\{[^}]*\}){}rL)r;r<r2r3 _varprogbrecompileASCIIsearchgetattr_varprogrxspangroupr?rBrrrOr~) r5rrstartendrxrQmjrvaluerSs r6rr@s 99T?D$ t K  #8"((CI!!"j$/ d?K zz"6AH** A  4O " K!vvay1wwqz ??5 !dmmC&8":D  BJJr{{4/@$AB 8D8e#DD A DLD'  A s&AF FF)_path_normpathctj|}t|tr d}d}d}d}nd}d}d}d}||k(r|St |\}}}|j |}g}|D]A} | ||fvr | |k7s|s|r |r|d |k(r|j | /|s2|jC|}||j|z}|xs|S) z0Normalize path, eliminating double slashes, etc.r1r8rUrerrYrrr) r;r<r2r3r r appendpopr ) r5r%r\dotdotdot_initial_slashescomps new_compscomps r6rrysyy dE "CECFCECF 5=J#,T? ?D 3 Ds|#y "  7  & %0{sr8ctj|}t|sEt|trtj }ntj }t||}t|S)zReturn an absolute path.) r;r<r r2r3getcwdbgetcwdr r)r5cwds r6rrsK 99T?D ; dE "**,C))+CC D>r8F)strictcjtj|}t|dd||i\}}t|S)zlReturn the canonical path of the specified filename, eliminating any symbolic links encountered in the path.Nr)r;r< _joinrealpathr)filenamerr5oks r6r+r+s6yy"HXbq\8VR@HD" 4=r8ct|trd}d}d}nd}d}d}t|r|dd}|}|r|j|\}}}|r||k(r ||k(r&|r!t |\}}||k(rt |||}n|}Kt ||} t j| } tj| j} | s| }| |vr.|| }||rt j| nt | |dfSd|| <t|t j| ||\}} | st ||dfS||| <|r|d fS#t$r|rd} YwxYw) Nr1rUrerrrrLFT)r2r3r partitionr r r;rarfrgrhrbrreadlink) r5restrseenr%r#r$rrnewpathstis_linkrs r6rrs$ T{ABx s+ atv~  6>"4[ d6>ff5D tT" /'"B ll2::.GD  d?=D GT*E11W  r{{7';VTJbd#U* *W Y \ :; G sD99E  E darwincP|s tdtj|}t|trd}d}d}nd}d}d}||}ntj|} t |j |Dcgc]}|s| }}t |j |Dcgc]}|s| }}tt||g}|gt||z z||dz} | s|St| Scc}wcc}w#ttttf$rtjd ||wxYw) z#Return a relative version of a pathzno path specifiedrUr1rerrrNr-)rcr;r<r2r3rr rOrr rCrDrEDeprecationWarningrFrG) r5rr#r%r$x start_list path_listrQrel_lists r6r-r-s2 ,-- 99T?D$ } %  !(!5!5c!:@!:Aaa!: @ ' 3 3C 8> 81AQ 8 >  j)45 68s:q01IabMAMXA> ~|5G H$$Ye< s<C37C)?C)C3!C.)C.-3C3!C3) C332D%c  |s tdtttj|}t |dt rd d}nd d} |Dcgc]}|j }} t fd|D\}|Dcgc]}|Dcgc] }|s||k7s |c}}}}t|}t|}|} t|D]\} }||| k7s|d | } n|r n d d} | j| zScc}w#t$r tdd wxYwcc}wcc}}w#ttf$rtj d g|wxYw) zDGiven a sequence of path names, returns the longest common sub-path.z%commonpath() arg is an empty sequencerr1rUrrc3.K|] }|ddk(yw)NrL).0rIr%s r6 zcommonpath..,s5u!2A#usz%Can't mix absolute and relative pathsNr.)rctuplerAr;r<r2r3r setminmax enumerater rCrDrFrG) pathsr#r5 split_pathsr r=crkrmcommonrQprefixr%s @r6r.r.su @AA #bii' (E%(E"38954tzz#5 9 P5u55FEEPPKq1:1aa6k1:K P    bMDAqBqEzBQ" 3r7(((#: PDE4 O P;P ~ &$$\:E: slD,D+D,.DD, D&D! D! D! $D&)4D,$D,D,DD,!D&&D,,'E)N)+__doc__r#r$r)r%r&r'r(r*r;rrfrF__all__r7rr r r rrVr r rrr/rrrrrrposixrrrzrr+rrr,r-r.rr8r6rs            ': "7((00 #>V6)z   .j 0D "'<~"llh6!R#Es9B""B-,B-dZdZdZdZdZdZdZdZdZdd l Z dd l Z dd l Z dd l Z dd l gd Z d Z dd lmZmZmZdZdZdZdZdZdZdZe j<je_dZdZ e!e jDdrdZ#ndZ#dZ$ ddl%m&Z&dZ'dZ(dZ) dd l%m*Z+d"Z, dd#l%m-Z-d$Z. dd%l%m/Z/m0Z1d&Z2d'Z3d(d)d*Z4d+Z5d5d,Z6d-Z7 dd.l%m8Z9dd/l%m:Z;dd0l%mZ? dd2l%m@Z@d3ZAy #e$rdZYwxYw#e$rd Z&YvwxYw#e$rd!Z+YtwxYw#e$re,Z.YtwxYw#e$re.Z4YlwxYw#e$rYUwxYw#e$rd4ZAYy wxYw)6zCommon pathname manipulations, WindowsNT/95 version. Instead of importing this module directly, import os and refer to this module as os.path. ...\;/z.;C:\binnulN)*)(normcaseisabsjoin splitdrive splitrootsplitsplitextbasenamedirname commonprefixgetsizegetmtimegetatimegetctimeislinkexistslexistsisdirisfileismount expanduser expandvarsnormpathabspathcurdirpardirseppathsepdefpathaltsepextsepdevnullrealpathsupports_unicode_filenamesrelpathsamefile sameopenfilesamestat commonpath isjunctionc&t|tryy)N\/\/) isinstancebytespaths  _get_bothsepsr:#s$) LCMapStringExLOCALE_NAME_INVARIANTLCMAP_LOWERCASEcXtj|}|s|St|tr]t j }|j |djdd}ttt|}|j|dSttt|jddS)nNormalize case of pathname. Makes all characters lowercase and all slashes into backslashes. surrogateescaperr) osfspathr5r6sysgetfilesystemencodingdecodereplace_LCMapStringEx_LOCALE_NAME_INVARIANT_LCMAP_LOWERCASEencode)sencodings r9r r 3s IIaLH a 002H#45==c4HA5/4A88H&78 8!"8"2"#))C"68 8r;ctj|}t|trFtjtj |j ddjS|j ddjS)r@rr)rBrCr5r6fsencodefsdecoderGlower)rLs r9r r Fsb IIaL a ;;r{{1~55c4@FFHI Iyyd#))++r;ctj|}t|trd}d}d}nd}d}d}|ddj ||}|j |s|j |d ry y ) zTest whether a path is absolute\/s:\rrz:\NTF)rBrCr5r6rG startswith)rLr$r' colon_seps r9r r Wsn ! A!U   "1 fc"A ||CALLA6 r;c8tj|}t|trd}d}d}nd}d}d} |s|dd|zt |\}}}t tj|D]b}t |\} } } | r | s|s| }| }| }| r/| |k7r*| j |j k7r| }| }| }N| }|r |d|vr||z}|| z}d|r|s|r|dd||zvr||z|zS||z|zS#tttf$rtjd |g|wxYw) NrSr3:rr4:rr ) rBrCr5r6rmaprQ TypeErrorAttributeError BytesWarning genericpath_check_arg_types) r8pathsr$sepscolon result_drive result_root result_pathpp_drivep_rootp_paths r9r r ks_ 99T?D$! !HsN1:4. k;RYY&A&/l #GVV,#*L$ $ W 4==?l&8&8&::#*L"(K"(K& {2d:)C/ %.K+'.  \"#.edlB#% 3 3k)K77 ~| 4$$VT:E: sB/C,$C,,-Dc.t|\}}}|||zfS)aSplit a pathname into drive/UNC sharepoint and relative path specifiers. Returns a 2-tuple (drive_or_unc, path); either part may be empty. If you assign result = splitdrive(p) It is always true that: result[0] + result[1] == p If the path contained a drive letter, drive_or_unc will contain everything up to and including the colon. e.g. splitdrive("c:/dir") returns ("c:", "/dir") If the path contained a UNC path, the drive_or_unc will contain the host name and share up to but not including the fourth directory separator character. e.g. splitdrive("//host/computer/dir") returns ("//host/computer", "/dir") Paths cannot contain both a drive letter and a UNC path. )r)ridriveroottails r9r r s#&"! E4 $+ r;ctj|}t|tr d}d}d}d}d}n d}d}d}d }d }|j ||}|d d |k(r||d d |k(ri|d dj |k(rdnd }|j ||}|dk(r|||fS|j ||d z} | dk(r|||fS|d | || | d z|| d zd fS||d d |d d fS|d d |k(r!|d d|k(r|d d |d d|dd fS|d d ||d d fS|||fS)aSplit a pathname into drive, root and tail. The drive is defined exactly as in splitdrive(). On Windows, the root may be a single path separator or an empty string. The tail contains anything after the root. For example: splitroot('//server/share/') == ('//server/share', '/', '') splitroot('C:/Users/Barney') == ('C:', '/', 'Users/Barney') splitroot('C:///spam///ham') == ('C:', '/', '//spam///ham') splitroot('Windows/notepad') == ('', '', 'Windows/notepad') rSrTrZ\\?\UNC\r;rrr[\\?\UNC\NrVr\rU)rBrCr5r6rGupperfind) rir$r're unc_prefixemptynormpstartindexindex2s r9rrs ! A!U$ #  IIfc "E RayC 1: r*j8AaEJJsE*E{%&ZZUQY/F|%&Wf:q 3Qvz{^C C!BQ%12& & qu  1: Ra5!Aa&!AB%' 'Ra5%12& &eQr;ctj|}t|}t|\}}}t |}|r||dz |vr|dz}|r ||dz |vr|d|||d}}||z|j |z|fS)z~Split a pathname. Return tuple (head, tail) where tail is everything after the final slash. Either part may be empty.rVN)rBrCr:rlenrstrip)rirddriheadrps r9rrs ! A  DlGAq! AA !A#d" Q !A#d"2A!"$D q54;;t$ $d **r;ctj|}t|trt j |dddSt j |dddS)NrSrT.rrr)rBrCr5r6ra _splitextris r9rrsG ! A!U$$QtT::$$Qc377r;ct|dS)z)Returns the final component of a pathnamerVrrs r9rr  8A;r;ct|dS)z-Returns the directory component of a pathnamerrrs r9rrrr;st_reparse_tagc tj|}t |j tjk(S#tttf$rYywxYwz!Test whether a path is a junctionF) rBlstatOSError ValueErrorr_boolrstatIO_REPARSE_TAG_MOUNT_POINTr8sts r9r1r1sM $BB%%)H)HHII^4  s=AAc.tj|yr)rBrCr7s r9r1r1#s $r;cZ tj|}y#ttf$rYywxYw)zCTest whether a path exists. Returns True for broken symbolic linksFT)rBrrrrs r9rr+s2 XXd^  Z s **)_getvolumepathnamec>tj|}t|}t|}t |\}}}|r |d|vr| S|r|syt rL|j |}t |j |}|j|jk(Sy)zaTest whether a path is a mount point (a drive root, the root of a share, or a mounted volume)rTF)rBrCr:r!rrrcasefold)r8rdrnrorestxys r9rrAs 99T?D  D 4=D!$E4 qT!x D KK  d # * *4 0zz|qzz|++r;c8tj|}t|trd}nd}|j |s|Sdt |}}||kr+||t |vr|dz }||kr||t |vrdtjvrtjd}nEdtjvr|S tjd}t|tjd}|dk7rs|d|}t|trtj|}tjjd}||k7r%|t|k7r|Stt||}t|trtj|}|||d zS#t$rd}YwxYw) zLExpand ~ and ~user constructs. If user or $HOME is unknown, do nothing.~~rV USERPROFILEHOMEPATH HOMEDRIVErtUSERNAMEN)rBrCr5r6rWrr:environKeyErrorr rPgetrrrO)r8tildernuserhomern target_user current_users r9rr^s{ 99T?D$ ??5 ! c$iqA a%DG=#66 Q a%DG=#66 "::m, 2:: %  JJ{+Erzz*56Av1Qi k5 )++k2Kzz~~j1 , & x11 GH-{;H$;;x( d12h / E s6F FFctj|}t|trPd|vrd|vr|Sddl}t|j |j zdzd}d}d}d}d }d}ttd d}nDd |vrd |vr|Sddl}|j |j zdz}d }d }d}d}d }tj}|dd} d} t|} | | kr|| | dz} | |k(r5|| dzd}t|} |j| } | | |d| dzzz } n| |k(r|| dz| dz|k(r | | z } | dz } n|| dzd}t|} |j|} |d| } |:tjtjtj| }n|| }| |z } n%| |k(r|| dz| dz|k(r | | z } | dz } n|| dz| dz|k(rr|| dzd}t|} |j|} |d| } |:tjtjtj| }n|| }| |z } n|dd} | dz } || | dz} | r| |vr| | z } | dz } || | dz} | r| |vr |:tjtjtj| }n|| }| |z } | r | dz} n| | z } | dz } | | kr| S#t$r| | |zz } | dz } Y&wxYw#t$r || z|z}YjwxYw#t$r| ||zz } | dz } YZwxYw#t$r||z| z|z}YwxYw#t$r| ||z|zz } | dz } YwxYw#t$r|| z}YwxYw)zfExpand shell variables of the forms $var, ${var} and %var%. Unknown variables are left unchanged.$%rNz_-ascii'{}environb$%'{}rVru)rBrCr5r6string ascii_lettersdigitsgetattrrrr}rrOrPr)r8rvarcharsquotepercentbracerbracedollarrresr}pathlencvarvalues r9rrsH 99T?D$ t D 0K-- =DgN"j$/ d?s$K''&--7$>** r(C E$iG '/ uQw  : #D$iG $ 1 q4 +++'\EAIeai(G3q E!GH~d)! JJw/E v,C8"?$&KK 2;;s;K0L$ME$+CLE5LC &[EAIeai(F2q eai *e3E!GH~d)! JJv.E v,C>"?$&KK 2;;s;K0L$ME$+CLE5LC2Ah uqy)AM1HCQJEU519-AAM) " BJJr{{37G,H I ' u QJE 1HC  W '/X JI $q4x!  $,$8 '#  78"(7T>)C#aKE(@$> & 4v =>"(6E>D00C#aKE(4 )"SLE)so3KL AK5(M?AL)8AM"K21K25L  L  L&%L&)M?MMM"M32M3)_path_normpathc tj|}t|tr d}d}d}d}nd}d}d}d}|j ||}t |\}}}||z}|j |}d } | t|kr_|| r|| |k(r|| =n?|| |k(r2| d kDr|| d z |k7r|| d z | d z=| d z} n| d k(r|r|| =n | d z } n| d z } | t|kr_|s|s|j|||j|zS) z0Normalize path, eliminating double slashes, etc.rSrTr..rrrrrrV) rBrCr5r6rGrrrappendr ) r8r$r'r"r#rnroprefixcompsrs r9r r s3yy dE "CFFFCFFF||FC(%dOtT 3 #e*n8uQx61!HqV#q5U1Q3Z61ac!A#gFA!VaFAQ#e*ne LL ''r;ctj|}t|sEt|trtj }ntj }t||}t|S)zReturn the absolute version of a path as a fallback function in case `nt._getfullpathname` is not available or raises OSError. See bpo-31047 for more. ) rBrCr r5r6getcwdbgetcwdr r )r8cwds r9_abspath_fallbackr4sM 99T?D ; dE "**,C))+CC D>r;)_getfullpathnamecl tt|S#ttf$rt |cYSwxYw)z&Return the absolute version of a path.)rr rrrr7s r9r!r!Ls5 +#HTN3 3$ +$T* * +s 33)_getfinalpathnamereadlinkcxd}t}t||vro|jt| |}t|}t |s.t |s|} |St tt||}t||vro|S#t$r}|j|vrYd}~|Sd}~wt$rY|SwxYw)N) rVrurU 2CWi&i(i)) setr add _nt_readlinkr rr r rrwinerrorr)r8allowed_winerrorseenold_pathexs r9_readlink_deeprYsLutnD( HHXd^ $ #D)T{"(+' $D):D$ABDtnD(,  ;;"22     s)%B B B9B)(B)) B98B9cfd}|dd}|r t|}|r t||S|S|S#t$r{}|j|vr t |}||k7r|r t||n|cYd}~Sn#t$rYnwxYwt |\}}|r |s ||zcYd}~S|r t||n|}Yd}~nd}~wwxYw|r)N)rVrurUrrrr5Arr{iir)rr rrrr)r8rrprnew_pathnames r9_getfinalpathname_nonstrictrs$XBQx :(.+/tD$'9T9* ) :;;&66  .d3H4'7;tHd3I(#4[ d$;&+/tD$'T' : sN(( B,B'A' B,&B'' A30B'2A33B' B,B''B,F)strictct|}t|trId}d}d}tj}t |t tj tk(r7yd}d}d}tj}t |t tk(ry|j|}|st|s t||} t|}d }|sU|j|rD|j|r||t%|dz} n|t%|d} t| |k(r| }|S|S#t$r,}|rtt|dt|}Yd}~d}~wt$r$}|r|j }t#|}Yd}~d}~wwxYw#t$r }Yd}~|Sd}~wt$r}|j k(r| }Yd}~|Sd}~wwxYw) Ns\\?\rrs\\s\\.\NULz\\?\rsz\\z\\.\NULr)r r5r6rBrr rOr)rrWr r rrrstrrrr) r8rrrynew_unc_prefixr had_prefixinitial_winerrorrspaths r9r*r*s~ dE "F(J$N**,C~"++g*>!??$F'J#N))+C~'!22#__V, %+T?D 5$T*D "doof5z*&c*o.>)??S[\* !$U+t3 D t I " c"g&D0D>D 5!{{ .t4D  5&    !;;"22 D  !sB D,F, F 5"E F (FF  G G*GGTcLtj|}t|trd}d}d}nd}d}d}||}|s t dtj|} t t |}t t |}t|\}}} t|\} }} t|t| k7rt d | d || j|D cgc]} | s|  } } | j|D cgc]} | s|  }} d }t| |D]#\}}t|t|k7rn|d z }%|gt| |z z||dz}|s|St|Scc} wcc} w#ttttt f$rt#j$d ||wxYw)z#Return a relative version of a pathrSrrrrrNzno path specifiedzpath is on mount z, start on mount rrVr,)rBrCr5r6rr!r rr rziprr r^r_r`DeprecationWarningrarb)r8r|r$r"r# start_abspath_abs start_drive_ start_rest path_drive path_restr start_list path_listre1e2rel_lists r9r,r,s 99T?D$ } ,-- IIe EHUO, 8D>*%.y%9" Q #,X#6 Ay K HZ$8 8K)* *",!1!1#!6BE,E"#E"'E,<E'E'AE,E," E,,7F#c `|s tdtttj|}t |dt rd}d}d}nd}d}d} |Dcgc]+}t|j||j-}}|Dcgc]\}}}|j|}}}}t|Dchc]\}}}| c}}}d k7r td t|Dchc]\}}}| c}}}d k7r td t|dj||\} } } | j|} | D cgc] } | s| |k7s | } } |D cgc]}|D cgc] } | s| |k7s | c} }}} t|}t|}t|D]\}} | ||k7s| d |} n| d t|} | | z|j| zScc}wcc}}}wcc}}}wcc}}}wcc} wcc} wcc} }w#t t"f$rt%j&d g|wxYw)zDGiven a sequence of path names, returns the longest common sub-path.z%commonpath() arg is an empty sequencerrSrTrrrrrVz%Can't mix absolute and relative pathszPaths don't have the same driveNr0)rtupler]rBrCr5r6rrGrQrrminmax enumerater r^r_rarb)rcr$r'r"ri drivesplitsrr split_pathsrnror8commonrrLs1s2rs r9r0r0.s- @AA #bii' (E%(E"JOP%Qy63!7!=!=!?@% P3>?;1aqwws|; ? -gaA- .! 3DE E -gaA- .! 3>? ?%eAh&6&6vs&CDtTC#9VqQ&[!V9DOPKq1:1aa6k1:K P    bMDAqBqEz" HSW%Ft|chhv...5Q?- . ::P ~ &$$\:E: sH0GHG!*H9 G( "H( G/ 5AHG6 G6G6H H%G; -G; 3G; 7H<2H/,HH;HH'H-) _path_isdir) _path_isfile) _path_islink) _path_exists)_path_isdevdrivecJ tt|S#t$rYywxYwz@Determines whether the specified path is on a Windows Dev Drive.F)rr!rr7s r9 isdevdriverts( #GDM2 2  s  ""cyrr7s r9rrosr;)N)B__doc__r"r#r(r$r%r'r&r)rBrDrra__all__r:_winapir<rHr=rIr>rJr ImportErrorr r r rrrrrrhasattr stat_resultr1rntrrrrrr rrr!rrrrrr*r+r,r0rrrrrrrrrrrr;r9r$s          O!,-- 8H(+b.1r +*8 ((00  2>>+,J$%:-zj`&(-P" +# +]> (T/b"'<@"+p.b  ())) #_ ,, ,t^#("(#(t G Hd  s} C3DD(D2D)D6)E3C>=C>D  D DDD&%D&)D32D36D>=D>E  E tdZddlZddlZgdZdZdZdZdZdZd Z d Z d Z d Z d Z dZdZdZdZy)z Path operations common to more than one OS Do not use directly. The OS specific modules import the appropriate functions from this module themselves. N) commonprefixexistsgetatimegetctimegetmtimegetsizeisdirisfileislinksamefile sameopenfilesamestatcZ tj|y#ttf$rYywxYw)zDTest whether a path exists. Returns False for broken symbolic linksFT)osstatOSError ValueError)paths rrs0    Z s **c tj|}tj|j S#ttf$rYywxYw)z%Test whether a path is a regular fileF)rrrrS_ISREGst_modersts rr r sB WWT] << ## Z 6AAc tj|}tj|j S#ttf$rYywxYw)zrbs`   $$$% & & & $$. Tr'RdZddlZGddeZGddeZGddeZy) z= The objects used by the site module to add custom builtins. Nc eZdZdZdZddZy)Quitterc ||_||_yNnameeof)selfrr s __init__zQuitter.__init__s c<d|jd|jdS)NzUse z() or z to exitrr s r __repr__zQuitter.__repr__s+/99dhh??r Ncx tjjt|#Yt|xYwr)sysstdinclose SystemExit)r codes r __call__zQuitter.__call__s7  IIOO   s+9r)__name__ __module__ __qualname__r rrr r rr s@r rc.eZdZdZdZddZdZdZdZy) _Printerzninteractive prompt objects for printing the license text, a list of contributors and the copyright notice.c ddl}||_||_d|_|Dcgc]%}|D]}|jj || 'c}}|_ycc}}wNr)os_Printer__name_Printer__data_Printer__linespathjoin_Printer__filenames)r rdatafilesdirsr!dirfilenames r r z_Printer.__init__#s[   '+3'+,1GGLLh7,18'+33s*AcF|jryd}|jD]*} t|d5}|j}dddn|s |j }|j d|_t|j|_y#1swYKxYw#t$rYwxYw)Nzutf-8)encoding ) r$r'openreadOSErrorr#splitlen_Printer__linecnt)r r(r,fps r __setupz_Printer.__setup,s << ((H (W5779D6 );;Dzz$' T\\*65  s' BBBB B B B c|jt|j|jkrdj |jSd|j fdzzS)Nr/z!Type %s() to see the full %s text)_Printer__setupr4r$MAXLINESr&r"rs r rz_Printer.__repr__<sI  t||  -99T\\* *64;;.:JK Kr c|jd}d} t|||jzD]}t|j| ||jz }d}|t |}|dvrd}||dk(ryf#t $rYywxYw)Nz0Hit Return for more, or q (and Return) to quit: r)qr>)r:ranger;printr$input IndexError)r promptlinenoikeys r rz_Printer.__call__Cs C vv '=>A$,,q/*? $--'k-C)+"k#:  s6A<< BBN)rr) rrr__doc__r;r r:rrrr r rrs#.H3+ Lr rceZdZdZdZdZy)_Helpera3Define the builtin 'help'. This is a wrapper around pydoc.help that provides a helpful message when 'help' is typed at the Python interactive prompt. Calling help() at the Python prompt starts an interactive help session. Calling help(thing) prints help for the python object 'thing'. cy)NzHType help() for interactive help, or help(object) for help about object.rrs r rz_Helper.__repr__bs8r c.ddl}|j|i|Sr )pydochelp)r argskwdsrLs r rz_Helper.__call__esuzz4(4((r N)rrrrGrrrr r rIrIXs8)r rI)rGrobjectrrrIrr r rQs4  f  8v8v)f)r Z dZddlmZmZddlZeeeZedZ dZ ee Z [ gdZ dZ eedZeeeZeeij%Zeeij)Zeeij-ZeegZeeegZeeedZeeed d zZeeeZeed Z eed Z!eee"Z#eij%Z$eij)Z%eij-Z&eejNZ(ed Z)dZ*e*Z*ee*Z+e*jY[*dZ-e-Z-ee-Z.[-dZ/GddeZ0GddeZ1Gdde1Z2e2jge+GddeZ4Gdde4Z5Gdde5Z6e6jge.GddeZ7Gd d!e7Z8e8jgee8jgee8jgee8jgee8jgee8jgee8jgee8jgee8jgee8jgee8jge e8jge!e8jge#Gd"d#e7Z9Gd$d%e8Z:e:jge)Gd&d'eZ;Gd(d)eZ<Gd*d+e;e7e<Z=Gd,d-eZ>Gd.d/eZ?d0Z@d1ZAGd2d3eZBGd4d5e=ZCeCjgeDGd6d7eCZEeEjgeGd8d9e=ZFeFjge(Gd:d;e;ZGGd<d=eGeCZHeHjge$Gd>d?eGeCZIeIjge&Gd@dAeGe=ZJeJjge%GdBdCeFZKeKjgeLGdDdEe9e=ZMeMjgeNeMjgeOeMjgeeMjgePGdFdGeZQGdHdIeMeQZReRjgeSeRjgeGdJdKeMZTeTjgeeTjgey)LzjAbstract Base Classes (ABCs) for collections, according to PEP 3119. Unit tests are in test_collections. )ABCMetaabstractmethodN.cyNr_fr (s$r) Awaitable Coroutine AsyncIterable AsyncIteratorAsyncGeneratorHashableIterableIterator Generator ReversibleSized ContainerCallable CollectionSet MutableSetMappingMutableMapping MappingViewKeysView ItemsView ValuesViewSequenceMutableSequence ByteStringBufferzcollections.abcrirc#KdSrrrrr r(Xs5rc Kywrrrrr _coror*Zs4cKdywrrrrr _agr-`s c|j}|D]9}|D]+}||jvs|j| tccS2tcSy)NT)__mro____dict__NotImplemented)CmethodsmromethodBs r _check_methodsr8hsP ))CA#::f%-))  " ! rc0eZdZdZedZedZy)rrcyNrrselfs r __hash__zHashable.__hash__xrc6|tur t|dStS)Nr>)rr8r2clsr3s r __subclasshook__zHashable.__subclasshook__| (?!!Z0 0rN)__name__ __module__ __qualname__ __slots__rr> classmethodrCrrr rrt-Irr) metaclassc@eZdZdZedZedZeeZ y)r rc#Kdywrrr<s r __await__zAwaitable.__await__s  sc6|tur t|dStS)NrN)r r8r2rAs r rCzAwaitable.__subclasshook__s ) !![1 1rN) rErFrGrHrrNrIrC GenericAlias__class_getitem__rrr r r s:I $L1rr cHeZdZdZedZeddZdZedZ y)r rct)zcSend a value into the coroutine. Return next yielded value or raise StopIteration.  StopIterationr=values r sendzCoroutine.send rNcF| |||}||j|}|)zgRaise an exception in the coroutine. Return next yielded value or raise StopIteration. with_tracebackr=typvaltbs r throwzCoroutine.throw4 ;z %C >$$R(C rcn |jttd#ttf$rYywxYw).Raise GeneratorExit inside coroutine. zcoroutine ignored GeneratorExitNra GeneratorExit RuntimeErrorrUr<s r closezCoroutine.close; B JJ} %@A A}-    "44c<|turt|ddddStS)NrNrXrarh)r r8r2rAs r rCzCoroutine.__subclasshook__s# ) !![&'7K KrNN) rErFrGrHrrXrarhrIrCrrr r r sGI   Brr c@eZdZdZedZedZeeZ y)r rctSr)rr<s r __aiter__zAsyncIterable.__aiter__s rc6|tur t|dStS)Nro)r r8r2rAs r rCzAsyncIterable.__subclasshook__s - !![1 1rN) rErFrGrHrrorIrCrPrQrrr r r s:I $L1rr c6eZdZdZedZdZedZy)rrcKtw)z@Return the next item or raise StopAsyncIteration when exhausted.StopAsyncIterationr<s r __anext__zAsyncIterator.__anext__s! r.c|Srrr<s r rozAsyncIterator.__aiter__ rc8|tur t|ddStS)Nruro)rr8r2rAs r rCzAsyncIterator.__subclasshook__s - !![+> >rN) rErFrGrHrrurorIrCrrr rrs2I!!rrcNeZdZdZdZedZeddZdZe dZ y) rrc@K|jdd{S7w)zpReturn the next item from the asynchronous generator. When exhausted, raise StopAsyncIteration. N)asendr<s r ruzAsyncGenerator.__anext__sZZ%%%%s cKtw)zuSend a value into the asynchronous generator. Return next yielded value or raise StopAsyncIteration. rsrVs r r{zAsyncGenerator.asends ! r.NcNK| |||}||j|}|w)zyRaise an exception in the asynchronous generator. Return next yielded value or raise StopAsyncIteration. r[r]s r athrowzAsyncGenerator.athrows8 ;z %C >$$R(C s#%cK |jtd{td7#ttf$rYywxYww)rdNz,asynchronous generator ignored GeneratorExit)r~rfrgrtr<s r aclosezAsyncGenerator.aclosesH O++m, , ,MN N -12   s/A.,. A.AAAAc>|turt|dddddStS)Nrorur{r~r)rr8r2rAs r rCzAsyncGenerator.__subclasshook__ s* . !![+")8X? ?rrl) rErFrGrHrurr{r~rrIrCrrr rrsNI& !!   Orrc@eZdZdZedZedZeeZ y)rrc# Kywrrr<s r __iter__zIterable.__iter__ r+c6|tur t|dStS)Nr)rr8r2rAs r rCzIterable.__subclasshook__ rDrN) rErFrGrHrrrIrCrPrQrrr rrs:I $L1rrc6eZdZdZedZdZedZy)rrct)zKReturn the next item from the iterator. When exhausted, raise StopIterationrTr<s r __next__zIterator.__next__-s rc|Srrr<s r rzIterator.__iter__2rwrc8|tur t|ddStS)Nrr)rr8r2rAs r rCzIterator.__subclasshook__5s (?!!Z< <rN) rErFrGrHrrrrIrCrrr rr)s2Irrc0eZdZdZedZedZy)rrc# Kywrrr<s r __reversed__zReversible.__reversed__Prr+c8|tur t|ddStS)Nrr)rr8r2rAs r rCzReversible.__subclasshook__Us * !!^Z@ @rN)rErFrGrHrrrIrCrrr rrLs-IrrcNeZdZdZdZedZeddZdZe dZ y) rrc$|jdS)z^Return the next item from the generator. When exhausted, raise StopIteration. N)rXr<s r rzGenerator.__next__`syyrct)zcSend a value into the generator. Return next yielded value or raise StopIteration. rTrVs r rXzGenerator.sendfrYrNcF| |||}||j|}|)zgRaise an exception in the generator. Return next yielded value or raise StopIteration. r[r]s r razGenerator.throwmrbrcn |jttd#ttf$rYywxYw)z.Raise GeneratorExit inside generator. zgenerator ignored GeneratorExitNrer<s r rhzGenerator.closezrirjc>|turt|dddddStS)NrrrXrarh)rr8r2rAs r rCzGenerator.__subclasshook__s* ) !!Z"('7< <rrl) rErFrGrHrrrXrarhrIrCrrr rr\sNI    Brrc0eZdZdZedZedZy)rrcyr;rr<s r __len__z Sized.__len__r?rc6|tur t|dStS)Nr)rr8r2rAs r rCzSized.__subclasshook__s %<!!Y/ /rN)rErFrGrHrrrIrCrrr rrrJrrc@eZdZdZedZedZeeZ y)rrcyNFr)r=xs r __contains__zContainer.__contains__rc6|tur t|dStS)Nr)rr8r2rAs r rCzContainer.__subclasshook__s ) !!^4 4rN) rErFrGrHrrrIrCrPrQrrr rrs:I $L1rrc eZdZdZedZy)rrc:|turt|dddStS)Nrrr)rr8r2rAs r rCzCollection.__subclasshook__s! * !!i^L LrN)rErFrGrHrIrCrrr rrsIrrc:eZdZdZededefdZedZ y)r$rflagsreturnctrNotImplementedError)r=rs r __buffer__zBuffer.__buffer__s!!rc6|tur t|dStS)Nr)r$r8r2rAs r rCzBuffer.__subclasshook__s &=!!\2 2rN) rErFrGrHrint memoryviewrrIrCrrr r$r$s;I"":""rr$c@eZdZdZdZfdZfdZdZfdZxZ S)_CallableGenericAliasz Represent `Callable[argtypes, resulttype]`. This sets ``__args__`` to a tuple containing the flattened ``argtypes`` followed by ``resulttype``. Example: ``Callable[[int, str], float]`` sets ``__args__`` to ``(int, str, float)``. rct|trt|dk(s td|\}}t|ttfrg||}nt |std|t ||||S)Nz6Callable must be used as Callable[[arg, ...], result].zFExpected a list of types, an ellipsis, ParamSpec, or Concatenate. Got ) isinstancetuplelen TypeErrorlist_is_param_exprsuper__new__)rBoriginargst_argst_result __class__s r rz_CallableGenericAlias.__new__s4'CINHJ J fudm ,&V&X&D'>>DXGH HwsFD11rc .t|jdk(r&t|jdrt|Sddj |jddDcgc] }t |c}dt |jddScc}w)Nrrzcollections.abc.Callable[[z, z], ])r__args__rr__repr__join _type_repr)r=ars r rz_CallableGenericAlias.__repr__s t}}  "~dmmA6F'G7#% %YYt}}Sb7IJ7I! 1 7IJKLCdmmB/014 5JsB c|j}t|dk(rt|dst|dd|df}tt |ffS)Nrrr)rrrrrr)r=rs r __reduce__z _CallableGenericAlias.__reduce__sI}}D Q>$q'#:Sb ?DH,D$x&666rct|ts|f}t| |j}t|dtt fs|d}|dd}||f}t tt|S)Nrr)rrr __getitem__rrrr)r=itemnew_argsrrrs r rz!_CallableGenericAlias.__getitem__sn $&7D7&t,55(1+t}5|Hcr]F)H$XuX??r) rErFrG__doc__rHrrrr __classcell__rs@r rrs*I 257 @@rrcturyttrytd}jdk(xrt fd|DS)z|Checks if obj matches either a list of types, ``...``, ``ParamSpec`` or ``_ConcatenateGenericAlias`` from typing.py T) ParamSpec_ConcatenateGenericAliastypingc3<K|]}j|k(ywr)rE).0nameobjs r z!_is_param_expr.. s-Uutclld.Bus)EllipsisrrtyperFany)rnamess` r rrsI h#t s)C 5E >>X % U#-Uu-U*UUrct|tr6|jdk(r |jS|jd|jS|turyt|t r |j St|S)zReturn the repr() of an object, special-casing types (internal helper). Copied from :mod:`typing` since collections.abc shouldn't depend on that module. (Keep this roughly in sync with the typing version.) builtins.z...)rrrFrGr FunctionTyperErepr)rs r rr sk#t >>Z '## #..!3#3#3"455 h#|$|| 9rc@eZdZdZedZedZeeZ y)rrcyrr)r=rkwdss r __call__zCallable.__call__!rrc6|tur t|dStS)Nr)rr8r2rAs r rCzCallable.__subclasshook__%rDrN) rErFrGrHrrrIrCrrQrrr rrs;I $$9:rrcxeZdZdZdZdZdZdZdZdZ e dZ d Z e Z d Zd ZeZd Zd ZdZeZdZy)raZA set is a finite, iterable container. This class provides concrete generic implementations of all methods except for __contains__, __iter__ and __len__. To override the comparisons (presumably for speed, as the semantics are fixed), redefine __le__ and __ge__, then the other operations will automatically follow suit. rczt|tstSt|t|kDry|D]}||vsyyNFTrrr2rr=otherelems r __le__z Set.__le__>s?%%! ! t9s5z !D5 rct|tstSt|t|kxr|j |Srrrr2rrr=rs r __lt__z Set.__lt__H3%%! !4y3u:%<$++e*<.ms"MeUu}5es rrr2rrs` r __and__z Set.__and__js*%*! !"""Me"MMMrc|D]}||vsyy)z1Return True if two sets have a null intersection.FTr)r=rrWs r isdisjointzSet.isdisjointqsE}rcft|tstSd||fD}|j|S)Nc3.K|] }|D]}|ywrr)rses r rzSet.__or__..{s5Mq1a1Msr)r=rchains r __or__z Set.__or__xs1%*! !5T5M5""5))rctts'ttstS|j |j fd|DS)Nc3*K|] }|vr| ywrr)rrWrs r rzSet.__sub__..s#:dU&+5&8$)drrrr2rrs `r __sub__z Set.__sub__sL%%eX.%%''.E""#:d#:: :rct|ts't|tstSj |}j fd|DS)Nc3*K|] }|vr| ywrrrs r rzSet.__rsub__..s#9eU&+4&7$)er r rs` r __rsub__z Set.__rsub__sL%%eX.%%''.E""#9e#99 9rct|ts't|tstS|j |}||z ||z zSrr rs r __xor__z Set.__xor__s?%%eX.%%''.Eu ..rctj}d|zdz}t|}d|dzz}||z}|D]#}t|}|||dzz dz dzz}||z}%||dz |dz z z}|d zd z}||z}||kDr||dzz}|d k(rd }|S) a+Compute the hash value of a set. Note that we don't define __hash__: not all sets are hashable. But if you define a hashable set type, its __hash__ should call this function. This must be compatible __eq__. All sets ought to compare equal if they contain the same elements, regardless of how they are implemented, and regardless of the order of the elements; so there's not much freedom for __eq__ or __hash__. We match the algorithm used by the built-in frozenset type. rr%iMriM[l4~2 i i6ri8#)sysmaxsizerhash)r=MAXMASKnhrhxs r _hashz Set._hashskk3w{ I !a%  T AaB "b/H,; ;A IA a2g!r' "" I ! T  s7 MA 7ArN)rErFrGrrHrrrrrrIrr__rand__rr __ror__rrr__rxor__r rrr rr1stI= = > N H* G:9/Hrrc^eZdZdZdZedZedZdZdZ dZ dZ d Z d Z d Zy ) raA mutable set is a finite, iterable container. This class provides concrete generic implementations of all methods except for __contains__, __iter__, __len__, add(), and discard(). To override the comparisons (presumably for speed, as the semantics are fixed), all you have to do is redefine __le__ and then the other operations will automatically follow suit. rct)zAdd an element.rrVs r addzMutableSet.add "!rct)z8Remove an element. Do not raise an exception if absent.rrVs r discardzMutableSet.discardr'rcD||vr t||j|y)z5Remove an element. If not a member, raise a KeyError.N)KeyErrorr)rVs r removezMutableSet.removes  5/ ! Urc~t|} t|}|j ||S#t$rtdwxYw)z2Return the popped value. Raise KeyError if empty.N)iternextrUr+r)r=rrWs r popzMutableSet.popsE $Z %HE U  % $ %s +<cF |j#t$rYywxYw)z6This is slow (creates N new iterators!) but effective.N)r1r+r<s r clearzMutableSet.clears*        c6|D]}|j||Sr)r&r0s r __ior__zMutableSet.__ior__sE HHUO rc<||z D]}|j||Sr)r)r0s r __iand__zMutableSet.__iand__s!RiE LL   rc||ur|j|St|ts|j|}|D])}||vr|j ||j |+|Sr)r3rrrr)r&r0s r __ixor__zMutableSet.__ixor__sd : JJL b#&((,D=LL'HHUO   rcb||ur|j|S|D]}|j||Sr)r3r)r0s r __isub__zMutableSet.__isub__s6 : JJL  U# rN)rErFrGrrHrr&r)r,r1r3r6r8r:r<rrr rrsW I""""   rrcReZdZdZdZdZedZd dZdZ dZ d Z d Z d Z dZy) rzA Mapping is a generic container for associating key/value pairs. This class provides concrete generic implementations of all methods except for __getitem__, __iter__, and __len__. r@ctrr+r=keys r rzMapping.__getitem__ rNc0 ||S#t$r|cYSwxYw)z D[k] if k in D, else d. d defaults to None.r@r=rBdefaults r getz Mapping.get$s% 9  N s  c. ||y#t$rYywxYwNTFr@rAs r rzMapping.__contains__+s'  I  s  ct|S)z:D.keys() -> a set-like object providing a view on D's keys)rr<s r keysz Mapping.keys3s ~rct|S)z a set-like object providing a view on D's items)rr<s r itemsz Mapping.items7s rct|S)z6D.values() -> an object providing a view on D's values)r r<s r valueszMapping.values;s $rct|tstSt|j t|j k(Sr)rrr2dictrMrs r rzMapping.__eq__?s3%)! !DJJL!T%++-%888rr)rErFrGrrH__abc_tpflags__rrrGrrKrMrOrrrrr rrsLIO 9 Lrrc2eZdZdZdZdZdZeeZ y)r_mappingc||_yrrT)r=mappings r __init__zMappingView.__init__Ms  rc,t|jSr)rrUr<s r rzMappingView.__len__Ps4==!!rc$dj|S)Nz&{0.__class__.__name__}({0._mapping!r}))formatr<s r rzMappingView.__repr__Ss7>>tDDrN) rErFrGrHrXrrrIrPrQrrr rrIs$I "E$L1rrc,eZdZdZedZdZdZy)rrct|Srsetrs r rzKeysView._from_iterable] 2wrc||jvSrrTrAs r rzKeysView.__contains__asdmm##rc#8K|jEd{y7wrrTr<s r rzKeysView.__iter__ds==  s NrErFrGrHrIrrrrrr rrYs#I$!rrc,eZdZdZedZdZdZy)rrct|Srr^rs r rzItemsView._from_iterableor`rc`|\}} |j|}||uxs||k(S#t$rYywxYwr)rUr+)r=rrBrWvs r rzItemsView.__contains__ssG U , c"A:+e +  s ! --c#TK|jD]}||j|fywrrTrAs r rzItemsView.__iter__|s(==C c*+ +!s&(Nrcrrr rrks#I,,rrceZdZdZdZdZy)r rcZ|jD]}|j|}||us||k(syyrIrT)r=rWrBrgs r rzValuesView.__contains__s3==C c"AEzQ%Z!rc#PK|jD]}|j|ywrrTrAs r rzValuesView.__iter__s#==C--$ $!s$&N)rErFrGrHrrrrr r r sI%rr cheZdZdZdZedZedZeZ e fdZ dZ dZ d dZ d d Zy ) rzA MutableMapping is a generic container for associating key/value pairs. This class provides concrete generic implementations of all methods except for __getitem__, __setitem__, __delitem__, __iter__, and __len__. rctrr@r=rBrWs r __setitem__zMutableMapping.__setitem__rCrctrr@rAs r __delitem__zMutableMapping.__delitem__rCrcX ||}||=|S#t$r||jur|cYSwxYw)zD.pop(k[,d]) -> v, remove specified key and return the corresponding value. If key is not found, d is returned if given, otherwise KeyError is raised. )r+_MutableMapping__marker)r=rBrFrWs r r1zMutableMapping.popsC IE S L  $--'N s  ))cl tt|}||}||=||fS#t$rtdwxYw)zD.popitem() -> (k, v), remove and return some (key, value) pair as a 2-tuple; but raise KeyError if D is empty. N)r/r.rUr+rns r popitemzMutableMapping.popitemsJ %tDz"CS  IEz  % $ %s"3cF |j#t$rYywxYw)z,D.clear() -> None. Remove all items from D.N)rur+r<s r r3zMutableMapping.clears*     r4c t|tr|D] }||||< n9t|dr|jD] }||||< n|D] \}}|||< |j D] \}}|||< y)aK D.update([E, ]**F) -> None. Update D from mapping/iterable E and F. If E present and has a .keys() method, does: for k in E: D[k] = E[k] If E present and lacks .keys() method, does: for (k, v) in E: D[k] = v In either case, this is followed by: for k, v in F.items(): D[k] = v rKN)rrhasattrrKrM)r=rrrBrWs r updatezMutableMapping.updates eW %!#JS  UF #zz|!#JS $$ U!S $**,JCDI'rNc8 ||S#t$r |||<Y|SwxYw)z@D.setdefault(k[,d]) -> D.get(k,d), also set D[k]=d if k not in Dr@rEs r setdefaultzMutableMapping.setdefaults. 9  DI s )rr)rErFrGrrHrrorqobjectrsr1rur3ryr{rrr rrsYIxH'  $rrcHeZdZdZdZdZedZdZdZ dZ d d Z d Z y) r!zAll the operations on a read-only sequence. Concrete subclasses must override __new__ or __init__, __getitem__, and __len__. r ctr IndexErrorr=indexs r rzSequence.__getitem__rc#NKd} ||}||dz }#t$rYywxYww)Nrr%r)r=irgs r rzSequence.__iter__sB  GQ   s% "%"%c(|D] }||us||k(s yyrIr)r=rWrgs r rzSequence.__contains__s!AEzQ%Zrc#^Kttt|D] }|| ywr)reversedranger)r=rs r rzSequence.__reversed__s'%D *+Aq'M,s+-Nc||dkrtt||zd}||dkr|t|z }|}|||kr ||}||us||k(r|S|dz }|||krt#t$rYtwxYw)zS.index(value, [start, [stop]]) -> integer -- return first index of value. Raises ValueError if the value is not present. Supporting start and stop arguments is optional, but recommended. rr%)maxrr ValueError)r=rWstartstoprrgs r rzSequence.indexs  D E)1-E  q CI D la$h GEzQ%Z FAla$h    sA## A43A4c,tfd|DS)zBS.count(value) -> integer -- return number of occurrences of valuec36K|]}|us|k(s dyw)r%Nr)rrgrWs r rz!Sequence.count..+s?da5jAJ1ds)sumrVs `r countzSequence.count)s?d???r)rN) rErFrGrrHrRrrrrrrrrrr r!r!sA IO .@rr!c(eZdZfdZfdZxZS)_DeprecateByteStringMetac b|dk7rddl}|jddt| ||||fi|S)Nr#rcollections.abc.ByteStringr,)warnings _deprecatedrr)rBrbases namespacekwargsrrs r rz _DeprecateByteStringMeta.__new__3sC <    , ! wsD%EfEErcPddl}|jddt| |S)Nrrrr)rrr__instancecheck__)rBinstancerrs r rz*_DeprecateByteStringMeta.__instancecheck__=s1 (  w(22r)rErFrGrrrrs@r rr2sF33rrceZdZdZdZy)r#zMThis unifies bytes and bytearray. XXX Should add all their methods. rN)rErFrGrrHrrr r#r#Fs Irr#cpeZdZdZdZedZedZedZdZ dZ dZ d Z dd Z d Zd Zy )r"zAll the operations on a read-write sequence. Concrete subclasses must provide __new__ or __init__, __getitem__, __setitem__, __delitem__, __len__, and insert(). rctrrr=rrWs r rozMutableSequence.__setitem__[rrctrrrs r rqzMutableSequence.__delitem___rrct)z3S.insert(index, value) -- insert value before indexrrs r insertzMutableSequence.insertcs rc:|jt||y)z:S.append(value) -- append value to the end of the sequenceN)rrrVs r appendzMutableSequence.appendhs CIu%rcF |j#t$rYywxYw)z,S.clear() -> None -- remove all items from SN)r1rr<s r r3zMutableSequence.clearls*     r4czt|}t|dzD]}|||z dz ||c||<|||z dz <!y)z!S.reverse() -- reverse *IN PLACE*rr%N)rr)r=rrs r reversezMutableSequence.reversetsI Iq!tA#'!A;Q DGT!A#a%[rcR||ur t|}|D]}|j|y)zMS.extend(iterable) -- extend sequence by appending elements from the iterableN)rr)r=rOrgs r extendzMutableSequence.extendzs' T>&\FA KKNrc||}||=|S)zS.pop([index]) -> item -- remove and return item at index (default last). Raise IndexError if list is empty or index is out of range. r)r=rrgs r r1zMutableSequence.pops K Krc(||j|=y)zvS.remove(value) -- remove first occurrence of value. Raise ValueError if the value is not present. N)rrVs r r,zMutableSequence.removes E" #rc(|j||Sr)r)r=rOs r __iadd__zMutableSequence.__iadd__s F rN)r)rErFrGrrHrrorqrrr3rrr1r,rrrr r"r"Rsk I&8 $ rr")UrabcrrrrrrrP EllipsisTyper r__all__rEr.bytes_iterator bytearraybytearray_iteratorrKdict_keyiteratorrOdict_valueiteratorrMdict_itemiterator list_iteratorrlist_reverseiteratorrrange_iteratorlongrange_iteratorr_ set_iterator str_iteratortuple_iteratorzip zip_iterator dict_keys dict_values dict_itemsr1 mappingproxy generatorr* coroutinerhr-async_generatorr8rr r registerr rrrrrrrrrr$rrrrr frozensetrrrrrr rrQr!rstrrrr#bytesr"rrr rs>( DI Cy Bx   d3i$y{+,RWWY($ryy{+,bhhj)*T"X D"./d58n%$uQ$Y/01DK DH~ d2hDK O 299; "((*  DMM" /$ %   K    es)   2'2"& &R 92g2"M&-]-`(22$x& .!$%"#$%#$- &'.!$%,,.!,   --` 9 g 2'2") w 4@L4@l V$;;(G*GT YMM` C 1j1f 2% 2 !{C ! ), S,, : %j %  K OWOd =@z:=@~ %#%*3w3(%= E I?h?D#r dZdZgdZddlZddlZddlmZmZmZmZm Z m Z m Z m Z m Z mZmZmZmZmZmZde_dZdZdZGd d ej0ej2 ZGd d ej6eZGddej:eZGddej>eZ ejCe e e eeefD]Z"ejCe"e efD]Z"e jCe"[" ddlm#Z#ejCe#y#e$$rYywxYw)aThe io module provides the Python interfaces to stream handling. The builtin open function is defined in this module. At the top of the I/O hierarchy is the abstract base class IOBase. It defines the basic interface to a stream. Note, however, that there is no separation between reading and writing to streams; implementations are allowed to raise an OSError if they do not support a given operation. Extending IOBase is RawIOBase which deals simply with the reading and writing of raw bytes to a stream. FileIO subclasses RawIOBase to provide an interface to OS files. BufferedIOBase deals with buffering on a raw byte stream (RawIOBase). Its subclasses, BufferedWriter, BufferedReader, and BufferedRWPair buffer streams that are readable, writable, and both respectively. BufferedRandom provides a buffered interface to random access streams. BytesIO is a simple stream of in-memory bytes. Another IOBase subclass, TextIOBase, deals with the encoding and decoding of streams into text. TextIOWrapper, which extends it, is a buffered text interface to a buffered raw stream (`BufferedIOBase`). Finally, StringIO is an in-memory stream for text. Argument names are not part of the specification, and only the arguments of open() are intended to be used as keyword arguments. data: DEFAULT_BUFFER_SIZE An int containing the default buffer size used by the module's buffered I/O classes. open() uses the file's blksize (as obtained by os.stat) if possible. zGuido van Rossum , Mike Verdone , Mark Russell , Antoine Pitrou , Amaury Forgeot d'Arc , Benjamin Peterson )BlockingIOErroropen open_codeIOBase RawIOBaseFileIOBytesIOStringIOBufferedIOBaseBufferedReaderBufferedWriterBufferedRWPairBufferedRandom TextIOBase TextIOWrapperUnsupportedOperationSEEK_SETSEEK_CURSEEK_ENDDEFAULT_BUFFER_SIZE text_encodingIncrementalNewlineDecoderN)rrrrrrrr r r r rrrrioc8eZdZejj Zy)rN)__name__ __module__ __qualname___io_IOBase__doc__ rrHskk!!Gr$r) metaclassc8eZdZejj Zy)rN)rrrr _RawIOBaser"r#r$r%rrKsnn$$Gr$rc8eZdZejj Zy)r N)rrrr _BufferedIOBaser"r#r$r%r r Ns!!))Gr$r c8eZdZejj Zy)rN)rrrr _TextIOBaser"r#r$r%rrQsoo%%Gr$r)_WindowsConsoleIO)%r" __author____all__r abcrrrrrrrr r r r rrrrrrrrr!ABCMetarr(rr*r r,rregisterklassr- ImportErrorr#r$r%r5s/!H8  P JJJJJ#'    "S[[CKK"%%*S((&*&&& 6~~~EE" &E' *%()  s-DD  D dZddlZddlZ ddlgdZdZdxZ Z dxZ Z d Z d Zejd k(re xZZe Zne xZZeZe Ze Ze ZeZGd d eZGddZGddeZGddeZGddeZGddeZGddeZGddeZ GddZ!GddZ"d2d!Z#d3d"Z$d#Z%d$Z&d%Z'd&Z(d'Z)d(Z*d4d)Z+d4d*Z,d+Z-d,Z. e/d Z0e/d-Z1e/d.Z2e/d/Z3e/d0Z4e/d1Z5dZ7e7rddl8Z8yy#e$rZedezdZ[wwxYw#e6$rdZ0dZ1dZ2dZ3dZ4dZ5Y5wxYw)5z codecs -- Python Codec Registry, API and helpers. Written by Marc-Andre Lemburg (mal@lemburg.com). (c) Copyright CNRI, All Rights Reserved. NO WARRANTY. N)*z%Failed to load the builtin codecs: %s),registerlookupopen EncodedFileBOMBOM_BEBOM_LEBOM32_BEBOM32_LEBOM64_BEBOM64_LEBOM_UTF8 BOM_UTF16 BOM_UTF16_LE BOM_UTF16_BE BOM_UTF32 BOM_UTF32_LE BOM_UTF32_BE CodecInfoCodecIncrementalEncoderIncrementalDecoder StreamReader StreamWriterStreamReaderWriter StreamRecoder getencoder getdecodergetincrementalencodergetincrementaldecoder getreader getwriterencodedecode iterencode iterdecode strict_errors ignore_errorsreplace_errorsxmlcharrefreplace_errorsbackslashreplace_errorsnamereplace_errorsregister_error lookup_errorssssslittlec,eZdZdZdZ ddddZdZy)rz0Codec details when looking up the codec registryTN)_is_text_encodingctj|||||f} || _|| _|| _|| _|| _|| _|| _||| _ | SN) tuple__new__namer$r%incrementalencoderincrementaldecoder streamwriter streamreaderr2) clsr$r%r;r:r8r9r7r2selfs r6zCodecInfo.__new__^se}}S66<"NO   "4"4((  (%6D " cd|jj|jj|jt |fzS)Nz%<%s.%s object for encoding %s at %#x>) __class__ __module__ __qualname__r7idr=s r>__repr__zCodecInfo.__repr__ms:6**DNN,G,GBtH&& &r?)NNNNN)__name__rBrC__doc__r2r6rFr?r>rrSs%:EI?C ! &r?rc eZdZdZddZddZy)ra9 Defines the interface for stateless encoders/decoders. The .encode()/.decode() methods may use different error handling schemes by providing the errors argument. These string values are predefined: 'strict' - raise a ValueError error (or a subclass) 'ignore' - ignore the character and continue with the next 'replace' - replace with a suitable replacement character; Python will use the official U+FFFD REPLACEMENT CHARACTER for the builtin Unicode codecs on decoding and '?' on encoding. 'surrogateescape' - replace with private code points U+DCnn. 'xmlcharrefreplace' - Replace with the appropriate XML character reference (only for encoding). 'backslashreplace' - Replace with backslashed escape sequences. 'namereplace' - Replace with \N{...} escape sequences (only for encoding). The set of allowed values can be extended via register_error. ct)a# Encodes the object input and returns a tuple (output object, length consumed). errors defines the error handling to apply. It defaults to 'strict' handling. The method may not store state in the Codec instance. Use StreamWriter for codecs which have to keep state in order to make encoding efficient. The encoder must be able to handle zero length input and return an empty object of the output object type in this situation. NotImplementedErrorr=inputerrorss r>r$z Codec.encodes ""!r?ct)a Decodes the object input and returns a tuple (output object, length consumed). input must be an object which provides the bf_getreadbuf buffer slot. Python strings, buffer objects and memory mapped files are examples of objects providing this slot. errors defines the error handling to apply. It defaults to 'strict' handling. The method may not store state in the Codec instance. Use StreamReader for codecs which have to keep state in order to make decoding efficient. The decoder must be able to handle zero length input and return an empty object of the output object type in this situation. rLrNs r>r%z Codec.decodes *"!r?Nstrict)rGrBrCrHr$r%rIr?r>rrrs,"&"r?rc2eZdZdZddZd dZdZdZdZy) rz An IncrementalEncoder encodes an input in multiple steps. The input can be passed piece by piece to the encode() method. The IncrementalEncoder remembers the state of the encoding process between calls to encode(). c ||_d|_y)z Creates an IncrementalEncoder instance. The IncrementalEncoder may use different error handling schemes by providing the errors keyword argument. See the module docstring for a list of possible values. N)rPbufferr=rPs r>__init__zIncrementalEncoder.__init__s  r?ct)zA Encodes input and returns the resulting object. rLr=rOfinals r>r$zIncrementalEncoder.encode "!r?cy)z: Resets the encoder to the initial state. NrIrEs r>resetzIncrementalEncoder.resetr?cy)z: Return the current state of the encoder. rrIrEs r>getstatezIncrementalEncoder.getstatesr?cy)zl Set the current state of the encoder. state must have been returned by getstate(). NrIr=states r>setstatezIncrementalEncoder.setstater`r?NrRF) rGrBrCrHrYr$r_rbrfrIr?r>rrs  "    r?rc8eZdZdZd dZdZd dZdZdZdZ y) BufferedIncrementalEncoderz This subclass of IncrementalEncoder can be used as the baseclass for an incremental encoder if the encoder must keep some of the output in a buffer between calls to encode(). c>tj||d|_yNrV)rrYrWrXs r>rYz#BufferedIncrementalEncoder.__init__s##D&1 r?ctr4rLr=rOrPr\s r>_buffer_encodez)BufferedIncrementalEncoder._buffer_encode "!r?cx|j|z}|j||j|\}}||d|_|Sr4)rWrnrPr=rOr\dataresultconsumeds r>r$z!BufferedIncrementalEncoder.encode?{{U"!00t{{EJ89o  r?c<tj|d|_yrk)rr_rWrEs r>r_z BufferedIncrementalEncoder.resets  & r?c"|jxsdSNrrWrEs r>rbz#BufferedIncrementalEncoder.getstates{{ar?c|xsd|_yrkryrds r>rfz#BufferedIncrementalEncoder.setstates kr r?NrRrg) rGrBrCrHrYrnr$r_rbrfrIr?r>riris%  "  "r?ric2eZdZdZddZd dZdZdZdZy) rz An IncrementalDecoder decodes an input in multiple steps. The input can be passed piece by piece to the decode() method. The IncrementalDecoder remembers the state of the decoding process between calls to decode(). c||_y)z Create an IncrementalDecoder instance. The IncrementalDecoder may use different error handling schemes by providing the errors keyword argument. See the module docstring for a list of possible values. N)rPrXs r>rYzIncrementalDecoder.__init__s  r?ct)z@ Decode input and returns the resulting object. rLr[s r>r%zIncrementalDecoder.decoder]r?cy)z9 Reset the decoder to the initial state. NrIrEs r>r_zIncrementalDecoder.resetr`r?cy)a  Return the current state of the decoder. This must be a (buffered_input, additional_state_info) tuple. buffered_input must be a bytes object containing bytes that were passed to decode() that have not yet been converted. additional_state_info must be a non-negative integer representing the state of the decoder WITHOUT yet having processed the contents of buffered_input. In the initial state and after reset(), getstate() must return (b"", 0). )r?rrIrEs r>rbzIncrementalDecoder.getstatesr?cy)z Set the current state of the decoder. state must have been returned by getstate(). The effect of setstate((b"", 0)) must be equivalent to reset(). NrIrds r>rfzIncrementalDecoder.setstate'r`r?NrRrg) rGrBrCrHrYr%r_rbrfrIr?r>rrs  "   r?rc8eZdZdZd dZdZd dZdZdZdZ y) BufferedIncrementalDecoderz This subclass of IncrementalDecoder can be used as the baseclass for an incremental decoder if the decoder must be able to handle incomplete byte sequences. c>tj||d|_yNr?)rrYrWrXs r>rYz#BufferedIncrementalDecoder.__init__5s##D&1 r?ctr4rLrms r>_buffer_decodez)BufferedIncrementalDecoder._buffer_decode:ror?cx|j|z}|j||j|\}}||d|_|Sr4)rWrrPrqs r>r%z!BufferedIncrementalDecoder.decode?rur?c<tj|d|_yr)rr_rWrEs r>r_z BufferedIncrementalDecoder.resetGs  & r?c|jdfSrxryrEs r>rbz#BufferedIncrementalDecoder.getstateKs Qr?c|d|_yrxryrds r>rfz#BufferedIncrementalDecoder.setstateOs Ah r?NrRrg) rGrBrCrHrYrr%r_rbrfrIr?r>rr/s%  "  r?rcJeZdZd dZdZdZdZd dZefdZ dZ dZ d Z y ) rc ||_||_y)aw Creates a StreamWriter instance. stream must be a file-like object open for writing. The StreamWriter may use different error handling schemes by providing the errors keyword argument. These parameters are predefined: 'strict' - raise a ValueError (or a subclass) 'ignore' - ignore the character and continue with the next 'replace'- replace with a suitable replacement character 'xmlcharrefreplace' - Replace with the appropriate XML character reference. 'backslashreplace' - Replace with backslashed escape sequences. 'namereplace' - Replace with \N{...} escape sequences. The set of allowed parameter values can be extended via register_error. N)streamrPr=rrPs r>rYzStreamWriter.__init__\s,  r?cx|j||j\}}|jj|y)z> Writes the object's contents encoded to self.stream. N)r$rPrwrite)r=objectrrrts r>rzStreamWriter.writeus.VT[[9h $r?cD|jdj|y)z[ Writes the concatenated list of strings to the stream using .write(). rVN)rjoinr=lists r> writelineszStreamWriter.writelines|s 2774=!r?cy)a2 Resets the codec buffers used for keeping internal state. Calling this method should ensure that the data on the output is put into a clean state, that allows appending of new fresh data without having to rescan the whole stream to recover state. NrIrEs r>r_zStreamWriter.resets r?ct|jj|||dk(r|dk(r|jyyyrxrseekr_r=offsetwhences r>rzStreamWriter.seeks3 ( Q;6Q; JJL';r?c(||j|Sz? Inherit all other methods from the underlying stream. rr=r7getattrs r> __getattr__zStreamWriter.__getattr__ t{{D))r?c|Sr4rIrEs r> __enter__zStreamWriter.__enter__ r?c8|jjyr4rcloser=typevaluetbs r>__exit__zStreamWriter.__exit__ r?cFtd|jjzNzcan't serialize %s TypeErrorrArGr=protos r> __reduce_ex__zStreamWriter.__reduce_ex__,t~~/F/FFGGr?NrRr) rGrBrCrYrrr_rrrrrrrIr?r>rrZs52 "   $*Hr?rcneZdZeZddZddZddZddZddZ dZ ddZ d Z d Z efd Zd Zd ZdZy)rc||_||_d|_|j|_|j|_d|_y)a Creates a StreamReader instance. stream must be a file-like object open for reading. The StreamReader may use different error handling schemes by providing the errors keyword argument. These parameters are predefined: 'strict' - raise a ValueError (or a subclass) 'ignore' - ignore the character and continue with the next 'replace'- replace with a suitable replacement character 'backslashreplace' - Replace with backslashed escape sequences; The set of allowed parameter values can be extended via register_error. r?N)rrP bytebuffercharbuffertype_empty_charbuffer charbuffer linebufferrs r>rYzStreamReader.__init__s>$  !%!4!4!600r?ctr4rLrNs r>r%zStreamReader.decodes!!r?cF|jr1|jj|j|_d|_|dkr|} |dk\rt |j|k\rn|dkr|j j }n|j j |}|j|z}|snC |j||j\}}||d|_|xj|z c_|sn|dkr|j} |j|_| S|jd|} |j|d|_| S#t$rZ}|rM|j|d|j|j\}}|jd} t | dkrYd}~d}~wwxYw)a Decodes data from the stream self.stream and returns the resulting object. chars indicates the number of decoded code points or bytes to return. read() will never return more data than requested, but it might return less, if there is not enough available. size indicates the approximate maximum number of decoded bytes or code points to read for decoding. The decoder can modify this setting as appropriate. The default value -1 indicates to read and decode as much as possible. size is intended to prevent having to decode huge files in one step. If firstline is true, and a UnicodeDecodeError happens after the first line terminator in the input only the first line will be returned, the rest of the input will be kept until the next call to read(). The method should use a greedy read strategy, meaning that it should read as much data as is allowed within the definition of the encoding and the given size, e.g. if optional encoding endings or state markers are available on the stream, these should be read too. NrTkeepends) rrrrlenrreadrr%rPUnicodeDecodeErrorstart splitlines) r=sizechars firstlinenewdatarrnewchars decodedbytesexclinesrss r>rzStreamReader.reads8 ??"4499$//JDO"DO 19Ezt'50ax++**,++**40??W,D )-T4;;)G&,#<=1DO OOx 'O?@ 19__F"44DO  __Ve,F"ooef5DO 1&  D#))$4dkkB+Hl$///>E5z1}%  s2D== F AFF Nc&|jrh|jd}|jd=t|jdk(r|jd|_d|_|s|jdd}|S|xsd}|j} |j |d}|rXt |tr|jd s!t |tr'|jd r||j dd z }||z }|jd}|rt|dkDrm|d}|d=t|dkDr&|d xx|jz cc<||_d|_n|d|jz|_|s|jdd} |S|d}|djdd}||k7r<|jj|dd|jz|_|r|} |S|} |S|r||r|s|jdd} |S|d kr|dz})z Read one line from the input stream and return the decoded data. size, if given, is passed as size argument to the read() method. rrNFrHT)r  )rri@) rrrrrr isinstancestrendswithbytesr) r=rrlinereadsizerrr line0withendline0withoutends r>readlinezStreamReader.readlines; ????1%D"4??#q(#'//!"4"&6q9K:2%%99X96DtS)dmmD.AtU+ e0DDII1AI66D DLDOOTO2Eu:>!8Da5zA~b T__4 */*.+0(T__*D##>qA& % %Qx "'("5"5u"5"Ea"H?2&*&<&<&A&A%)&L&*oo'6DO+  / 4+??E?:1=D $A ]r?cD|j}|j|S)aS Read all lines available on the input stream and return them as a list. Line breaks are implemented using the codec's decoder method and are included in the list entries. sizehint, if given, is ignored since there is no efficient way to finding the true end-of-line. )rr)r=sizehintrrrs r> readlineszStreamReader.readlinesasyy{x((r?cBd|_|j|_d|_y)z Resets the codec buffers used for keeping internal state. Note that no stream repositioning should take place. This method is primarily intended to be able to recover from decoding errors. r?N)rrrrrEs r>r_zStreamReader.resetps00r?c\|jj|||jy)zp Set the input stream's current position. Resets the codec buffers used for keeping state. Nrrs r>rzStreamReader.seek}s! ( r?c6|j}|r|Stz4 Return the next decoded line from the input stream.)r StopIteration)r=rs r>__next__zStreamReader.__next__s}} Kr?c|Sr4rIrEs r>__iter__zStreamReader.__iter__rr?c(||j|Srrrs r>rzStreamReader.__getattr__rr?c|Sr4rIrEs r>rzStreamReader.__enter__rr?c8|jjyr4rrs r>rzStreamReader.__exit__rr?cFtd|jjzrrrs r>rzStreamReader.__reduce_ex__rr?rR)rrF)NTr)rGrBrCrrrYr%rrrr_rrrrrrrrrIr?r>rrsRN2"N`IV ) $*Hr?rcveZdZdZdZddZddZddZddZdZ d Z d Z d Z d Z dd ZefdZdZdZdZy)ra StreamReaderWriter instances allow wrapping streams which work in both read and write modes. The design is such that one can use the factory functions returned by the codec.lookup() function to construct the instance. unknowncX||_||||_||||_||_y)aR Creates a StreamReaderWriter instance. stream must be a Stream-like object. Reader, Writer must be factory functions or classes providing the StreamReader, StreamWriter interface resp. Error handling is done in the same way as defined for the StreamWriter/Readers. N)rreaderwriterrP)r=rReaderWriterrPs r>rYzStreamReaderWriter.__init__s. VV, VV,  r?c8|jj|Sr4)rrr=rs r>rzStreamReaderWriter.reads{{%%r?Nc8|jj|Sr4)rrrs r>rzStreamReaderWriter.readlines{{##D))r?c8|jj|Sr4)rr)r=rs r>rzStreamReaderWriter.readliness{{$$X..r?c,t|jSr)nextrrEs r>rzStreamReaderWriter.__next__sDKK  r?c|Sr4rIrEs r>rzStreamReaderWriter.__iter__rr?c8|jj|Sr4)rr)r=rrs r>rzStreamReaderWriter.writes{{  &&r?c8|jj|Sr4)rrrs r>rzStreamReaderWriter.writeliness{{%%d++r?cl|jj|jjyr4rr_rrEs r>r_zStreamReaderWriter.reset"  r?c|jj|||jj|dk(r!|dk(r|jjyyyrx)rrrr_rrs r>rzStreamReaderWriter.seeksJ (  Q;6Q; KK   ';r?c(||j|Srrrs r>rzStreamReaderWriter.__getattr__rr?c|Sr4rIrEs r>rzStreamReaderWriter.__enter__rr?c8|jjyr4rrs r>rzStreamReaderWriter.__exit__rr?cFtd|jjzrrrs r>rz StreamReaderWriter.__reduce_ex__rr?rRrr4r)rGrBrCrHencodingrYrrrrrrrr_rrrrrrrIr?r>rrsZH$&*/! ',  $*Hr?rc|eZdZdZdZdZ ddZddZddZddZ dZ d Z d Z d Z d Zdd ZefdZdZdZdZy)raB StreamRecoder instances translate data from one encoding to another. They use the complete set of APIs returned by the codecs.lookup() function to implement their task. Data written to the StreamRecoder is first decoded into an intermediate format (depending on the "decode" codec) and then written to the underlying stream using an instance of the provided Writer class. In the other direction, data is read from the underlying stream using a Reader instance and then encoded and returned to the caller. rct||_||_||_||||_||||_||_y)a Creates a StreamRecoder instance which implements a two-way conversion: encode and decode work on the frontend (the data visible to .read() and .write()) while Reader and Writer work on the backend (the data in stream). You can use these objects to do transparent transcodings from e.g. latin-1 to utf-8 and back. stream must be a file-like object. encode and decode must adhere to the Codec interface; Reader and Writer must be factory functions or classes providing the StreamReader and StreamWriter interfaces resp. Error handling is done in the same way as defined for the StreamWriter/Readers. N)rr$r%rrrP)r=rr$r%rrrPs r>rYzStreamRecoder.__init__s<*   VV, VV,  r?cz|jj|}|j||j\}}|Sr4)rrr$rPr=rrr bytesencodeds r>rzStreamRecoder.read,s4{{%![[t{{;l r?Nc||jj}n|jj|}|j||j\}}|Sr4)rrr$rPrs r>rzStreamRecoder.readline2sK <;;'')D;;''-D![[t{{;l r?c|jj}|j||j\}}|j dS)NTr)rrr$rPr)r=rrrrs r>rzStreamRecoder.readlines;s>{{!![[t{{;l--r?cnt|j}|j||j\}}|Sr)rrr$rP)r=rrrs r>rzStreamRecoder.__next__As0DKK ![[t{{;l r?c|Sr4rIrEs r>rzStreamRecoder.__iter__Hrr?cv|j||j\}}|jj|Sr4)r%rPrr)r=rr bytesdecodeds r>rzStreamRecoder.writeKs0![[t{{;l{{  &&r?cdj|}|j||j\}}|jj |Sr)rr%rPrr)r=rrrrs r>rzStreamRecoder.writelinesPs=xx~![[t{{;l{{  &&r?cl|jj|jjyr4rrEs r>r_zStreamRecoder.resetVrr?ct|jj|||jj||yr4)rrrrs r>rzStreamRecoder.seek[s, ( (r?c(||j|Srrrs r>rzStreamRecoder.__getattr__arr?c|Sr4rIrEs r>rzStreamRecoder.__enter__hrr?c8|jjyr4rrs r>rzStreamRecoder.__exit__krr?cFtd|jjzrrrs r>rzStreamRecoder.__reduce_ex__nrr?rRr r4r)rGrBrCrH data_encoding file_encodingrYrrrrrrrr_rrrrrrrIr?r>rrsd MM!8 . ' '  )$*Hr?rrSc| d|vr|dz}tj|||}||S t|}t||j|j |}||_|S#|jxYw)a Open an encoded file using the given mode and return a wrapped version providing transparent encoding/decoding. Note: The wrapped version will only accept the object format defined by the codecs, i.e. Unicode objects for most builtin codecs. Output is also codec dependent and will usually be Unicode as well. If encoding is not None, then the underlying encoded files are always opened in binary mode. The default file mode is 'r', meaning to open the file in read mode. encoding specifies the encoding which is to be used for the file. errors may be given to define the error handling. It defaults to 'strict' which causes ValueErrors to be raised in case an encoding error occurs. buffering has the same meaning as for the builtin open() API. It defaults to -1 which means that the default buffer size will be used. The returned wrapped file object provides an extra attribute .encoding which allows querying the used encoding. This attribute is only available if an encoding was specified as parameter. b)builtinsrrrr;r:r r)filenamemoder rP bufferingfileinfosrws r>rrss> $cz ==4 3D h t'8'8$:K:KVT    s 5AA1c||}t|}t|}t||j|j|j|j |}||_||_|S)a Return a wrapped version of file which provides transparent encoding translation. Data written to the wrapped file is decoded according to the given data_encoding and then encoded to the underlying file using file_encoding. The intermediate data type will usually be Unicode but depends on the specified codecs. Bytes read from the file are decoded using file_encoding and then passed back to the caller encoded using data_encoding. If file_encoding is not given, it defaults to data_encoding. errors may be given to define the error handling. It defaults to 'strict' which causes ValueErrors to be raised in case an encoding error occurs. The returned wrapped file object provides two extra attributes .data_encoding and .file_encoding which reflect the given parameters of the same name. The attributes can be used for introspection by Python programs. )rrr$r%r;r:rr)r%rrrP data_info file_infosrs r>rrsj2% }%I}%I tY--y/?/? --y/E/Ev OB%B$B Ir?c,t|jS)z Lookup up the codec for the given encoding and return its encoder function. Raises a LookupError in case the encoding cannot be found. )rr$r s r>rr (  " ""r?c,t|jS)z Lookup up the codec for the given encoding and return its decoder function. Raises a LookupError in case the encoding cannot be found. )rr%r-s r>rrr.r?cJt|j}| t||S)z Lookup up the codec for the given encoding and return its IncrementalEncoder class or factory function. Raises a LookupError in case the encoding cannot be found or the codecs doesn't provide an incremental encoder. )rr8 LookupError)r encoders r>r r )X11G(## Nr?cJt|j}| t||S)z Lookup up the codec for the given encoding and return its IncrementalDecoder class or factory function. Raises a LookupError in case the encoding cannot be found or the codecs doesn't provide an incremental decoder. )rr9r1)r decoders r>r!r!r3r?c,t|jS)z Lookup up the codec for the given encoding and return its StreamReader class or factory function. Raises a LookupError in case the encoding cannot be found. )rr;r-s r>r"r" (  ( ((r?c,t|jS)z Lookup up the codec for the given encoding and return its StreamWriter class or factory function. Raises a LookupError in case the encoding cannot be found. )rr:r-s r>r#r#r7r?c+Kt||fi|}|D]}|j|}|s||jdd}|r|yyw)z Encoding iterator. Encodes the input strings from the iterator using an IncrementalEncoder. errors and kwargs are passed through to the IncrementalEncoder constructor. rVTN)r r$)iteratorr rPkwargsr2rOoutputs r>r&r&s^.#H-f??G& L^^B %F   +A Ac+Kt||fi|}|D]}|j|}|s||jdd}|r|yyw)z Decoding iterator. Decodes the input strings from the iterator using an IncrementalDecoder. errors and kwargs are passed through to the IncrementalDecoder constructor. r?TN)r!r%)r:r rPr;r5rOr<s r>r'r' s^.#H-f??G& L^^C &F  r=c.|Dcic]}||c}Scc}w)z make_identity_dict(rng) -> dict Return a dictionary where elements of the rng sequence are mapped to themselves. rI)rngis r>make_identity_dictrB4s  AAaC  s cXi}|jD]\}}||vr|||<d||<|S)a Creates an encoding map from a decoding map. If a target mapping in the decoding map occurs multiple times, then that target is mapped to None (undefined mapping), causing an exception when encountered by the charmap codec during translation. One example where this happens is cp875.py which decodes multiple character to \u001a. N)items) decoding_mapmkvs r>make_encoding_maprI>s@ A!!#!AvAaDAaD $ Hr?ignorereplacexmlcharrefreplacebackslashreplace namereplace)rNrSr)NrSrR)9rHr!sys_codecs ImportErrorwhy SystemError__all__rr rr rrr byteorderrrrr r rr r5rrrrrirrrrrrrrrrr r!r"r#r&r'rBrIr/r(r)r*r+r,r-r1_false encodingsrIr?r>rYs E -0 $#$## # ==H#"C)I #"C)I     &&>@"@"D& & P "!3 "D/ / b"!3"VHH5HHXxH5xHxVHVHtsHsHn/b"L##  ))$( . *M *M!),N+,?@*+=>%m4   o"E =C DDEV"MMN#"s)D0D-D* D%%D*-EEdZdZGddeZGddeZGddeZ dd lm Z m Z m Z m Z m Z mZmZmZGd d eZdZGddeZy#e$rdd lmZm Z d e_Y&wxYw)z3Abstract Base Classes (ABCs) according to PEP 3119.cd|_|S)aIA decorator indicating abstract methods. Requires that the metaclass is ABCMeta or derived from it. A class that has a metaclass derived from ABCMeta cannot be instantiated unless all of its abstract methods are overridden. The abstract methods can be called using any of the normal 'super' call mechanisms. abstractmethod() may be used to declare abstract methods for properties and descriptors. Usage: class C(metaclass=ABCMeta): @abstractmethod def my_abstract_method(self, arg1, arg2, argN): ... T)__isabstractmethod__)funcobjs abstractmethodrs"$(G Nc&eZdZdZdZfdZxZS)abstractclassmethodaA decorator indicating abstract classmethods. Deprecated, use 'classmethod' with 'abstractmethod' instead: class C(ABC): @classmethod @abstractmethod def my_abstract_classmethod(cls, ...): ... Tc2d|_t| |yNTrsuper__init__selfcallable __class__s rrzabstractclassmethod.__init__+(,% "r__name__ __module__ __qualname____doc__rr __classcell__rs@rr r   ##rr c&eZdZdZdZfdZxZS)abstractstaticmethodaA decorator indicating abstract staticmethods. Deprecated, use 'staticmethod' with 'abstractmethod' instead: class C(ABC): @staticmethod @abstractmethod def my_abstract_staticmethod(...): ... Tc2d|_t| |yr r rs rrzabstractstaticmethod.__init__?rrrrs@rrr0rrrceZdZdZdZy)abstractpropertyzA decorator indicating abstract properties. Deprecated, use 'property' with 'abstractmethod' instead: class C(ABC): @property @abstractmethod def my_abstract_property(self): ... TN)rrrrrrrr r Ds  rr )get_cache_token _abc_init _abc_register_abc_instancecheck_abc_subclasscheck _get_dump_reset_registry _reset_cachescHeZdZdZfdZdZdZdZd dZdZ dZ xZ S) ABCMetaaMetaclass for defining Abstract Base Classes (ABCs). Use this metaclass to create an ABC. An ABC can be subclassed directly, and then acts as a mix-in class. You can also register unrelated concrete classes (even built-in classes) and unrelated ABCs as 'virtual subclasses' -- these and their descendants will be considered subclasses of the registering ABC by the built-in issubclass() function, but the registering ABC won't show up in their MRO (Method Resolution Order) nor will method implementations defined by the registering ABC be callable (not even via super()). c Dt|||||fi|}t||SN)r __new__r$)mclsnamebases namespacekwargsclsrs rr/zABCMeta.__new__is('/$eYI&IC cNJrct||S)z{Register a virtual subclass of an ABC. Returns the subclass, to allow usage as a class decorator. )r%r5subclasss rregisterzABCMeta.registerns !h/ /rct||S)z'Override for isinstance(instance, cls).)r&)r5instances r__instancecheck__zABCMeta.__instancecheck__u%c84 4rct||S)z'Override for issubclass(subclass, cls).)r'r7s r__subclasscheck__zABCMeta.__subclasscheck__yr=rc"td|jd|j|tdt|t |\}}}}td||td||td||td||y ) z'Debug helper to print the ABC registry.zClass: .)filezInv. counter: z_abc_registry: z _abc_cache: z_abc_negative_cache: z_abc_negative_cache_version: N)printrrr#r()r5rB _abc_registry _abc_cache_abc_negative_cache_abc_negative_cache_versions r_dump_registryzABCMeta._dump_registry}s GCNN+1S-=-=,>?d K N?#4"56T B,5cN *]J(; ( OM#45D A L/d ; )*=)@A M 12M1PQ rct|y)z.Clear the registry (for debugging or testing).N)r)r5s r_abc_registry_clearzABCMeta._abc_registry_clears C rct|y)z,Clear the caches (for debugging or testing).N)r*rJs r_abc_caches_clearzABCMeta._abc_caches_clears # rr.) rrrrr/r9r<r?rHrKrMrrs@rr,r,\s+    0 5 5  ! rr,)r,r#abccvt|ds|St}|jD]@}t|ddD].}t||d}t|dds|j |0B|j j D]$\}}t|dds|j |&t||_|S)aRecalculate the set of abstract methods of an abstract class. If a class has had one of its abstract methods implemented after the class was created, the method will not be considered implemented until this function is called. Alternatively, if a new abstract method has been added to the class, it will only be considered an abstract method of the class after this function is called. This function should be called before any use is made of the class, usually in class decorators that add methods to the subject class. Returns cls, to allow usage as a class decorator. If cls is not an instance of ABCMeta, does nothing. __abstractmethods__r!NrF) hasattrset __bases__getattradd__dict__items frozensetrP)r5 abstractssclsr1values rupdate_abstractmethodsr\s 3- . I D"7rhs:*#+#(#<#(  x  ;6663$3l#LGA0GsAA.-A.dZedy)Tz Hello world!N) initializedprintrs nr(dZdZedk(reyy)Tctdy)Nz Hello world!)printmainrs  .r__main__N) initializedr__name__rrrr s#  zFry)Nrrsry)Nrrsr(dZdZedk(reyy)Tctdy)Nz Hello world!)printmainrs  .r__main__N) initializedr__name__rrrr s#  zFrddZGddZGddZGddZdZedk(rey y ) TceZdZdZy)TestFrozenUtf8_1¶N__name__ __module__ __qualname____doc__rrr rceZdZdZy)TestFrozenUtf8_2uπNrr r r rrr r rceZdZdZy)TestFrozenUtf8_4u😀Nrr r r rr sr rctdy)Nz Hello world!)printr r r mainr s  .r __main__N) initializedrrrrrr r r rsA  zFr c ejdxseZedk(sedk(re3ee2ZRe8e2ZSneSrd,Z!eSZgZ"d*ZUe:se$re-rejd6d,d,kDrX e3e$e>e3e$ed,Z&e3e$eZUeUr3edk(reUZVn eeUge ZVeVr e3eVdZ%n e3eUdZ%eseVZeseUZd'ed6<e-rdxZZnFereje\ZZWZeWseZd*Z%e9rLesJe8e9ZPer edk(ree3ePer ePZn eePeZe re reseQd7e Dr ePZe3ee Z%er9e4r7es5edk(ree3e4er e4Zn ee4eZere3ee Z%eXe%sd*Z%e re re4resee4ge Zer e%s e3ee Z%eYreseYZeQd8e DseOd9ese/dZeOd9e rAes?edk(reZes e4r ee4e eXZeseZreZZereXe3ee sedk(re&s eZ&neOd:eseZereseOd;e-re-jceed(<d'ed)<ne#sgZ"e!r/e r-e jceD]Z2e"je/e2edk(r&e9r e8e9ZPne4ZPe"je3ePen3eUre"je3eYene"je3eeedk(re!re\re\je\jfD]jZ_ e\je_eZD d,Za e\jeDe\jeDeaZdeeedefr e"jedjceead'z ZaReir.eijceD]Z2e"je3ee2e%s er e3ee Z%e&s er e3ee Z&edk(r>e&re"je&e%re"je%e4r<gZ"eRD]dZBeBjd?d,jZBeBs(eBd@k(rd'ed=<3eBjdAr eOdBMe"je3eSeBfe"ed(<d'ed)<eed<eed<eed<eed <eed!<eed"<exseed#<exseed$<eed<e%xsdedC<e&xsdedD<y*#e)$rY0wxYw#e@eAf$re>e3e=eZ?e=Z zsearch_up..s<)QtHVQ'()s)anydirname)rr landmarkss`` r search_uprs'  <)< <M  program_namehome executablebase_executabler exec_prefix base_prefixbase_exec_prefixpythonpath_envuse_environmentmodule_search_pathsmodule_search_paths_setN orig_argvz /bin/pythonFT=z Failed to find real location of c#NK|]}ttt|ywrisfiler library_dir)rps rrrs F5E6(;* +5E#%exedllz._pth_is_python_buildc#NK|]}ttt|ywrr,rrs rrr3sN=M6(;23=Mr0c#NK|]}ttt|ywr)r-rrr5s rrrNsI8H16(61-.8Hr0z6Could not find platform independent libraries z9Could not find platform dependent libraries z8Consider setting $PYTHONHOME to [:]isolated site_import safe_path#z import sitezimport z'unsupported 'import' line in ._pth file stdlib_dirplatstdlib_dir)kconfigget PLATLIBDIRros_name BUILDDIR_TXTBUILD_LANDMARK VERSION_MAJORDEFAULT_PROGRAM_NAME VERSION_MINOR STDLIB_SUBDIRSTDLIB_LANDMARKSPLATSTDLIB_LANDMARKBUILDSTDLIB_LANDMARKS VENV_LANDMARK ZIP_LANDMARKDELIMSEPVPATH PYDEBUGEXTPYWINVER WINREG_KEYr-rrrrrrr r!r"ENV_PYTHONPATHr$ pythonpathpythonpath_was_setreal_executable_dirr;r<boolprogram_name_was_set IndexError EXE_SUFFIX hassuffixisxfile py_setpathreal_executableabspathENV_PATHsplitr/rexecutable_dirENV_PYTHONEXECUTABLEENV___PYVENV_LAUNCHER__WITH_NEXT_FRAMEWORKrlibrary home_was_setENV_PYTHONHOME venv_prefix venv_prefix2 readlines pyvenvcfgFileNotFoundErrorPermissionErrorline partitionkeyhad_equvaluestriplowerrealpathOSErrorbasenamebase_exe candidateexwarnr.rpthpth_dir rpartition build_prefixbuild_stdlib_prefix had_delimisdirPREFIX EXEC_PREFIXappendwinregHKEY_CURRENT_USERHKEY_LOCAL_MACHINEhk OpenKeyExi QueryValueEnumKeyv isinstancestrextendCloseKey PYTHONPATH startswithrrrsX \ZZ % 3  gH,#L*N#M?3!l'--IM(/0]O72KL'L a l[(M M \ dKL E C _#Lw45N#M(/1m_H3MN'L)N MM?=/*:J9K4PL1(<HJ E C(.!zz.)  zz& ZZ % **./ H jj' jj' ::01()**.2 ZZ- . ZZ 9:   L) zz+r215 'L i j9glU_F_>`*,L $ c\)&J!J  !Olx^^E " Q % 1:J  # JS\N)2 (2 %W-.k--Y$ )%@)@JZ(N L D  J&<)< l+  '!(; "FGI"nnS1We syy{((*f438;;= @N0"&.z&:O&*4*,'&.~x ?S&TO $vo/F#+J#7*>&WXYfXg@h)iI%zrII'94 ((0(KI &i02; %*j GJ  9O9rO%OC/O'X-''"K F5E FF"+.,+2?+CCN(!/2  , z? 3 $Ia$79Q;NLL%a( LA l!!*4  -j ::(! ,q 05!  h2LA B1 E  3U;  d?". "+L"Q;P"Q  !"5u=J!,6J(F&K&'!"F[ *.)>& ; K vg& $(; =>(F"; = -fN=MNN$%fm< v d?h~|<='~|=,<= *!&-8J fI8HII I J  EF; d?!K~#N4GeTK{%K%>Q(R"S$&&1NPQ    GH$.$4$4U$;F !()F $% J>%%e,A   gaj )-$ !'*K(K(; => (6<89(6<89$?v ++V-F-FGB &&r:6)A" & 1 1#v~~c17M NA&a-&--aggen=Q H4!!%(A   hvq1 2) &fm4 k!+/BC$    n -    j ) nJ>   n -    j )    n -$.F !()F $% d?| ZZ ! +VF**]+D{DfKF: !F F=F;J~~c"1%++-  ] "$%F= ! __Y ' : ;   hw5 6%/F !()F $% &~v!|+x#}#-v}-<!|!'R|)/R    X"?3 '!(<"GHI&K '  /   PCo //@ AB Ch  6 <, 3U;  /5 (.? @#$7?L$"55@ '"!" "--c48%a-&--aggen=OOC(FOOC((  s.b+cb7?c(=c4 d"d&=gg"e%6/g+b43b47cccc c%$c%(c10c14d9ddd#"d#&e"9%e"!e"%e-*g,e--Ag/gggg"!g"  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ÇüéâäàåçêëèïîìÄÅÉæÆôöòûùÿÖÜ¢£¥₧ƒáíóúñѪº¿⌐¬½¼¡«»░▒▓│┤╡╢╖╕╣║╗╝╜╛┐└┴┬├─┼╞╟╚╔╩╦╠═╬╧╨╤╥╙╘╒╓╫╪┘┌█▄▌▐▀αßΓπΣσµτΦΘΩδ∞φε∩≡±≥≤⌠⌡÷≈°∙·√ⁿ²■ pwd.struct_passwd: Results from getpw*() routines. This object may be accessed either as a tuple of (pw_name,pw_passwd,pw_uid,pw_gid,pw_gecos,pw_dir,pw_shell) or via the object attributes as named in the above tuple.This module provides access to the Unix password database. It is available on all Unix versions. Password database entries are reported as 7-tuples containing the following items from the password database (see `'), in order: pw_name, pw_passwd, pw_uid, pw_gid, pw_gecos, pw_dir, pw_shell. The uid and gid items are integers, all others are strings. An exception is raised if the entry asked for cannot be found.getpwall($module, /) -- Return a list of all available password database entries, in arbitrary order. See help(pwd) for more on password database entries.getpwnam($module, name, /) -- Return the password database entry for the given user name. See `help(pwd)` for more on password database entries.getpwuid($module, uidobj, /) -- Return the password database entry for the given numeric user ID. See `help(pwd)` for more on password database entries.symtable($module, source, filename, startstr, /) -- Return symbol and scope dictionaries used internally by compiler.Convert a file's mode to a string of the form '-rwxrwxrwx'Return the portion of the file's mode that describes the file type.Return the portion of the file's mode that can be set by os.chmod().S_ISWHT(mode) -> bool Return True if mode is from a whiteout.S_ISPORT(mode) -> bool Return True if mode is from an event port.S_ISDOOR(mode) -> bool Return True if mode is from a door.S_ISSOCK(mode) -> bool Return True if mode is from a socket.S_ISLNK(mode) -> bool Return True if mode is from a symbolic link.S_ISFIFO(mode) -> bool Return True if mode is from a FIFO (named pipe).S_ISREG(mode) -> bool Return True if mode is from a regular file.S_ISBLK(mode) -> bool Return True if mode is from a block special device file.S_ISCHR(mode) -> bool Return True if mode is from a character special device file.S_ISDIR(mode) -> bool Return True if mode is from a directory.S_IFMT_: file type bits S_IFDIR: directory S_IFCHR: character device S_IFBLK: block device S_IFREG: regular file S_IFIFO: fifo (named pipe) S_IFLNK: symbolic link S_IFSOCK: socket file S_IFDOOR: door S_IFPORT: event port S_IFWHT: whiteout S_ISUID: set UID bit S_ISGID: set GID bit S_ENFMT: file locking enforcement S_ISVTX: sticky bit S_IREAD: Unix V7 synonym for S_IRUSR S_IWRITE: Unix V7 synonym for S_IWUSR S_IEXEC: Unix V7 synonym for S_IXUSR S_IRWXU: mask for owner permissions S_IRUSR: read by owner S_IWUSR: write by owner S_IXUSR: execute by owner S_IRWXG: mask for group permissions S_IRGRP: read by group S_IWGRP: write by group S_IXGRP: execute by group S_IRWXO: mask for others (not in group) permissions S_IROTH: read by others S_IWOTH: write by others S_IXOTH: execute by others UF_NODUMP: do not dump file UF_IMMUTABLE: file may not be changed UF_APPEND: file may only be appended to UF_OPAQUE: directory is opaque when viewed through a union stack UF_NOUNLINK: file may not be renamed or deleted UF_COMPRESSED: OS X: file is hfs-compressed UF_HIDDEN: OS X: file should not be displayed SF_ARCHIVED: file may be archived SF_IMMUTABLE: file may not be changed SF_APPEND: file may only be appended to SF_NOUNLINK: file may not be renamed or deleted SF_SNAPSHOT: file is a snapshot file ST_MODE ST_INO ST_DEV ST_NLINK ST_UID ST_GID ST_SIZE ST_ATIME ST_MTIME ST_CTIME FILE_ATTRIBUTE_*: Windows file attribute constants (only present on Windows) call($module, obj, /, *args, **kwargs) -- Same as obj(*args, **kwargs).length_hint($module, obj, default=0, /) -- Return an estimate of the number of items in obj. This is useful for presizing containers when building from an iterable. If the object supports len(), the result will be exact. Otherwise, it may over- or under-estimate by an arbitrary amount. The result will be an integer >= 0._compare_digest($module, a, b, /) -- Return 'a == b'. This function uses an approach designed to prevent timing analysis, making it appropriate for cryptography. a and b must both be of the same type: either str (ASCII only), or any bytes-like object. Note: If a and b are of different lengths, or if an error occurs, a timing attack could theoretically reveal information about the types and lengths of a and b--but not their values.ge($module, a, b, /) -- Same as a >= b.gt($module, a, b, /) -- Same as a > b.le($module, a, b, /) -- Same as a <= b.lt($module, a, b, /) -- Same as a < b.ne($module, a, b, /) -- Same as a != b.eq($module, a, b, /) -- Same as a == b.ipow($module, a, b, /) -- Same as a **= b.pow($module, a, b, /) -- Same as a ** b.delitem($module, a, b, /) -- Same as del a[b].setitem($module, a, b, c, /) -- Same as a[b] = c.getitem($module, a, b, /) -- Same as a[b].iconcat($module, a, b, /) -- Same as a += b, for a and b sequences.concat($module, a, b, /) -- Same as a + b, for a and b sequences.ior($module, a, b, /) -- Same as a |= b.ixor($module, a, b, /) -- Same as a ^= b.iand($module, a, b, /) -- Same as a &= b.irshift($module, a, b, /) -- Same as a >>= b.ilshift($module, a, b, /) -- Same as a <<= b.imod($module, a, b, /) -- Same as a %= b.itruediv($module, a, b, /) -- Same as a /= b.ifloordiv($module, a, b, /) -- Same as a //= b.imatmul($module, a, b, /) -- Same as a @= b.imul($module, a, b, /) -- Same as a *= b.isub($module, a, b, /) -- Same as a -= b.iadd($module, a, b, /) -- Same as a += b.or_($module, a, b, /) -- Same as a | b.xor($module, a, b, /) -- Same as a ^ b.and_($module, a, b, /) -- Same as a & b.not_($module, a, /) -- Same as not a.rshift($module, a, b, /) -- Same as a >> b.lshift($module, a, b, /) -- Same as a << b.invert($module, a, /) -- Same as ~a.inv($module, a, /) -- Same as ~a.abs($module, a, /) -- Same as abs(a).pos($module, a, /) -- Same as +a.neg($module, a, /) -- Same as -a.mod($module, a, b, /) -- Same as a % b.truediv($module, a, b, /) -- Same as a / b.floordiv($module, a, b, /) -- Same as a // b.matmul($module, a, b, /) -- Same as a @ b.mul($module, a, b, /) -- Same as a * b.sub($module, a, b, /) -- Same as a - b.add($module, a, b, /) -- Same as a + b.index($module, a, /) -- Same as a.__index__()is_not($module, a, b, /) -- Same as a is not b.is_($module, a, b, /) -- Same as a is b.countOf($module, a, b, /) -- Return the number of items in a which are, or which equal, b.indexOf($module, a, b, /) -- Return the first index of b in a.contains($module, a, b, /) -- Same as b in a (note reversed operands).truth($module, a, /) -- Return True if a is true, False otherwise.itemgetter(item, /, *items) -- Return a callable object that fetches the given item(s) from its operand. After f = itemgetter(2), the call f(r) returns r[2]. After g = itemgetter(2, 5, 3), the call g(r) returns (r[2], r[5], r[3])attrgetter(attr, /, *attrs) -- Return a callable object that fetches the given attribute(s) from its operand. After f = attrgetter('name'), the call f(r) returns r.name. After g = attrgetter('name', 'date'), the call g(r) returns (r.name, r.date). After h = attrgetter('name.first', 'name.last'), the call h(r) returns (r.name.first, r.name.last).Return state information for picklingmethodcaller(name, /, *args, **kwargs) -- Return a callable object that calls the given method on its operand. After f = methodcaller('name'), the call f(r) returns r.name(). After g = methodcaller('name', 'date', foo=1), the call g(r) returns r.name('date', foo=1).Operator interface. This module exports a set of functions implemented in C corresponding to the intrinsic operators of Python. For example, operator.add(x, y) is equivalent to the expression x+y. The function names are those used for special methods; variants without leading and trailing '__' are also provided for convenience.getencoding($module, /) -- Get the current locale encoding.bind_textdomain_codeset($module, domain, codeset, /) -- Bind the C library's domain to codeset.bindtextdomain($module, domain, dir, /) -- Bind the C library's domain to dir.textdomain($module, domain, /) -- Set the C library's textdmain to domain, returning the new domain.dcgettext($module, domain, msg, category, /) -- Return translation of msg in domain and category.dgettext($module, domain, msg, /) -- dgettext(domain, msg) -> string Return translation of msg in domain.gettext($module, msg, /) -- gettext(msg) -> string Return translation of msg.nl_langinfo($module, key, /) -- Return the value for the locale information associated with key.strxfrm($module, string, /) -- Return a string that can be used as a key for locale-aware comparisons.strcoll($module, os1, os2, /) -- Compares two strings according to the locale.localeconv($module, /) -- Returns numeric and monetary locale-specific parameters.setlocale($module, category, locale=, /) -- Activates/queries locale processing.Support for POSIX locales.partial(func, *args, **keywords) - new function with partial application of the given arguments and keywords. cache_clear($self, /) -- Clear the cache and cache statisticscache_info($self, /) -- Report cache statisticsCreate a cached callable that wraps another function. user_function: the function being cached maxsize: 0 for no caching None for unlimited cache size n for a bounded cache typed: False cache f(3) and f(3.0) as identical calls True cache f(3) and f(3.0) as distinct calls cache_info_type: namedtuple class with the fields: hits misses currsize maxsize Tools that operate on functions.cmp_to_key($module, /, mycmp) -- Convert a cmp= function into a key= function. mycmp Function that compares two objects.reduce(function, iterable[, initial]) -> value Apply a function of two arguments cumulatively to the items of a sequence or iterable, from left to right, so as to reduce the iterable to a single value. For example, reduce(lambda x, y: x+y, [1, 2, 3, 4, 5]) calculates ((((1+2)+3)+4)+5). If initial is present, it is placed before the items of the iterable in the calculation, and serves as a default when the iterable is empty.Internal state held by ABC machinery._abc_subclasscheck($module, self, subclass, /) -- Internal ABC helper for subclasss checks. Should be never used outside abc module._abc_instancecheck($module, self, instance, /) -- Internal ABC helper for instance checks. Should be never used outside abc module._abc_register($module, self, subclass, /) -- Internal ABC helper for subclasss registration. Should be never used outside abc module._get_dump($module, self, /) -- Internal ABC helper for cache and registry debugging. Return shallow copies of registry, of both caches, and negative cache version. Don't call this function directly, instead use ABC._dump_registry() for a nice repr._reset_caches($module, self, /) -- Internal ABC helper to reset both caches of a given class. Should be only used by refleak.py_reset_registry($module, self, /) -- Internal ABC helper to reset registry of a given class. Should be only used by refleak.py_abc_init($module, self, /) -- Internal ABC helper for class set-up. Should be never used outside abc module.get_cache_token($module, /) -- Returns the current ABC cache token. The token is an opaque object (supporting equality testing) identifying the current version of the ABC cache for virtual subclasses. The token changes with every call to register() on any ABC.Module contains faster C implementation of abc.ABCMetaproxy($module, object, callback=None, /) -- Create a proxy object that weakly references 'object'. 'callback', if given, is called with a reference to the proxy when 'object' is about to be finalized.getweakrefs($module, object, /) -- Return a list of all weak reference objects pointing to 'object'._remove_dead_weakref($module, dct, key, /) -- Atomically remove key from dict if it points to a dead weakref.getweakrefcount($module, object, /) -- Return the number of weak references to 'object'._idfunc($module, x, /) -- Accelerators for the typing module. get_clock_info(name: str) -> dict Get information of the specified clock.perf_counter_ns() -> int Performance counter for benchmarking as nanoseconds.perf_counter() -> float Performance counter for benchmarking.thread_time() -> int Thread time for profiling as nanoseconds: sum of the kernel and user-space CPU time.thread_time() -> float Thread time for profiling: sum of the kernel and user-space CPU time.process_time() -> int Process time for profiling as nanoseconds: sum of the kernel and user-space CPU time.process_time() -> float Process time for profiling: sum of the kernel and user-space CPU time.monotonic_ns() -> int Monotonic clock, cannot go backward, as nanoseconds.monotonic() -> float Monotonic clock, cannot go backward.tzset() Initialize, or reinitialize, the local timezone to the value stored in os.environ['TZ']. The TZ environment variable should be specified in standard Unix timezone format as documented in the tzset man page (eg. 'US/Eastern', 'Europe/Amsterdam'). Unknown timezones will silently fall back to UTC. If the TZ environment variable is not set, the local timezone is set to the systems best guess of wallclock time. Changing the TZ environment variable without calling tzset *may* change the local timezone used by methods such as localtime, but this behaviour should not be relied on.strptime(string, format) -> struct_time Parse a string to a time tuple according to a format specification. See the library reference manual for formatting codes (same as strftime()). Commonly used format codes: %Y Year with century as a decimal number. %m Month as a decimal number [01,12]. %d Day of the month as a decimal number [01,31]. %H Hour (24-hour clock) as a decimal number [00,23]. %M Minute as a decimal number [00,59]. %S Second as a decimal number [00,61]. %z Time zone offset from UTC. %a Locale's abbreviated weekday name. %A Locale's full weekday name. %b Locale's abbreviated month name. %B Locale's full month name. %c Locale's appropriate date and time representation. %I Hour (12-hour clock) as a decimal number [01,12]. %p Locale's equivalent of either AM or PM. Other codes may be available on your platform. See documentation for the C library strftime function. strftime(format[, tuple]) -> string Convert a time tuple to a string according to a format specification. See the library reference manual for formatting codes. When the time tuple is not present, current time as returned by localtime() is used. Commonly used format codes: %Y Year with century as a decimal number. %m Month as a decimal number [01,12]. %d Day of the month as a decimal number [01,31]. %H Hour (24-hour clock) as a decimal number [00,23]. %M Minute as a decimal number [00,59]. %S Second as a decimal number [00,61]. %z Time zone offset from UTC. %a Locale's abbreviated weekday name. %A Locale's full weekday name. %b Locale's abbreviated month name. %B Locale's full month name. %c Locale's appropriate date and time representation. %I Hour (12-hour clock) as a decimal number [01,12]. %p Locale's equivalent of either AM or PM. Other codes may be available on your platform. See documentation for the C library strftime function. mktime(tuple) -> floating-point number Convert a time tuple in local time to seconds since the Epoch. Note that mktime(gmtime(0)) will not generally return zero for most time zones; instead the returned value will either be equal to that of the timezone or altzone attributes on the time module.ctime(seconds) -> string Convert a time in seconds since the Epoch to a string in local time. This is equivalent to asctime(localtime(seconds)). When the time tuple is not present, current time as returned by localtime() is used.asctime([tuple]) -> string Convert a time tuple to a string, e.g. 'Sat Jun 06 16:26:11 1998'. When the time tuple is not present, current time as returned by localtime() is used.localtime([seconds]) -> (tm_year,tm_mon,tm_mday,tm_hour,tm_min, tm_sec,tm_wday,tm_yday,tm_isdst) Convert seconds since the Epoch to a time tuple expressing local time. When 'seconds' is not passed in, convert the current time instead.gmtime([seconds]) -> (tm_year, tm_mon, tm_mday, tm_hour, tm_min, tm_sec, tm_wday, tm_yday, tm_isdst) Convert seconds since the Epoch to a time tuple expressing UTC (a.k.a. GMT). When 'seconds' is not passed in, convert the current time instead. If the platform supports the tm_gmtoff and tm_zone, they are available as attributes only.sleep(seconds) Delay execution for a given number of seconds. The argument may be a floating-point number for subsecond precision.pthread_getcpuclockid(thread_id) -> int Return the clk_id of a thread's CPU time clock.clock_getres(clk_id) -> floating-point number Return the resolution (precision) of the specified clock clk_id.clock_settime_ns(clk_id, time) Set the time of the specified clock clk_id with nanoseconds.clock_settime(clk_id, time) Set the time of the specified clock clk_id.clock_gettime_ns(clk_id) -> int Return the time of the specified clock clk_id as nanoseconds.clock_gettime(clk_id) -> float Return the time of the specified clock clk_id.time_ns() -> int Return the current time in nanoseconds since the Epoch.time() -> floating-point number Return the current time in seconds since the Epoch. Fractions of a second may be present if the system clock provides them.This module provides various functions to manipulate time values. There are two standard representations of time. One is the number of seconds since the Epoch, in UTC (a.k.a. GMT). It may be an integer or a floating-point number (to represent fractions of seconds). The epoch is the point where the time starts, the return value of time.gmtime(0). It is January 1, 1970, 00:00:00 (UTC) on all platforms. The other representation is a tuple of 9 integers giving local time. The tuple items are: year (including century, e.g. 1998) month (1-12) day (1-31) hours (0-23) minutes (0-59) seconds (0-59) weekday (0-6, Monday is 0) Julian day (day in the year, 1-366) DST (Daylight Savings Time) flag (-1, 0 or 1) If the DST flag is 0, the time is given in the regular time zone; if it is 1, the time is given in the DST time zone; if it is -1, mktime() should guess based on the date and time. locked() -> bool (locked_lock() is an obsolete synonym) Return whether the lock is in the locked state.release() (release_lock() is an obsolete synonym) Release the lock, allowing another thread that is blocked waiting for the lock to acquire the lock. The lock must be in the locked state, but it needn't be locked by the same thread that unlocks it.acquire(blocking=True, timeout=-1) -> bool (acquire_lock() is an obsolete synonym) Lock the lock. Without argument, this blocks if the lock is already locked (even by the same thread), waiting for another thread to release the lock, and return True once the lock is acquired. With an argument, this will only block if the argument is true, and the return value reflects whether the lock is acquired. The blocking operation is interruptible.A lock object is a synchronization primitive. To create a lock, call threading.Lock(). Methods are: acquire() -- lock the lock, possibly blocking until it can be obtained release() -- unlock of the lock locked() -- test whether the lock is currently locked A lock is not owned by the thread that locked it; another thread may unlock it. A thread attempting to lock a lock that it has already locked will block until another thread unlocks it. Deadlocks may ensue._recursion_count() -> int For internal use by reentrancy checks._release_save() -> tuple For internal use by `threading.Condition`._acquire_restore(state) -> None For internal use by `threading.Condition`._is_owned() -> bool For internal use by `threading.Condition`.release() Release the lock, allowing another thread that is blocked waiting for the lock to acquire the lock. The lock must be in the locked state, and must be locked by the same thread that unlocks it; otherwise a `RuntimeError` is raised. Do note that if the lock was acquire()d several times in a row by the current thread, release() needs to be called as many times for the lock to be available for other threads.acquire(blocking=True) -> bool Lock the lock. `blocking` indicates whether we should wait for the lock to be available or not. If `blocking` is False and another thread holds the lock, the method will return False immediately. If `blocking` is True and another thread holds the lock, the method will wait for the lock to be released, take it and then return True. (note: the blocking operation is interruptible.) In all other cases, the method will return True immediately. Precisely, if the current thread already holds the lock, its internal counter is simply incremented. If nobody holds the lock, the lock is taken and its internal counter initialized to 1.ExceptHookArgs Type used to pass arguments to threading.excepthook._is_main_interpreter() Return True if the current interpreter is the main Python interpreter.excepthook(exc_type, exc_value, exc_traceback, thread) Handle uncaught Thread.run() exception._set_sentinel() -> lock Set a sentinel lock that will be released when the current thread state is finalized (after it is untied from the interpreter). This is a private API for the threading module.stack_size([size]) -> size Return the thread stack size used when creating new threads. The optional size argument specifies the stack size (in bytes) to be used for subsequently created threads, and must be 0 (use platform or configured default) or a positive integer value of at least 32,768 (32k). If changing the thread stack size is unsupported, a ThreadError exception is raised. If the specified size is invalid, a ValueError exception is raised, and the stack size is unmodified. 32k bytes currently the minimum supported stack size value to guarantee sufficient stack space for the interpreter itself. Note that some platforms may have particular restrictions on values for the stack size, such as requiring a minimum stack size larger than 32 KiB or requiring allocation in multiples of the system memory page size - platform documentation should be referred to for more information (4 KiB pages are common; using multiples of 4096 for the stack size is the suggested approach in the absence of more specific information)._count() -> integer Return the number of currently running Python threads, excluding the main thread. The returned number comprises all threads created through `start_new_thread()` as well as `threading.Thread`, and not yet finished. This function is meant for internal and specialized purposes only. In most applications `threading.enumerate()` should be used instead.get_native_id() -> integer Return a non-negative integer identifying the thread as reported by the OS (kernel). This may be used to uniquely identify a particular thread within a system.get_ident() -> integer Return a non-zero integer that uniquely identifies the current thread amongst other threads that exist simultaneously. This may be used to identify per-thread resources. Even though on some platforms threads identities may appear to be allocated consecutive numbers starting at 1, this behavior should not be relied upon, and the number should be seen purely as a magic cookie. A thread's identity may be reused for another thread after it exits.interrupt_main(signum=signal.SIGINT, /) Simulate the arrival of the given signal in the main thread, where the corresponding signal handler will be executed. If *signum* is omitted, SIGINT is assumed. A subthread can use this function to interrupt the main thread. Note: the default signal handler for SIGINT raises ``KeyboardInterrupt``.exit() (exit_thread() is an obsolete synonym) This is synonymous to ``raise SystemExit''. It will cause the current thread to exit silently unless the exception is caught.allocate_lock() -> lock object (allocate() is an obsolete synonym) Create a new lock object. See help(type(threading.Lock())) for information about locks.daemon_threads_allowed() Return True if daemon threads are allowed in the current interpreter, and False otherwise. start_new_thread(function, args[, kwargs]) (start_new() is an obsolete synonym) Start a new thread and return its identifier. The thread will call the function with positional arguments from the tuple args and keyword arguments taken from the optional dictionary kwargs. The thread exits when the function returns; the return value is ignored. The thread will also exit when the function raises an unhandled exception; a stack trace will be printed unless the exception is SystemExit. This module provides primitive operations to write multi-threaded programs. The 'threading' module provides a more convenient interface.__deepcopy__($self, memo, /) -- __copy__($self, /) -- scanner($self, /, string, pos=0, endpos=sys.maxsize) -- finditer($self, /, string, pos=0, endpos=sys.maxsize) -- Return an iterator over all non-overlapping matches for the RE pattern in string. For each match, the iterator returns a match object.split($self, /, string, maxsplit=0) -- Split string by the occurrences of pattern.findall($self, /, string, pos=0, endpos=sys.maxsize) -- Return a list of all non-overlapping matches of pattern in string.subn($self, /, repl, string, count=0) -- Return the tuple (new_string, number_of_subs_made) found by replacing the leftmost non-overlapping occurrences of pattern with the replacement repl.sub($self, /, repl, string, count=0) -- Return the string obtained by replacing the leftmost non-overlapping occurrences of pattern in string by the replacement repl.search($self, /, string, pos=0, endpos=sys.maxsize) -- Scan through string looking for a match, and return a corresponding match object instance. Return None if no position in the string matches.fullmatch($self, /, string, pos=0, endpos=sys.maxsize) -- Matches against all of the string.match($self, /, string, pos=0, endpos=sys.maxsize) -- Matches zero or more characters at the beginning of the string.Compiled regular expression object.__deepcopy__($self, memo, /) -- __copy__($self, /) -- expand($self, /, template) -- Return the string obtained by doing backslash substitution on the string template, as done by the sub() method.groupdict($self, /, default=None) -- Return a dictionary containing all the named subgroups of the match, keyed by the subgroup name. default Is used for groups that did not participate in the match.groups($self, /, default=None) -- Return a tuple containing all the subgroups of the match, from 1. default Is used for groups that did not participate in the match.span($self, group=0, /) -- For match object m, return the 2-tuple (m.start(group), m.end(group)).end($self, group=0, /) -- Return index of the end of the substring matched by group.start($self, group=0, /) -- Return index of the start of the substring matched by group.group([group1, ...]) -> str or tuple. Return subgroup(s) of the match by indices or names. For 0 returns the entire match.The result of re.match() and re.search(). Match objects always have a boolean value of True.search($self, /) -- match($self, /) -- unicode_tolower($module, character, /) -- ascii_tolower($module, character, /) -- unicode_iscased($module, character, /) -- ascii_iscased($module, character, /) -- getcodesize($module, /) -- template($module, pattern, template, /) -- template A list containing interleaved literal strings (str or bytes) and group indices (int), as returned by re._parser.parse_template(): [literal1, group1, ..., literalN, groupN]compile($module, /, pattern, flags, code, groups, groupindex, indexgroup) -- batched(iterable, n) -- Batch data into tuples of length n. The last batch may be shorter than n. Loops over the input iterable and accumulates data into tuples up to size n. The input is consumed lazily, just enough to fill a batch. The result is yielded as soon as a batch is full or when the input iterable is exhausted. >>> for batch in batched('ABCDEFG', 3): ... print(batch) ... ('A', 'B', 'C') ('D', 'E', 'F') ('G',)pairwise(iterable, /) -- Return an iterator of overlapping pairs taken from the input iterator. s -> (s0,s1), (s1,s2), (s2, s3), ...groupby(iterable, key=None) -- make an iterator that returns consecutive keys and groups from the iterable iterable Elements to divide into groups according to the key function. key A function for computing the group category for each element. If the key function is not specified or is None, the element itself is used for grouping.teedataobject(iterable, values, next, /) -- Data container common to multiple tee objects.Returns an independent iterator._tee(iterable, /) -- Iterator wrapped to make it copyable.cycle(iterable, /) -- Return elements from the iterable until it is exhausted. Then repeat the sequence indefinitely.dropwhile(predicate, iterable, /) -- Drop items from the iterable while predicate(item) is true. Afterwards, return every element until the iterable is exhausted.takewhile(predicate, iterable, /) -- Return successive entries from an iterable as long as the predicate evaluates to true for each entry.islice(iterable, stop) --> islice object islice(iterable, start, stop[, step]) --> islice object Return an iterator whose next() method returns selected values from an iterable. If start is specified, will skip all preceding elements; otherwise, start defaults to zero. Step defaults to one. If specified as another value, step determines how many values are skipped between successive calls. Works like a slice() on a list but returns an iterator.starmap(function, iterable, /) -- Return an iterator whose values are returned from the function evaluated with an argument tuple taken from the given sequence.from_iterable($type, iterable, /) -- Alternative chain() constructor taking a single iterable argument that evaluates lazily.chain(*iterables) --> chain object Return a chain object whose .__next__() method returns elements from the first iterable until it is exhausted, then elements from the next iterable, until all of the iterables are exhausted.product(*iterables, repeat=1) --> product object Cartesian product of input iterables. Equivalent to nested for-loops. For example, product(A, B) returns the same as: ((x,y) for x in A for y in B). The leftmost iterators are in the outermost for-loop, so the output tuples cycle in a manner similar to an odometer (with the rightmost element changing on every iteration). To compute the product of an iterable with itself, specify the number of repetitions with the optional repeat keyword argument. For example, product(A, repeat=4) means the same as product(A, A, A, A). product('ab', range(3)) --> ('a',0) ('a',1) ('a',2) ('b',0) ('b',1) ('b',2) product((0,1), (0,1), (0,1)) --> (0,0,0) (0,0,1) (0,1,0) (0,1,1) (1,0,0) ...combinations(iterable, r) -- Return successive r-length combinations of elements in the iterable. combinations(range(4), 3) --> (0,1,2), (0,1,3), (0,2,3), (1,2,3)combinations_with_replacement(iterable, r) -- Return successive r-length combinations of elements in the iterable allowing individual elements to have successive repeats. combinations_with_replacement('ABC', 2) --> ('A','A'), ('A','B'), ('A','C'), ('B','B'), ('B','C'), ('C','C')Returns size in memory, in bytes.permutations(iterable, r=None) -- Return successive r-length permutations of elements in the iterable. permutations(range(3), 2) --> (0,1), (0,2), (1,0), (1,2), (2,0), (2,1)accumulate(iterable, func=None, *, initial=None) -- Return series of accumulated sums (or other binary function results).compress(data, selectors) -- Return data elements corresponding to true selector elements. Forms a shorter iterator from selected data elements using the selectors to choose the data elements.filterfalse(function, iterable, /) -- Return those items of iterable for which function(item) is false. If function is None, return the items that are false.count(start=0, step=1) -- Return a count object whose .__next__() method returns consecutive values. Equivalent to: def count(firstval=0, step=1): x = firstval while 1: yield x x += stepPrivate method returning an estimate of len(list(it)).repeat(object [,times]) -> create an iterator which returns the object for the specified number of times. If not specified, returns the object endlessly.Set state information for unpickling.Return state information for pickling.zip_longest(iter1 [,iter2 [...]], [fillvalue=None]) --> zip_longest object Return a zip_longest object whose .__next__() method returns a tuple where the i-th element comes from the i-th iterable argument. The .__next__() method continues until the longest iterable in the argument sequence is exhausted and then it raises StopIteration. When the shorter iterables are exhausted, the fillvalue is substituted in their place. The fillvalue defaults to None or can be specified by a keyword argument. Functional tools for creating and using iterators. Infinite iterators: count(start=0, step=1) --> start, start+step, start+2*step, ... cycle(p) --> p0, p1, ... plast, p0, p1, ... repeat(elem [,n]) --> elem, elem, elem, ... endlessly or up to n times Iterators terminating on the shortest input sequence: accumulate(p[, func]) --> p0, p0+p1, p0+p1+p2 batched(p, n) --> [p0, p1, ..., p_n-1], [p_n, p_n+1, ..., p_2n-1], ... chain(p, q, ...) --> p0, p1, ... plast, q0, q1, ... chain.from_iterable([p, q, ...]) --> p0, p1, ... plast, q0, q1, ... compress(data, selectors) --> (d[0] if s[0]), (d[1] if s[1]), ... dropwhile(predicate, seq) --> seq[n], seq[n+1], starting when predicate fails groupby(iterable[, keyfunc]) --> sub-iterators grouped by value of keyfunc(v) filterfalse(predicate, seq) --> elements of seq where predicate(elem) is False islice(seq, [start,] stop [, step]) --> elements from seq[start:stop:step] pairwise(s) --> (s[0],s[1]), (s[1],s[2]), (s[2], s[3]), ... starmap(fun, seq) --> fun(*seq[0]), fun(*seq[1]), ... tee(it, n=2) --> (it1, it2 , ... itn) splits one iterator into n takewhile(predicate, seq) --> seq[0], seq[1], until predicate fails zip_longest(p, q, ...) --> (p[0], q[0]), (p[1], q[1]), ... Combinatoric generators: product(p, q, ... [repeat=1]) --> cartesian product permutations(p[, r]) combinations(p, r) combinations_with_replacement(p, r) tee($module, iterable, n=2, /) -- Returns a tuple of n independent iterators.writable($self, /) -- Returns True if the IO object can be written.readable($self, /) -- Returns True if the IO object can be read.seekable($self, /) -- Returns True if the IO object can be seeked.write($self, s, /) -- Write string to file. Returns the number of characters written, which is always equal to the length of the string.seek($self, pos, whence=0, /) -- Change stream position. Seek to character offset pos relative to position indicated by whence: 0 Start of stream (the default). pos should be >= 0; 1 Current position - pos must be 0; 2 End of stream - pos must be 0. Returns the new absolute position.truncate($self, pos=None, /) -- Truncate size to pos. The pos argument defaults to the current file position, as returned by tell(). The current file position is unchanged. Returns the new absolute position.tell($self, /) -- Tell the current file position.readline($self, size=-1, /) -- Read until newline or EOF. Returns an empty string if EOF is hit immediately.read($self, size=-1, /) -- Read at most size characters, returned as a string. If the argument is negative or omitted, read until EOF is reached. Return an empty string at EOF.getvalue($self, /) -- Retrieve the entire contents of the object.close($self, /) -- Close the IO object. Attempting any further operation after the object is closed will raise a ValueError. This method has no effect if the file is already closed.StringIO(initial_value='', newline='\n') -- Text I/O implementation using an in-memory buffer. The initial_value argument sets the value of object. The newline argument is like the one of TextIOWrapper's constructor.write($self, s, /) -- Write string s to stream. Return the number of characters written (which is always equal to the length of the string).readline($self, size=-1, /) -- Read until newline or EOF. Return an empty string if EOF is hit immediately. If size is specified, at most size characters will be read.read($self, size=-1, /) -- Read at most size characters from stream. Read from underlying buffer until we have size characters or we hit EOF. If size is negative or omitted, read until EOF.detach($self, /) -- Separate the underlying buffer from the TextIOBase and return it. After the underlying buffer has been detached, the TextIO is in an unusable state.The error setting of the decoder or encoder. Subclasses should override. Line endings translated so far. Only line endings translated during reading are considered. Subclasses should override. Encoding of the text stream. Subclasses should override. Base class for text I/O. This class provides a character and line based interface to stream I/O. There is no readinto method because Python's character strings are immutable. reset($self, /) -- setstate($self, state, /) -- getstate($self, /) -- decode($self, /, input, final=False) -- IncrementalNewlineDecoder(decoder, translate, errors='strict') -- Codec used when reading a file in universal newlines mode. It wraps another incremental decoder, translating \r\n and \r into \n. It also records the types of newlines encountered. When used with translate=False, it ensures that the newline sequence is returned in one piece. When used with decoder=None, it expects unicode strings as decode input and translates newlines without first invoking an external decoder.truncate($self, pos=None, /) -- tell($self, /) -- Return the stream position as an opaque number. The return value of tell() can be given as input to seek(), to restore a previous stream position.seek($self, cookie, whence=os.SEEK_SET, /) -- Set the stream position, and return the new stream position. cookie Zero or an opaque number returned by tell(). whence The relative position to seek from. Four operations are supported, given by the following argument combinations: - seek(0, SEEK_SET): Rewind to the start of the stream. - seek(cookie, SEEK_SET): Restore a previous position; 'cookie' must be a number returned by tell(). - seek(0, SEEK_END): Fast-forward to the end of the stream. - seek(0, SEEK_CUR): Leave the current stream position unchanged. Any other argument combinations are invalid, and may raise exceptions.isatty($self, /) -- writable($self, /) -- readable($self, /) -- seekable($self, /) -- fileno($self, /) -- close($self, /) -- flush($self, /) -- readline($self, size=-1, /) -- read($self, size=-1, /) -- write($self, text, /) -- reconfigure($self, /, *, encoding=None, errors=None, newline=None, line_buffering=None, write_through=None) -- Reconfigure the text stream with new parameters. This also does an implicit stream flush.detach($self, /) -- TextIOWrapper(buffer, encoding=None, errors=None, newline=None, line_buffering=False, write_through=False) -- Character and line based layer over a BufferedIOBase object, buffer. encoding gives the name of the encoding that the stream will be decoded or encoded with. It defaults to locale.getencoding(). errors determines the strictness of encoding and decoding (see help(codecs.Codec) or the documentation for codecs.register) and defaults to "strict". newline controls how line endings are handled. It can be None, '', '\n', '\r', and '\r\n'. It works as follows: * On input, if newline is None, universal newlines mode is enabled. Lines in the input can end in '\n', '\r', or '\r\n', and these are translated into '\n' before being returned to the caller. If it is '', universal newline mode is enabled, but line endings are returned to the caller untranslated. If it has any of the other legal values, input lines are only terminated by the given string, and the line ending is returned to the caller untranslated. * On output, if newline is None, any '\n' characters written are translated to the system default line separator, os.linesep. If newline is '' or '\n', no translation takes place. If newline is any of the other legal values, any '\n' characters written are translated to the given string. If line_buffering is True, a call to flush is implied when a call to write contains a newline character.write($self, b, /) -- Write buffer b to the IO stream. Return the number of bytes written, which is always the length of b in bytes. Raise BlockingIOError if the buffer is full and the underlying raw stream cannot accept more data at the moment.readinto1($self, buffer, /) -- readinto($self, buffer, /) -- read1($self, size=-1, /) -- Read and return up to size bytes, with at most one read() call to the underlying raw stream. Return an empty bytes object on EOF. A short result does not imply that EOF is imminent.read($self, size=-1, /) -- Read and return up to n bytes. If the size argument is omitted, None, or negative, read and return all data until EOF. If the size argument is positive, and the underlying raw stream is not 'interactive', multiple raw reads may be issued to satisfy the byte count (unless EOF is reached first). However, for interactive raw streams (as well as sockets and pipes), at most one raw read will be issued, and a short result does not imply that EOF is imminent. Return an empty bytes object on EOF. Return None if the underlying raw stream was open in non-blocking mode and no data is available at the moment.detach($self, /) -- Disconnect this buffer from its underlying raw stream and return it. After the raw stream has been detached, the buffer is in an unusable state.Base class for buffered IO objects. The main difference with RawIOBase is that the read() method supports omitting the size argument, and does not have a default implementation that defers to readinto(). In addition, read(), readinto() and write() may raise BlockingIOError if the underlying raw stream is in non-blocking mode and not ready; unlike their raw counterparts, they will never return None. A typical implementation should not inherit from a RawIOBase implementation, but wrap one. flush($self, /) -- BufferedReader(raw, buffer_size=DEFAULT_BUFFER_SIZE) -- Create a new buffered reader using the given readable raw IO object.BufferedWriter(raw, buffer_size=DEFAULT_BUFFER_SIZE) -- A buffer for a writeable sequential RawIO object. The constructor creates a BufferedWriter for the given writeable raw stream. If the buffer_size is not given, it defaults to DEFAULT_BUFFER_SIZE.BufferedRWPair(reader, writer, buffer_size=DEFAULT_BUFFER_SIZE, /) -- A buffered reader and writer object together. A buffered reader object and buffered writer object put together to form a sequential IO object that can read and write. This is typically used with a socket or two-way pipe. reader and writer are RawIOBase objects that are readable and writeable respectively. If the buffer_size is omitted it defaults to DEFAULT_BUFFER_SIZE.__sizeof__($self, /) -- write($self, buffer, /) -- peek($self, size=0, /) -- readline($self, size=-1, /) -- readinto1($self, buffer, /) -- readinto($self, buffer, /) -- read1($self, size=-1, /) -- read($self, size=-1, /) -- truncate($self, pos=None, /) -- tell($self, /) -- seek($self, target, whence=0, /) -- flush($self, /) -- _dealloc_warn($self, source, /) -- isatty($self, /) -- fileno($self, /) -- writable($self, /) -- readable($self, /) -- seekable($self, /) -- detach($self, /) -- close($self, /) -- BufferedRandom(raw, buffer_size=DEFAULT_BUFFER_SIZE) -- A buffered interface to random access streams. The constructor creates a reader and writer for a seekable stream, raw, given in the first argument. If the buffer_size is omitted it defaults to DEFAULT_BUFFER_SIZE.truncate($self, size=None, /) -- Truncate the file to at most size bytes. Size defaults to the current file position, as returned by tell(). The current file position is unchanged. Returns the new size.seek($self, pos, whence=0, /) -- Change stream position. Seek to byte offset pos relative to position indicated by whence: 0 Start of stream (the default). pos should be >= 0; 1 Current position - pos may be negative; 2 End of stream - pos usually negative. Returns the new absolute position.getvalue($self, /) -- Retrieve the entire contents of the BytesIO object.getbuffer($self, /) -- Get a read-write view over the contents of the BytesIO object.read($self, size=-1, /) -- Read at most size bytes, returned as a bytes object. If the size argument is negative, read until EOF is reached. Return an empty bytes object at EOF.readlines($self, size=None, /) -- List of bytes objects, each a line from the file. Call readline() repeatedly and return a list of the lines so read. The optional size argument, if given, is an approximate bound on the total number of bytes in the lines returned.readline($self, size=-1, /) -- Next line from the file, as a bytes object. Retain newline. A non-negative size argument limits the maximum number of bytes to return (an incomplete line may be returned then). Return an empty bytes object at EOF.readinto($self, buffer, /) -- Read bytes into buffer. Returns number of bytes read (0 for EOF), or None if the object is set not to block and has no data to read.read1($self, size=-1, /) -- Read at most size bytes, returned as a bytes object. If the size argument is negative or omitted, read until EOF is reached. Return an empty bytes object at EOF.writelines($self, lines, /) -- Write lines to the file. Note that newlines are not added. lines can be any iterable object producing bytes-like objects. This is equivalent to calling write() for each element.write($self, b, /) -- Write bytes to file. Return the number of bytes written.tell($self, /) -- Current file position, an integer.isatty($self, /) -- Always returns False. BytesIO objects are not connected to a TTY-like device.flush($self, /) -- Does nothing.close($self, /) -- Disable all I/O operations.writable($self, /) -- Returns True if the IO object can be written.seekable($self, /) -- Returns True if the IO object can be seeked.readable($self, /) -- Returns True if the IO object can be read.BytesIO(initial_bytes=b'') -- Buffered I/O implementation using an in-memory bytes buffer.isatty($self, /) -- True if the file is connected to a TTY device.fileno($self, /) -- Return the underlying file descriptor (an integer).writable($self, /) -- True if file was opened in a write mode.readable($self, /) -- True if file was opened in a read mode.seekable($self, /) -- True if file supports random-access.close($self, /) -- Close the file. A closed file cannot be used for further I/O operations. close() may be called more than once without error.truncate($self, size=None, /) -- Truncate the file to at most size bytes and return the truncated size. Size defaults to the current file position, as returned by tell(). The current file position is changed to the value of size.tell($self, /) -- Current file position. Can raise OSError for non seekable files.seek($self, pos, whence=0, /) -- Move to new file position and return the file position. Argument offset is a byte count. Optional argument whence defaults to SEEK_SET or 0 (offset from start of file, offset should be >= 0); other values are SEEK_CUR or 1 (move relative to current position, positive or negative), and SEEK_END or 2 (move relative to end of file, usually negative, although many platforms allow seeking beyond the end of a file). Note that not all file objects are seekable.write($self, b, /) -- Write buffer b to file, return number of bytes written. Only makes one system call, so not all of the data may be written. The number of bytes actually written is returned. In non-blocking mode, returns None if the write would block.readinto($self, buffer, /) -- Same as RawIOBase.readinto().readall($self, /) -- Read all data from the file, returned as bytes. In non-blocking mode, returns as much as is immediately available, or None if no data is available. Return an empty bytes object at EOF.read($self, size=-1, /) -- Read at most size bytes, returned as bytes. Only makes one system call, so less data may be returned than requested. In non-blocking mode, returns None if no data is available. Return an empty bytes object at EOF.FileIO(file, mode='r', closefd=True, opener=None) -- Open a file. The mode can be 'r' (default), 'w', 'x' or 'a' for reading, writing, exclusive creation or appending. The file will be created if it doesn't exist when opened for writing or appending; it will be truncated when opened for writing. A FileExistsError will be raised if it already exists when opened for creating. Opening a file for creating implies writing so this mode behaves in a similar way to 'w'.Add a '+' to the mode to allow simultaneous reading and writing. A custom opener can be used by passing a callable as *opener*. The underlying file descriptor for the file object is then obtained by calling opener with (*name*, *flags*). *opener* must return an open file descriptor (passing os.open as *opener* results in functionality similar to passing None).writelines($self, lines, /) -- Write a list of lines to stream. Line separators are not added, so it is usual for each of the lines provided to have a line separator at the end.readlines($self, hint=-1, /) -- Return a list of lines from the stream. hint can be specified to control the number of lines read: no more lines will be read if the total size (in bytes/characters) of all lines so far exceeds hint.readline($self, size=-1, /) -- Read and return a line from the stream. If size is specified, at most size bytes will be read. The line terminator is always b'\n' for binary files; for text files, the newlines argument to open can be used to select the line terminator(s) recognized.isatty($self, /) -- Return whether this is an 'interactive' stream. Return False if it can't be determined.fileno($self, /) -- Return underlying file descriptor if one exists. Raise OSError if the IO object does not use a file descriptor.writable($self, /) -- Return whether object was opened for writing. If False, write() will raise OSError.readable($self, /) -- Return whether object was opened for reading. If False, read() will raise OSError.seekable($self, /) -- Return whether object supports random access. If False, seek(), tell() and truncate() will raise OSError. This method may need to do a test seek().close($self, /) -- Flush and close the IO object. This method has no effect if the file is already closed.flush($self, /) -- Flush write buffers, if applicable. This is not implemented for read-only and non-blocking streams.truncate($self, size=None, /) -- Truncate file to size bytes. File pointer is left unchanged. Size defaults to the current IO position as reported by tell(). Return the new size.tell($self, /) -- Return current stream position.seek($self, offset, whence=os.SEEK_SET, /) -- Change the stream position to the given byte offset. offset The stream position, relative to 'whence'. whence The relative position to seek from. The offset is interpreted relative to the position indicated by whence. Values for whence are: * os.SEEK_SET or 0 -- start of stream (the default); offset should be zero or positive * os.SEEK_CUR or 1 -- current stream position; offset may be negative * os.SEEK_END or 2 -- end of stream; offset is usually negative Return the new absolute position.The abstract base class for all I/O classes. This class provides dummy implementations for many methods that derived classes can override selectively; the default implementations represent a file that cannot be read, written or seeked. Even though IOBase does not declare read, readinto, or write because their signatures will vary, implementations and clients should consider those methods part of the interface. Also, implementations may raise UnsupportedOperation when operations they do not support are called. The basic type used for binary data read from or written to a file is bytes. Other bytes-like objects are accepted as method arguments too. In some cases (such as readinto), a writable object is required. Text I/O classes work with str data. Note that calling any method (except additional calls to close(), which are ignored) on a closed stream should raise a ValueError. IOBase (and its subclasses) support the iterator protocol, meaning that an IOBase object can be iterated over yielding the lines in a stream. IOBase also supports the :keyword:`with` statement. In this example, fp is closed after the suite of the with statement is complete: with open('spam.txt', 'r') as fp: fp.write('Spam and eggs!') readall($self, /) -- Read until EOF, using multiple read() call.read($self, size=-1, /) -- Base class for raw binary I/O.open_code($module, /, path) -- Opens the provided file with the intent to import the contents. This may perform extra validation beyond open(), but is otherwise interchangeable with calling open(path, 'rb').text_encoding($module, encoding, stacklevel=2, /) -- A helper function to choose the text encoding. When encoding is not None, this function returns it. Otherwise, this function returns the default text encoding (i.e. "locale" or "utf-8" depends on UTF-8 mode). This function emits an EncodingWarning if encoding is None and sys.flags.warn_default_encoding is true. This can be used in APIs with an encoding=None parameter. However, please consider using encoding="utf-8" for new APIs.open($module, /, file, mode='r', buffering=-1, encoding=None, errors=None, newline=None, closefd=True, opener=None) -- Open file and return a stream. Raise OSError upon failure. file is either a text or byte string giving the name (and the path if the file isn't in the current working directory) of the file to be opened or an integer file descriptor of the file to be wrapped. (If a file descriptor is given, it is closed when the returned I/O object is closed, unless closefd is set to False.) mode is an optional string that specifies the mode in which the file is opened. It defaults to 'r' which means open for reading in text mode. Other common values are 'w' for writing (truncating the file if it already exists), 'x' for creating and writing to a new file, and 'a' for appending (which on some Unix systems, means that all writes append to the end of the file regardless of the current seek position). In text mode, if encoding is not specified the encoding used is platform dependent: locale.getencoding() is called to get the current locale encoding. (For reading and writing raw bytes use binary mode and leave encoding unspecified.) The available modes are: ========= =============================================================== Character Meaning --------- --------------------------------------------------------------- 'r' open for reading (default) 'w' open for writing, truncating the file first 'x' create a new file and open it for writing 'a' open for writing, appending to the end of the file if it exists 'b' binary mode 't' text mode (default) '+' open a disk file for updating (reading and writing) ========= =============================================================== The default mode is 'rt' (open for reading text). For binary random access, the mode 'w+b' opens and truncates the file to 0 bytes, while 'r+b' opens the file without truncation. The 'x' mode implies 'w' and raises an `FileExistsError` if the file already exists. Python distinguishes between files opened in binary and text modes, even when the underlying operating system doesn't. Files opened in binary mode (appending 'b' to the mode argument) return contents as bytes objects without any decoding. In text mode (the default, or when 't' is appended to the mode argument), the contents of the file are returned as strings, the bytes having been first decoded using a platform-dependent encoding or using the specified encoding if given. buffering is an optional integer used to set the buffering policy. Pass 0 to switch buffering off (only allowed in binary mode), 1 to select line buffering (only usable in text mode), and an integer > 1 to indicate the size of a fixed-size chunk buffer. When no buffering argument is given, the default buffering policy works as follows: * Binary files are buffered in fixed-size chunks; the size of the buffer is chosen using a heuristic trying to determine the underlying device's "block size" and falling back on `io.DEFAULT_BUFFER_SIZE`. On many systems, the buffer will typically be 4096 or 8192 bytes long. * "Interactive" text files (files for which isatty() returns True) use line buffering. Other text files use the policy described above for binary files. encoding is the name of the encoding used to decode or encode the file. This should only be used in text mode. The default encoding is platform dependent, but any encoding supported by Python can be passed. See the codecs module for the list of supported encodings. errors is an optional string that specifies how encoding errors are to be handled---this argument should not be used in binary mode. Pass 'strict' to raise a ValueError exception if there is an encoding error (the default of None has the same effect), or pass 'ignore' to ignore errors. (Note that ignoring encoding errors can lead to data loss.) See the documentation for codecs.register or run 'help(codecs.Codec)' for a list of the permitted encoding error strings. newline controls how universal newlines works (it only applies to text mode). It can be None, '', '\n', '\r', and '\r\n'. It works as follows: * On input, if newline is None, universal newlines mode is enabled. Lines in the input can end in '\n', '\r', or '\r\n', and these are translated into '\n' before being returned to the caller. If it is '', universal newline mode is enabled, but line endings are returned to the caller untranslated. If it has any of the other legal values, input lines are only terminated by the given string, and the line ending is returned to the caller untranslated. * On output, if newline is None, any '\n' characters written are translated to the system default line separator, os.linesep. If newline is '' or '\n', no translation takes place. If newline is any of the other legal values, any '\n' characters written are translated to the given string. If closefd is False, the underlying file descriptor will be kept open when the file is closed. This does not work when a file name is given and must be True in that case. A custom opener can be used by passing a callable as *opener*. The underlying file descriptor for the file object is then obtained by calling *opener* with (*file*, *flags*). *opener* must return an open file descriptor (passing os.open as *opener* results in functionality similar to passing None). open() returns a file object whose type depends on the mode, and through which the standard file operations such as reading and writing are performed. When open() is used to open a file in a text mode ('w', 'r', 'wt', 'rt', etc.), it returns a TextIOWrapper. When used to open a file in a binary mode, the returned class varies: in read binary mode, it returns a BufferedReader; in write binary and append binary modes, it returns a BufferedWriter, and in read/write mode, it returns a BufferedRandom. It is also possible to use a string or bytearray as a file for both reading and writing. For strings StringIO can be used like a file opened in a text mode, and for bytes a BytesIO can be used like a file opened in a binary mode.The io module provides the Python interfaces to stream handling. The builtin open function is defined in this module. At the top of the I/O hierarchy is the abstract base class IOBase. It defines the basic interface to a stream. Note, however, that there is no separation between reading and writing to streams; implementations are allowed to raise an OSError if they do not support a given operation. Extending IOBase is RawIOBase which deals simply with the reading and writing of raw bytes to a stream. FileIO subclasses RawIOBase to provide an interface to OS files. BufferedIOBase deals with buffering on a raw byte stream (RawIOBase). Its subclasses, BufferedWriter, BufferedReader, and BufferedRWPair buffer streams that are readable, writable, and both respectively. BufferedRandom provides a buffered interface to random access streams. BytesIO is a simple stream of in-memory bytes. Another IOBase subclass, TextIOBase, deals with the encoding and decoding of streams into text. TextIOWrapper, which extends it, is a buffered text interface to a buffered raw stream (`BufferedIOBase`). Finally, StringIO is an in-memory stream for text. Argument names are not part of the specification, and only the arguments of open() are intended to be used as keyword arguments. data: DEFAULT_BUFFER_SIZE An int containing the default buffer size used by the module's buffered I/O classes. open() uses the file's blksize (as obtained by os.stat) if possible. This module makes available standard errno system symbols. The value of each symbol is the corresponding integer value, e.g., on most systems, errno.ENOENT equals the integer 2. The dictionary errno.errorcode maps numeric codes to symbol names, e.g., errno.errorcode[2] could be the string 'ENOENT'. Symbols that are not relevant to the underlying system are not defined. To map error codes to error messages, use the function os.strerror(), e.g. os.strerror(2) could return 'No such file or directory'.D.__sizeof__() -- size of D in memory, in bytesRotate the deque n steps to the right (default n=1). If n is negative, rotates left.D.reverse() -- reverse *IN PLACE*D.__reversed__() -- return a reverse iterator over the dequeD.remove(value) -- remove first occurrence of value.Remove and return the leftmost element.Remove and return the rightmost element.D.insert(index, object) -- insert object before indexD.index(value, [start, [stop]]) -- return first index of value. Raises ValueError if the value is not present.Extend the left side of the deque with elements from the iterableExtend the right side of the deque with elements from the iterableD.count(value) -- return number of occurrences of valueReturn a shallow copy of a deque.Remove all elements from the deque.Add an element to the left side of the deque.Add an element to the right side of the deque.deque([iterable[, maxlen]]) --> deque object A list-like sequence optimized for data accesses near its endpoints.Private method returning an estimate of len(list(it)).Return state information for pickling.D.copy() -> a shallow copy of D.__missing__(key) # Called by __getitem__ for missing key; pseudo-code: if self.default_factory is None: raise KeyError((key,)) self[key] = value = self.default_factory() return value defaultdict(default_factory=None, /, [...]) --> dict with default factory The default factory is called without arguments to produce a new value when a key is not present, in __getitem__ only. A defaultdict compares equal to a dict with the same items. All remaining arguments are treated the same as if they were passed to the dict constructor, including keyword arguments. High performance data structures. - deque: ordered collection accessible from endpoints only - defaultdict: dict subclass with a default value factory _count_elements($module, mapping, iterable, /) -- Count elements in the iterable, updating the mappinglookup_error($module, name, /) -- lookup_error(errors) -> handler Return the error handler for the specified error handling name or raise a LookupError, if no handler exists under this name.register_error($module, errors, handler, /) -- Register the specified error handler under the name errors. handler must be a callable object, that will be called with an exception instance containing information about the location of the encoding/decoding error and must return a (replacement, new position) tuple.readbuffer_encode($module, data, errors=None, /) -- charmap_build($module, map, /) -- charmap_decode($module, data, errors=None, mapping=None, /) -- charmap_encode($module, str, errors=None, mapping=None, /) -- ascii_decode($module, data, errors=None, /) -- ascii_encode($module, str, errors=None, /) -- latin_1_decode($module, data, errors=None, /) -- latin_1_encode($module, str, errors=None, /) -- raw_unicode_escape_decode($module, data, errors=None, final=True, /) -- raw_unicode_escape_encode($module, str, errors=None, /) -- unicode_escape_decode($module, data, errors=None, final=True, /) -- unicode_escape_encode($module, str, errors=None, /) -- utf_32_ex_decode($module, data, errors=None, byteorder=0, final=False, /) -- utf_32_be_decode($module, data, errors=None, final=False, /) -- utf_32_le_decode($module, data, errors=None, final=False, /) -- utf_32_decode($module, data, errors=None, final=False, /) -- utf_32_be_encode($module, str, errors=None, /) -- utf_32_le_encode($module, str, errors=None, /) -- utf_32_encode($module, str, errors=None, byteorder=0, /) -- utf_16_ex_decode($module, data, errors=None, byteorder=0, final=False, /) -- utf_16_be_decode($module, data, errors=None, final=False, /) -- utf_16_le_decode($module, data, errors=None, final=False, /) -- utf_16_decode($module, data, errors=None, final=False, /) -- utf_16_be_encode($module, str, errors=None, /) -- utf_16_le_encode($module, str, errors=None, /) -- utf_16_encode($module, str, errors=None, byteorder=0, /) -- utf_7_decode($module, data, errors=None, final=False, /) -- utf_7_encode($module, str, errors=None, /) -- utf_8_decode($module, data, errors=None, final=False, /) -- utf_8_encode($module, str, errors=None, /) -- escape_decode($module, data, errors=None, /) -- escape_encode($module, data, errors=None, /) -- decode($module, /, obj, encoding='utf-8', errors='strict') -- Decodes obj using the codec registered for encoding. Default encoding is 'utf-8'. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a ValueError. Other possible values are 'ignore', 'replace' and 'backslashreplace' as well as any other name registered with codecs.register_error that can handle ValueErrors.encode($module, /, obj, encoding='utf-8', errors='strict') -- Encodes obj using the codec registered for encoding. The default encoding is 'utf-8'. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a ValueError. Other possible values are 'ignore', 'replace' and 'backslashreplace' as well as any other name registered with codecs.register_error that can handle ValueErrors.lookup($module, encoding, /) -- Looks up a codec tuple in the Python codec registry and returns a CodecInfo object.unregister($module, search_function, /) -- Unregister a codec search function and clear the registry's cache. If the search function is not registered, do nothing.register($module, search_function, /) -- Register a codec search function. Search functions are expected to take one argument, the encoding name in all lower case letters, and either return None, or a tuple of functions (encoder, decoder, stream_reader, stream_writer) (or a CodecInfo object).reset_peak($module, /) -- Set the peak size of memory blocks traced by tracemalloc to the current size. Do nothing if the tracemalloc module is not tracing memory allocations.get_traced_memory($module, /) -- Get the current size and peak size of memory blocks traced by tracemalloc. Returns a tuple: (current: int, peak: int).get_tracemalloc_memory($module, /) -- Get the memory usage in bytes of the tracemalloc module. This memory is used internally to trace memory allocations.get_traceback_limit($module, /) -- Get the maximum number of frames stored in the traceback of a trace. By default, a trace of an allocated memory block only stores the most recent frame: the limit is 1.stop($module, /) -- Stop tracing Python memory allocations. Also clear traces of memory blocks allocated by Python.start($module, nframe=1, /) -- Start tracing Python memory allocations. Also set the maximum number of frames stored in the traceback of a trace to nframe._get_object_traceback($module, obj, /) -- Get the traceback where the Python object obj was allocated. Return a tuple of (filename: str, lineno: int) tuples. Return None if the tracemalloc module is disabled or did not trace the allocation of the object._get_traces($module, /) -- Get traces of all memory blocks allocated by Python. Return a list of (size: int, traceback: tuple) tuples. traceback is a tuple of (filename: str, lineno: int) tuples. Return an empty list if the tracemalloc module is disabled.clear_traces($module, /) -- Clear traces of memory blocks allocated by Python.is_tracing($module, /) -- Return True if the tracemalloc module is tracing Python memory allocations.Debug module to trace memory blocks allocated by Python.struct_siginfo: Result from sigwaitinfo or sigtimedwait. This object may be accessed either as a tuple of (si_signo, si_code, si_errno, si_pid, si_uid, si_status, si_band), or via the attributes si_signo, si_code, and so on.valid_signals($module, /) -- Return a set of valid signal numbers on this platform. The signal numbers returned by this function can be safely passed to functions like `pthread_sigmask`.sigtimedwait($module, sigset, timeout, /) -- Like sigwaitinfo(), but with a timeout. The timeout is specified in seconds, with floating-point numbers allowed.sigwaitinfo($module, sigset, /) -- Wait synchronously until one of the signals in *sigset* is delivered. Returns a struct_siginfo containing information about the signal.sigwait($module, sigset, /) -- Wait for a signal. Suspend execution of the calling thread until the delivery of one of the signals specified in the signal set sigset. The function accepts the signal and returns the signal number.sigpending($module, /) -- Examine pending signals. Returns a set of signal numbers that are pending for delivery to the calling thread.pthread_sigmask($module, how, mask, /) -- Fetch and/or change the signal mask of the calling thread.pthread_kill($module, thread_id, signalnum, /) -- Send a signal to a thread.pidfd_send_signal($module, pidfd, signalnum, siginfo=None, flags=0, /) -- Send a signal to a process referred to by a pid file descriptor.pause($module, /) -- Wait until a signal arrives.siginterrupt($module, signalnum, flag, /) -- Change system call restart behaviour. If flag is False, system calls will be restarted when interrupted by signal sig, else system calls will be interrupted.set_wakeup_fd(fd, *, warn_on_full_buffer=True) -> fd Sets the fd to be written to (with the signal number) when a signal comes in. A library can use this to wakeup select or poll. The previous fd or -1 is returned. The fd must be non-blocking.getsignal($module, signalnum, /) -- Return the current action for the given signal. The return value can be: SIG_IGN -- if the signal is being ignored SIG_DFL -- if the default action for the signal is in effect None -- if an unknown handler is in effect anything else -- the callable Python object used as a handlerstrsignal($module, signalnum, /) -- Return the system description of the given signal. Returns the description of signal *signalnum*, such as "Interrupt" for :const:`SIGINT`. Returns :const:`None` if *signalnum* has no description. Raises :exc:`ValueError` if *signalnum* is invalid.raise_signal($module, signalnum, /) -- Send a signal to the executing process.signal($module, signalnum, handler, /) -- Set the action for the given signal. The action can be SIG_DFL, SIG_IGN, or a callable Python object. The previous action is returned. See getsignal() for possible return values. *** IMPORTANT NOTICE *** A signal handler function is called with two arguments: the first is the signal number, the second is the interrupted stack frame.getitimer($module, which, /) -- Returns current value of given itimer.setitimer($module, which, seconds, interval=0.0, /) -- Sets given itimer (one of ITIMER_REAL, ITIMER_VIRTUAL or ITIMER_PROF). The timer will fire after value seconds and after that every interval seconds. The itimer can be cleared by setting seconds to zero. Returns old values as a tuple: (delay, interval).alarm($module, seconds, /) -- Arrange for SIGALRM to arrive after the given number of seconds.default_int_handler($module, signalnum, frame, /) -- The default handler for SIGINT installed by Python. It raises KeyboardInterrupt.This module provides mechanisms to use signal handlers in Python. Functions: alarm() -- cause SIGALRM after a specified time [Unix only] setitimer() -- cause a signal (described below) after a specified float time and the timer may restart then [Unix only] getitimer() -- get current value of timer [Unix only] signal() -- set the action for a given signal getsignal() -- get the signal action for a given signal pause() -- wait until a signal arrives [Unix only] default_int_handler() -- default SIGINT handler signal constants: SIG_DFL -- used to refer to the system default handler SIG_IGN -- used to ignore the signal NSIG -- number of defined signals SIGINT, SIGTERM, etc. -- signal numbers itimer constants: ITIMER_REAL -- decrements in real time, and delivers SIGALRM upon expiration ITIMER_VIRTUAL -- decrements only when the process is executing, and delivers SIGVTALRM upon expiration ITIMER_PROF -- decrements both when the process is executing and when the system is executing on behalf of the process. Coupled with ITIMER_VIRTUAL, this timer is usually used to profile the time spent by the application in user and kernel space. SIGPROF is delivered upon expiration. *** IMPORTANT NOTICE *** A signal handler function is called with two arguments: the first is the signal number, the second is the interrupted stack frame.stat_result: Result from stat, fstat, or lstat. This object may be accessed either as a tuple of (mode, ino, dev, nlink, uid, gid, size, atime, mtime, ctime) or via the attributes st_mode, st_ino, st_dev, st_nlink, st_uid, and so on. Posix/windows: If your platform supports st_blksize, st_blocks, st_rdev, or st_flags, they are available as attributes only. See os.stat for more information.statvfs_result: Result from statvfs or fstatvfs. This object may be accessed either as a tuple of (bsize, frsize, blocks, bfree, bavail, files, ffree, favail, flag, namemax), or via the attributes f_bsize, f_frsize, f_blocks, f_bfree, and so on. See os.statvfs for more information.waitid_result: Result from waitid. This object may be accessed either as a tuple of (si_pid, si_uid, si_signo, si_status, si_code), or via the attributes si_pid, si_uid, and so on. See os.waitid for more information.uname_result: Result from os.uname(). This object may be accessed either as a tuple of (sysname, nodename, release, version, machine), or via the attributes sysname, nodename, release, version, and machine. See os.uname for more information.sched_param(sched_priority) -- Currently has only one field: sched_priority sched_priority A scheduling parameter.times_result: Result from os.times(). This object may be accessed either as a tuple of (user, system, children_user, children_system, elapsed), or via the attributes user, system, children_user, children_system, and elapsed. See os.times for more information.A tuple of (columns, lines) for holding terminal window size__fspath__($self, /) -- Returns the path for the entry.inode($self, /) -- Return inode of the entry; cached per entry.stat($self, /, *, follow_symlinks=True) -- Return stat_result object for the entry; cached per entry.is_junction($self, /) -- Return True if the entry is a junction; cached per entry.is_symlink($self, /) -- Return True if the entry is a symbolic link; cached per entry.is_file($self, /, *, follow_symlinks=True) -- Return True if the entry is a file; cached per entry.is_dir($self, /, *, follow_symlinks=True) -- Return True if the entry is a directory; cached per entry.unshare($module, /, flags) -- Disassociate parts of a process (or thread) execution context. flags Namespaces to be unshared.setns($module, /, fd, nstype=0) -- Move the calling thread into different namespaces. fd A file descriptor to a namespace. nstype Type of namespace.waitstatus_to_exitcode($module, /, status) -- Convert a wait status to an exit code. On Unix: * If WIFEXITED(status) is true, return WEXITSTATUS(status). * If WIFSIGNALED(status) is true, return -WTERMSIG(status). * Otherwise, raise a ValueError. On Windows, return status shifted right by 8 bits. On Unix, if the process is being traced or if waitpid() was called with WUNTRACED option, the caller must first check if WIFSTOPPED(status) is true. This function must not be called if WIFSTOPPED(status) is true.eventfd_write($module, /, fd, value) -- Write eventfd value.eventfd_read($module, /, fd) -- Read eventfd valueeventfd($module, /, initval, flags=EFD_CLOEXEC) -- Creates and returns an event notification file descriptor.memfd_create($module, /, name, flags=MFD_CLOEXEC) -- getrandom($module, /, size, flags=0) -- Obtain a series of random bytes.fspath($module, /, path) -- Return the file system path representation of the object. If the object is str or bytes, then allow it to pass through as-is. If the object defines __fspath__(), then return the result of that method. All other types raise a TypeError.scandir($module, /, path=None) -- Return an iterator of DirEntry objects for given path. path can be specified as either str, bytes, or a path-like object. If path is bytes, the names of yielded DirEntry objects will also be bytes; in all other circumstances they will be str. If path is None, uses the path='.'.set_blocking($module, fd, blocking, /) -- Set the blocking mode of the specified file descriptor. Set the O_NONBLOCK flag if blocking is False, clear the O_NONBLOCK flag otherwise.get_blocking($module, fd, /) -- Get the blocking mode of the file descriptor. Return False if the O_NONBLOCK flag is set, True if the flag is cleared.set_inheritable($module, fd, inheritable, /) -- Set the inheritable flag of the specified file descriptor.get_inheritable($module, fd, /) -- Get the close-on-exe flag of the specified file descriptor.cpu_count($module, /) -- Return the number of CPUs in the system; return None if indeterminable. This number is not equivalent to the number of CPUs the current process can use. The number of usable CPUs can be obtained with ``len(os.sched_getaffinity(0))``get_terminal_size($module, fd=, /) -- Return the size of the terminal window as (columns, lines). The optional argument fd (default standard output) specifies which file descriptor should be queried. If the file descriptor is not connected to a terminal, an OSError is thrown. This function will only be defined if an implementation is available for this system. shutil.get_terminal_size is the high-level function which should normally be used, os.get_terminal_size is the low-level implementation.listxattr($module, /, path=None, *, follow_symlinks=True) -- Return a list of extended attributes on path. path may be either None, a string, a path-like object, or an open file descriptor. if path is None, listxattr will examine the current directory. If follow_symlinks is False, and the last element of the path is a symbolic link, listxattr will examine the symbolic link itself instead of the file the link points to.removexattr($module, /, path, attribute, *, follow_symlinks=True) -- Remove extended attribute attribute on path. path may be either a string, a path-like object, or an open file descriptor. If follow_symlinks is False, and the last element of the path is a symbolic link, removexattr will modify the symbolic link itself instead of the file the link points to.setxattr($module, /, path, attribute, value, flags=0, *, follow_symlinks=True) -- Set extended attribute attribute on path to value. path may be either a string, a path-like object, or an open file descriptor. If follow_symlinks is False, and the last element of the path is a symbolic link, setxattr will modify the symbolic link itself instead of the file the link points to.getxattr($module, /, path, attribute, *, follow_symlinks=True) -- Return the value of extended attribute attribute on path. path may be either a string, a path-like object, or an open file descriptor. If follow_symlinks is False, and the last element of the path is a symbolic link, getxattr will examine the symbolic link itself instead of the file the link points to.getresgid($module, /) -- Return a tuple of the current process's real, effective, and saved group ids.getresuid($module, /) -- Return a tuple of the current process's real, effective, and saved user ids.setresgid($module, rgid, egid, sgid, /) -- Set the current process's real, effective, and saved group ids.setresuid($module, ruid, euid, suid, /) -- Set the current process's real, effective, and saved user ids.urandom($module, size, /) -- Return a bytes object containing random bytes suitable for cryptographic use.getloadavg($module, /) -- Return average recent system load information. Return the number of processes in the system run queue averaged over the last 1, 5, and 15 minutes as a tuple of three floats. Raises OSError if the load average was unobtainable._path_normpath($module, /, path) -- Normalize path, eliminating double slashes, etc.abort($module, /) -- Abort the interpreter immediately. This function 'dumps core' or otherwise fails in the hardest way possible on the hosting operating system. This function never returns.pathconf($module, /, path, name) -- Return the configuration limit name for the file or directory path. If there is no limit, return -1. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.fpathconf($module, fd, name, /) -- Return the configuration limit name for the file descriptor fd. If there is no limit, return -1.sysconf($module, name, /) -- Return an integer-valued system configuration variable.confstr($module, name, /) -- Return a string-valued system configuration variable.statvfs($module, /, path) -- Perform a statvfs system call on the given path. path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.fstatvfs($module, fd, /) -- Perform an fstatvfs system call on the given fd. Equivalent to statvfs(fd).WSTOPSIG($module, /, status) -- Return the signal that stopped the process that provided the status value.WTERMSIG($module, /, status) -- Return the signal that terminated the process that provided the status value.WEXITSTATUS($module, /, status) -- Return the process return code from status.WIFEXITED($module, /, status) -- Return True if the process returning status exited via the exit() system call.WIFSIGNALED($module, /, status) -- Return True if the process returning status was terminated by a signal.WIFSTOPPED($module, /, status) -- Return True if the process returning status was stopped.WIFCONTINUED($module, /, status) -- Return True if a particular process was continued from a job control stop. Return True if the process returning status was continued from a job control stop.WCOREDUMP($module, status, /) -- Return True if the process returning status was dumped to a core file.fdatasync($module, /, fd) -- Force write of fd to disk without forcing update of metadata.sync($module, /) -- Force write of everything to disk.fsync($module, /, fd) -- Force write of fd to disk.fchdir($module, /, fd) -- Change to the directory of the given file descriptor. fd must be opened on a directory, not a file. Equivalent to os.chdir(fd).strerror($module, code, /) -- Translate an error code to a message string.unsetenv($module, name, /) -- Delete an environment variable.putenv($module, name, value, /) -- Change or add an environment variable.posix_fadvise($module, fd, offset, length, advice, /) -- Announce an intention to access data in a specific pattern. Announce an intention to access data in a specific pattern, thus allowing the kernel to make optimizations. The advice applies to the region of the file specified by fd starting at offset and continuing for length bytes. advice is one of POSIX_FADV_NORMAL, POSIX_FADV_SEQUENTIAL, POSIX_FADV_RANDOM, POSIX_FADV_NOREUSE, POSIX_FADV_WILLNEED, or POSIX_FADV_DONTNEED.posix_fallocate($module, fd, offset, length, /) -- Ensure a file has allocated at least a particular number of bytes on disk. Ensure that the file specified by fd encompasses a range of bytes starting at offset bytes from the beginning and continuing for length bytes.truncate($module, /, path, length) -- Truncate a file, specified by path, to a specific length. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.ftruncate($module, fd, length, /) -- Truncate a file, specified by file descriptor, to a specific length.makedev($module, major, minor, /) -- Composes a raw device number from the major and minor device numbers.minor($module, device, /) -- Extracts a device minor number from a raw device number.major($module, device, /) -- Extracts a device major number from a raw device number.mknod($module, /, path, mode=384, device=0, *, dir_fd=None) -- Create a node in the file system. Create a node in the file system (file, device special file or named pipe) at path. mode specifies both the permissions to use and the type of node to be created, being combined (bitwise OR) with one of S_IFREG, S_IFCHR, S_IFBLK, and S_IFIFO. If S_IFCHR or S_IFBLK is set on mode, device defines the newly created device special file (probably using os.makedev()). Otherwise device is ignored. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.mkfifo($module, /, path, mode=438, *, dir_fd=None) -- Create a "fifo" (a POSIX named pipe). If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.pipe2($module, flags, /) -- Create a pipe with flags set atomically. Returns a tuple of two file descriptors: (read_fd, write_fd) flags can be constructed by ORing together one or more of these values: O_NONBLOCK, O_CLOEXEC.pipe($module, /) -- Create a pipe. Returns a tuple of two file descriptors: (read_fd, write_fd)isatty($module, fd, /) -- Return True if the fd is connected to a terminal. Return True if the file descriptor is an open file descriptor connected to the slave end of a terminal.fstat($module, /, fd) -- Perform a stat system call on the given file descriptor. Like stat(), but for an open file descriptor. Equivalent to os.stat(fd).sendfile($module, /, out_fd, in_fd, offset, count) -- Copy count bytes from file descriptor in_fd to file descriptor out_fd.pwritev($module, fd, buffers, offset, flags=0, /) -- Writes the contents of bytes-like objects to a file descriptor at a given offset. Combines the functionality of writev() and pwrite(). All buffers must be a sequence of bytes-like objects. Buffers are processed in array order. Entire contents of first buffer is written before proceeding to second, and so on. The operating system may set a limit (sysconf() value SC_IOV_MAX) on the number of buffers that can be used. This function writes the contents of each object to the file descriptor and returns the total number of bytes written. The flags argument contains a bitwise OR of zero or more of the following flags: - RWF_DSYNC - RWF_SYNC - RWF_APPEND Using non-zero flags requires Linux 4.7 or newer.pwrite($module, fd, buffer, offset, /) -- Write bytes to a file descriptor starting at a particular offset. Write buffer to fd, starting at offset bytes from the beginning of the file. Returns the number of bytes writte. Does not change the current file offset.writev($module, fd, buffers, /) -- Iterate over buffers, and write the contents of each to a file descriptor. Returns the total number of bytes written. buffers must be a sequence of bytes-like objects.write($module, fd, data, /) -- Write a bytes object to a file descriptor.preadv($module, fd, buffers, offset, flags=0, /) -- Reads from a file descriptor into a number of mutable bytes-like objects. Combines the functionality of readv() and pread(). As readv(), it will transfer data into each buffer until it is full and then move on to the next buffer in the sequence to hold the rest of the data. Its fourth argument, specifies the file offset at which the input operation is to be performed. It will return the total number of bytes read (which can be less than the total capacity of all the objects). The flags argument contains a bitwise OR of zero or more of the following flags: - RWF_HIPRI - RWF_NOWAIT Using non-zero flags requires Linux 4.6 or newer.pread($module, fd, length, offset, /) -- Read a number of bytes from a file descriptor starting at a particular offset. Read length bytes from file descriptor fd, starting at offset bytes from the beginning of the file. The file offset remains unchanged.readv($module, fd, buffers, /) -- Read from a file descriptor fd into an iterable of buffers. The buffers should be mutable buffers accepting bytes. readv will transfer data into each buffer until it is full and then move on to the next buffer in the sequence to hold the rest of the data. readv returns the total number of bytes read, which may be less than the total capacity of all the buffers.read($module, fd, length, /) -- Read from a file descriptor. Returns a bytes object.lseek($module, fd, position, whence, /) -- Set the position of a file descriptor. Return the new position. fd An open file descriptor, as returned by os.open(). position Position, interpreted relative to 'whence'. whence The relative position to seek from. Valid values are: - SEEK_SET: seek from the start of the file. - SEEK_CUR: seek from the current file position. - SEEK_END: seek from the end of the file. The return value is the number of bytes relative to the beginning of the file.lockf($module, fd, command, length, /) -- Apply, test or remove a POSIX lock on an open file descriptor. fd An open file descriptor. command One of F_LOCK, F_TLOCK, F_ULOCK or F_TEST. length The number of bytes to lock, starting at the current position.dup2($module, /, fd, fd2, inheritable=True) -- Duplicate file descriptor.dup($module, fd, /) -- Return a duplicate of a file descriptor.device_encoding($module, /, fd) -- Return a string describing the encoding of a terminal's file descriptor. The file descriptor must be attached to a terminal. If the device is not a terminal, return None.closerange($module, fd_low, fd_high, /) -- Closes all file descriptors in [fd_low, fd_high), ignoring errors.close($module, /, fd) -- Close a file descriptor.open($module, /, path, flags, mode=511, *, dir_fd=None) -- Open a file for low level IO. Returns a file descriptor (integer). If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.tcsetpgrp($module, fd, pgid, /) -- Set the process group associated with the terminal specified by fd.tcgetpgrp($module, fd, /) -- Return the process group associated with the terminal specified by fd.setpgid($module, pid, pgrp, /) -- Call the system call setpgid(pid, pgrp).setsid($module, /) -- Call the system call setsid().getsid($module, pid, /) -- Call the system call getsid(pid) and return the result.pidfd_open($module, /, pid, flags=0) -- Return a file descriptor referring to the process *pid*. The descriptor can be used to perform process management without races and signals.waitpid($module, pid, options, /) -- Wait for completion of a given child process. Returns a tuple of information regarding the child process: (pid, status) The options argument is ignored on Windows.waitid($module, idtype, id, options, /) -- Returns the result of waiting for a process or processes. idtype Must be one of be P_PID, P_PGID or P_ALL. id The id to wait on. options Constructed from the ORing of one or more of WEXITED, WSTOPPED or WCONTINUED and additionally may be ORed with WNOHANG or WNOWAIT. Returns either waitid_result or None if WNOHANG is specified and there are no children in a waitable state.wait4($module, /, pid, options) -- Wait for completion of a specific child process. Returns a tuple of information about the child process: (pid, status, rusage)wait3($module, /, options) -- Wait for completion of a child process. Returns a tuple of information about the child process: (pid, status, rusage)wait($module, /) -- Wait for completion of a child process. Returns a tuple of information about the child process: (pid, status)setpgrp($module, /) -- Make the current process the leader of its process group.getpgid($module, /, pid) -- Call the system call getpgid(), and return the result.initgroups($module, username, gid, /) -- Initialize the group access list. Call the system initgroups() to initialize the group access list with all of the groups of which the specified username is a member, plus the specified group id.setgroups($module, groups, /) -- Set the groups of the current process to list.setregid($module, rgid, egid, /) -- Set the current process's real and effective group ids.setegid($module, egid, /) -- Set the current process's effective group id.setgid($module, gid, /) -- Set the current process's group id.setreuid($module, ruid, euid, /) -- Set the current process's real and effective user ids.seteuid($module, euid, /) -- Set the current process's effective user id.setuid($module, uid, /) -- Set the current process's user id.killpg($module, pgid, signal, /) -- Kill a process group with a signal.kill($module, pid, signal, /) -- Kill a process with a signal.getlogin($module, /) -- Return the actual login name.getuid($module, /) -- Return the current process's user id.getppid($module, /) -- Return the parent's process id. If the parent process has already exited, Windows machines will still return its id; others systems will return the id of the 'init' process (1).getpgrp($module, /) -- Return the current process group id.getpid($module, /) -- Return the current process id.getgroups($module, /) -- Return list of supplemental group IDs for the process.getgrouplist($module, user, group, /) -- Returns a list of groups to which a user belongs. user username to lookup group base group id of the usergetgid($module, /) -- Return the current process's group id.geteuid($module, /) -- Return the current process's effective user id.getegid($module, /) -- Return the current process's effective group id.forkpty($module, /) -- Fork a new process with a new pseudo-terminal as controlling tty. Returns a tuple of (pid, master_fd). Like fork(), return pid of 0 to the child process, and pid of child to the parent process. To both, return fd of newly opened pseudo-terminal.login_tty($module, fd, /) -- Prepare the tty of which fd is a file descriptor for a new login session. Make the calling process a session leader; make the tty the controlling tty, the stdin, the stdout, and the stderr of the calling process; close fd.openpty($module, /) -- Open a pseudo-terminal. Return a tuple of (master_fd, slave_fd) containing open file descriptors for both the master and slave ends.sched_getaffinity($module, pid, /) -- Return the affinity of the process identified by pid (or the current process if zero). The affinity is returned as a set of CPU identifiers.sched_setaffinity($module, pid, mask, /) -- Set the CPU affinity of the process identified by pid to mask. mask should be an iterable of integers identifying CPUs.sched_yield($module, /) -- Voluntarily relinquish the CPU.sched_setscheduler($module, pid, policy, param, /) -- Set the scheduling policy for the process identified by pid. If pid is 0, the calling process is changed. param is an instance of sched_param.sched_setparam($module, pid, param, /) -- Set scheduling parameters for the process identified by pid. If pid is 0, sets parameters for the calling process. param should be an instance of sched_param.sched_rr_get_interval($module, pid, /) -- Return the round-robin quantum for the process identified by pid, in seconds. Value returned is a float.sched_getscheduler($module, pid, /) -- Get the scheduling policy for the process identified by pid. Passing 0 for pid returns the scheduling policy for the calling process.sched_getparam($module, pid, /) -- Returns scheduling parameters for the process identified by pid. If pid is 0, returns parameters for the calling process. Return value is an instance of sched_param.sched_get_priority_min($module, /, policy) -- Get the minimum scheduling priority for policy.sched_get_priority_max($module, /, policy) -- Get the maximum scheduling priority for policy.register_at_fork($module, /, *, before=, after_in_child=, after_in_parent=) -- Register callables to be called when forking a new process. before A callable to be called in the parent before the fork() syscall. after_in_child A callable to be called in the child after fork(). after_in_parent A callable to be called in the parent after fork(). 'before' callbacks are called in reverse order. 'after_in_child' and 'after_in_parent' callbacks are called in order.fork($module, /) -- Fork a child process. Return 0 to child process and PID of child to parent process.execve($module, /, path, argv, env) -- Execute an executable path with arguments, replacing current process. path Path of executable file. argv Tuple or list of strings. env Dictionary of strings mapping to strings.execv($module, path, argv, /) -- Execute an executable path with arguments, replacing current process. path Path of executable file. argv Tuple or list of strings._exit($module, /, status) -- Exit to the system with specified status, without normal exit processing.times($module, /) -- Return a collection containing process timing information. The object returned behaves like a named tuple with these fields: (utime, stime, cutime, cstime, elapsed_time) All fields are floating-point numbers.utime($module, /, path, times=None, *, ns=, dir_fd=None, follow_symlinks=True) -- Set the access and modified time of path. path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception. If times is not None, it must be a tuple (atime, mtime); atime and mtime should be expressed as float seconds since the epoch. If ns is specified, it must be a tuple (atime_ns, mtime_ns); atime_ns and mtime_ns should be expressed as integer nanoseconds since the epoch. If times is None and ns is unspecified, utime uses the current time. Specifying tuples for both times and ns is an error. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. If follow_symlinks is False, and the last element of the path is a symbolic link, utime will modify the symbolic link itself instead of the file the link points to. It is an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor. dir_fd and follow_symlinks may not be available on your platform. If they are unavailable, using them will raise a NotImplementedError.remove($module, /, path, *, dir_fd=None) -- Remove a file (same as unlink()). If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.unlink($module, /, path, *, dir_fd=None) -- Remove a file (same as remove()). If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.uname($module, /) -- Return an object identifying the current operating system. The object behaves like a named tuple with the following fields: (sysname, nodename, release, version, machine)umask($module, mask, /) -- Set the current numeric umask and return the previous umask.system($module, /, command) -- Execute the command in a subshell.symlink($module, /, src, dst, target_is_directory=False, *, dir_fd=None) -- Create a symbolic link pointing to src named dst. target_is_directory is required on Windows if the target is to be interpreted as a directory. (On Windows, symlink requires Windows 6.0 or greater, and raises a NotImplementedError otherwise.) target_is_directory is ignored on non-Windows platforms. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.rmdir($module, /, path, *, dir_fd=None) -- Remove a directory. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.replace($module, /, src, dst, *, src_dir_fd=None, dst_dir_fd=None) -- Rename a file or directory, overwriting the destination. If either src_dir_fd or dst_dir_fd is not None, it should be a file descriptor open to a directory, and the respective path string (src or dst) should be relative; the path will then be relative to that directory. src_dir_fd and dst_dir_fd, may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.rename($module, /, src, dst, *, src_dir_fd=None, dst_dir_fd=None) -- Rename a file or directory. If either src_dir_fd or dst_dir_fd is not None, it should be a file descriptor open to a directory, and the respective path string (src or dst) should be relative; the path will then be relative to that directory. src_dir_fd and dst_dir_fd, may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.splice($module, /, src, dst, count, offset_src=None, offset_dst=None, flags=0) -- Transfer count bytes from one pipe to a descriptor or vice versa. src Source file descriptor. dst Destination file descriptor. count Number of bytes to copy. offset_src Starting offset in src. offset_dst Starting offset in dst. flags Flags to modify the semantics of the call. If offset_src is None, then src is read from the current position; respectively for offset_dst. The offset associated to the file descriptor that refers to a pipe must be None.copy_file_range($module, /, src, dst, count, offset_src=None, offset_dst=None) -- Copy count bytes from one file descriptor to another. src Source file descriptor. dst Destination file descriptor. count Number of bytes to copy. offset_src Starting offset in src. offset_dst Starting offset in dst. If offset_src is None, then src is read from the current position; respectively for offset_dst.readlink($module, /, path, *, dir_fd=None) -- Return a string representing the path to which the symbolic link points. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.posix_spawnp($module, path, argv, env, /, *, file_actions=(), setpgroup=, resetids=False, setsid=False, setsigmask=(), setsigdef=(), scheduler=) -- Execute the program specified by path in a new process. path Path of executable file. argv Tuple or list of strings. env Dictionary of strings mapping to strings. file_actions A sequence of file action tuples. setpgroup The pgroup to use with the POSIX_SPAWN_SETPGROUP flag. resetids If the value is `True` the POSIX_SPAWN_RESETIDS will be activated. setsid If the value is `True` the POSIX_SPAWN_SETSID or POSIX_SPAWN_SETSID_NP will be activated. setsigmask The sigmask to use with the POSIX_SPAWN_SETSIGMASK flag. setsigdef The sigmask to use with the POSIX_SPAWN_SETSIGDEF flag. scheduler A tuple with the scheduler policy (optional) and parameters.posix_spawn($module, path, argv, env, /, *, file_actions=(), setpgroup=, resetids=False, setsid=False, setsigmask=(), setsigdef=(), scheduler=) -- Execute the program specified by path in a new process. path Path of executable file. argv Tuple or list of strings. env Dictionary of strings mapping to strings. file_actions A sequence of file action tuples. setpgroup The pgroup to use with the POSIX_SPAWN_SETPGROUP flag. resetids If the value is `true` the POSIX_SPAWN_RESETIDS will be activated. setsid If the value is `true` the POSIX_SPAWN_SETSID or POSIX_SPAWN_SETSID_NP will be activated. setsigmask The sigmask to use with the POSIX_SPAWN_SETSIGMASK flag. setsigdef The sigmask to use with the POSIX_SPAWN_SETSIGDEF flag. scheduler A tuple with the scheduler policy (optional) and parameters.setpriority($module, /, which, who, priority) -- Set program scheduling priority.getpriority($module, /, which, who) -- Return program scheduling priority.nice($module, increment, /) -- Add increment to the priority of process and return the new priority.mkdir($module, /, path, mode=511, *, dir_fd=None) -- Create a directory. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError. The mode argument is ignored on Windows. Where it is used, the current umask value is first masked out.lstat($module, /, path, *, dir_fd=None) -- Perform a stat system call on the given path, without following symbolic links. Like stat(), but do not follow symbolic links. Equivalent to stat(path, follow_symlinks=False).listdir($module, /, path=None) -- Return a list containing the names of the files in the directory. path can be specified as either str, bytes, or a path-like object. If path is bytes, the filenames returned will also be bytes; in all other circumstances the filenames returned will be str. If path is None, uses the path='.'. On some platforms, path may also be specified as an open file descriptor;\ the file descriptor must refer to a directory. If this functionality is unavailable, using it raises NotImplementedError. The list is in arbitrary order. It does not include the special entries '.' and '..' even if they are present in the directory.link($module, /, src, dst, *, src_dir_fd=None, dst_dir_fd=None, follow_symlinks=True) -- Create a hard link to a file. If either src_dir_fd or dst_dir_fd is not None, it should be a file descriptor open to a directory, and the respective path string (src or dst) should be relative; the path will then be relative to that directory. If follow_symlinks is False, and the last element of src is a symbolic link, link will create a link to the symbolic link itself instead of the file the link points to. src_dir_fd, dst_dir_fd, and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.getcwdb($module, /) -- Return a bytes string representing the current working directory.getcwd($module, /) -- Return a unicode string representing the current working directory.ctermid($module, /) -- Return the name of the controlling terminal for this process.chroot($module, /, path) -- Change root directory to path.lchown($module, /, path, uid, gid) -- Change the owner and group id of path to the numeric uid and gid. This function will not follow symbolic links. Equivalent to os.chown(path, uid, gid, follow_symlinks=False).fchown($module, /, fd, uid, gid) -- Change the owner and group id of the file specified by file descriptor. Equivalent to os.chown(fd, uid, gid).chown($module, /, path, uid, gid, *, dir_fd=None, follow_symlinks=True) -- Change the owner and group id of path to the numeric uid and gid.\ path Path to be examined; can be string, bytes, a path-like object, or open-file-descriptor int. dir_fd If not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. follow_symlinks If False, and the last element of the path is a symbolic link, stat will examine the symbolic link itself instead of the file the link points to. path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. If follow_symlinks is False, and the last element of the path is a symbolic link, chown will modify the symbolic link itself instead of the file the link points to. It is an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor. dir_fd and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.fchmod($module, /, fd, mode) -- Change the access permissions of the file given by file descriptor fd. fd The file descriptor of the file to be modified. mode Operating-system mode bitfield. Be careful when using number literals for *mode*. The conventional UNIX notation for numeric modes uses an octal base, which needs to be indicated with a ``0o`` prefix in Python. Equivalent to os.chmod(fd, mode).chmod($module, /, path, mode, *, dir_fd=None, follow_symlinks=True) -- Change the access permissions of a file. path Path to be modified. May always be specified as a str, bytes, or a path-like object. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception. mode Operating-system mode bitfield. Be careful when using number literals for *mode*. The conventional UNIX notation for numeric modes uses an octal base, which needs to be indicated with a ``0o`` prefix in Python. dir_fd If not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. follow_symlinks If False, and the last element of the path is a symbolic link, chmod will modify the symbolic link itself instead of the file the link points to. It is an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor. dir_fd and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.chdir($module, /, path) -- Change the current working directory to the specified path. path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.ttyname($module, fd, /) -- Return the name of the terminal device connected to 'fd'. fd Integer file descriptor handle.access($module, /, path, mode, *, dir_fd=None, effective_ids=False, follow_symlinks=True) -- Use the real uid/gid to test for access to a path. path Path to be tested; can be string, bytes, or a path-like object. mode Operating-system mode bitfield. Can be F_OK to test existence, or the inclusive-OR of R_OK, W_OK, and X_OK. dir_fd If not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. effective_ids If True, access will use the effective uid/gid instead of the real uid/gid. follow_symlinks If False, and the last element of the path is a symbolic link, access will examine the symbolic link itself instead of the file the link points to. dir_fd, effective_ids, and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError. Note that most operations will use the effective uid/gid, therefore this routine can be used in a suid/sgid environment to test if the invoking user has the specified access to the path.stat($module, /, path, *, dir_fd=None, follow_symlinks=True) -- Perform a stat system call on the given path. path Path to be examined; can be string, bytes, a path-like object or open-file-descriptor int. dir_fd If not None, it should be a file descriptor open to a directory, and path should be a relative string; path will then be relative to that directory. follow_symlinks If False, and the last element of the path is a symbolic link, stat will examine the symbolic link itself instead of the file the link points to. dir_fd and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError. It's an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor.This module provides access to operating system functionality that is standardized by the C Standard and the POSIX standard (a thinly disguised Unix interface). Refer to the library manual and corresponding Unix manual entries for more information on calls.faulthandler module._ncallbacks() -> int Return the number of registered exit functions._run_exitfuncs() -> None Run all registered exit functions. If a callback raises an exception, it is logged with sys.unraisablehook.unregister(func) -> None Unregister an exit function which was previously registered using atexit.register func - function to be unregistered_clear() -> None Clear the list of previously registered exit functions.register(func, *args, **kwargs) -> func Register a function to be executed upon normal program termination func - function to be called at exit args - optional arguments to pass to func kwargs - optional keyword arguments to pass to func func is returned to facilitate usage as a decorator.allow programmer to define multiple exit functions to be executed upon normal program termination. Two public functions, register and unregister, are defined. get_freeze_count($module, /) -- Return the number of objects in the permanent generation.unfreeze($module, /) -- Unfreeze all objects in the permanent generation. Put all objects in the permanent generation back into oldest generation.freeze($module, /) -- Freeze all current tracked objects and ignore them for future collections. This can be used before a POSIX fork() call to make the gc copy-on-write friendly. Note: collection before a POSIX fork() call may free pages for future allocation which can cause copy-on-write.get_referents(*objs) -> list Return the list of objects that are directly referred to by objs.get_referrers(*objs) -> list Return the list of objects that directly refer to any of objs.is_finalized($module, obj, /) -- Returns true if the object has been already finalized by the GC.is_tracked($module, obj, /) -- Returns true if the object is tracked by the garbage collector. Simple atomic objects will return false.get_stats($module, /) -- Return a list of dictionaries containing per-generation statistics.get_objects($module, /, generation=None) -- Return a list of objects tracked by the collector (excluding the list returned). generation Generation to extract the objects from. If generation is not None, return only the objects tracked by the collector that are in that generation.collect($module, /, generation=2) -- Run the garbage collector. With no arguments, run a full collection. The optional argument may be an integer specifying which generation to collect. A ValueError is raised if the generation number is invalid. The number of unreachable objects is returned.get_threshold($module, /) -- Return the current collection thresholds.set_threshold(threshold0, [threshold1, threshold2]) -> None Sets the collection thresholds. Setting threshold0 to zero disables collection. get_count($module, /) -- Return a three-tuple of the current collection counts.get_debug($module, /) -- Get the garbage collection debugging flags.set_debug($module, flags, /) -- Set the garbage collection debugging flags. flags An integer that can have the following bits turned on: DEBUG_STATS - Print statistics during collection. DEBUG_COLLECTABLE - Print collectable objects found. DEBUG_UNCOLLECTABLE - Print unreachable but uncollectable objects found. DEBUG_SAVEALL - Save objects to gc.garbage rather than freeing them. DEBUG_LEAK - Debug leaking programs (everything but STATS). Debugging information is written to sys.stderr.isenabled($module, /) -- Returns true if automatic garbage collection is enabled.disable($module, /) -- Disable automatic garbage collection.enable($module, /) -- Enable automatic garbage collection.This module provides access to the garbage collector for reference cycles. enable() -- Enable automatic garbage collection. disable() -- Disable automatic garbage collection. isenabled() -- Returns true if automatic collection is enabled. collect() -- Do a full collection right now. get_count() -- Return the current collection counts. get_stats() -- Return list of dictionaries containing per-generation stats. set_debug() -- Set debugging flags. get_debug() -- Get debugging flags. set_threshold() -- Set the collection thresholds. get_threshold() -- Return the current the collection thresholds. get_objects() -- Return a list of all objects tracked by the collector. is_tracked() -- Returns true if a given object is tracked. is_finalized() -- Returns true if a given object has been already finalized. get_referrers() -- Return the list of objects that refer to an object. get_referents() -- Return the list of objects that an object refers to. freeze() -- Freeze all tracked objects and ignore them for future collections. unfreeze() -- Unfreeze all objects in the permanent generation. get_freeze_count() -- Return the number of objects in the permanent generation. TracebackType(tb_next, tb_frame, tb_lasti, tb_lineno) -- Create a new traceback object.sys.thread_info A named tuple holding information about the thread implementation.asyncgen_hooks A named tuple providing information about asynchronous generators hooks. The attributes are read only.hash_info A named tuple providing parameters used for computing hashes. The attributes are read only.set_int_max_str_digits($module, /, maxdigits) -- Set the maximum string digits limit for non-binary int<->str conversions.get_int_max_str_digits($module, /) -- Return the maximum string digits limit for non-binary int<->str conversions.unraisablehook($module, unraisable, /) -- Handle an unraisable exception. The unraisable argument has the following attributes: * exc_type: Exception type. * exc_value: Exception value, can be None. * exc_traceback: Exception traceback, can be None. * err_msg: Error message, can be None. * object: Object causing the exception, can be None.is_stack_trampoline_active($module, /) -- Return *True* if a stack profiler trampoline is active.deactivate_stack_trampoline($module, /) -- Deactivate the current stack profiler trampoline backend. If no stack profiler is activated, this function has no effect.activate_stack_trampoline($module, backend, /) -- Activate stack profiler trampoline *backend*.get_asyncgen_hooks($module, /) -- Return the installed asynchronous generators hooks. This returns a namedtuple of the form (firstiter, finalizer).set_asyncgen_hooks([firstiter] [, finalizer]) Set a finalizer for async generators objects.get_coroutine_origin_tracking_depth($module, /) -- Check status of origin tracking for coroutine objects in this thread.set_coroutine_origin_tracking_depth($module, /, depth) -- Enable or disable origin tracking for coroutine objects in this thread. Coroutine objects will track 'depth' frames of traceback information about where they came from, available in their cr_origin attribute. Set a depth of 0 to disable._debugmallocstats($module, /) -- Print summary info to stderr about the state of pymalloc's structures. In Py_DEBUG mode, also perform some expensive internal consistency checks.call_tracing($module, func, args, /) -- Call func(*args), while tracing is enabled. The tracing state is saved, and restored afterwards. This is intended to be called from a debugger from a checkpoint, to recursively debug some other code.gettrace($module, /) -- Return the global debug tracing function set with sys.settrace. See the debugger chapter in the library manual._settraceallthreads($module, arg, /) -- Set the global debug tracing function in all running threads belonging to the current interpreter. It will be called on each function call. See the debugger chapter in the library manual.settrace(function) Set the global debug tracing function. It will be called on each function call. See the debugger chapter in the library manual.setrecursionlimit($module, limit, /) -- Set the maximum depth of the Python interpreter stack to n. This limit prevents infinite recursion from causing an overflow of the C stack and crashing Python. The highest possible limit is platform- dependent.getprofile($module, /) -- Return the profiling function set with sys.setprofile. See the profiler chapter in the library manual._setprofileallthreads($module, arg, /) -- Set the profiling function in all running threads belonging to the current interpreter. It will be called on each function call and return. See the profiler chapter in the library manual.setprofile(function) Set the profiling function. It will be called on each function call and return. See the profiler chapter in the library manual.setdlopenflags($module, flags, /) -- Set the flags used by the interpreter for dlopen calls. This is used, for example, when the interpreter loads extension modules. Among other things, this will enable a lazy resolving of symbols when importing a module, if called as sys.setdlopenflags(0). To share symbols across extension modules, call as sys.setdlopenflags(os.RTLD_GLOBAL). Symbolic names for the flag modules can be found in the os module (RTLD_xxx constants, e.g. os.RTLD_LAZY).getswitchinterval($module, /) -- Return the current thread switch interval; see sys.setswitchinterval().setswitchinterval($module, interval, /) -- Set the ideal thread switching delay inside the Python interpreter. The actual frequency of switching threads can be lower if the interpreter executes long sequences of uninterruptible code (this is implementation-specific and workload-dependent). The parameter must represent the desired switching delay in seconds A typical value is 0.005 (5 milliseconds).is_finalizing($module, /) -- Return True if Python is exiting.intern($module, string, /) -- ``Intern'' the given string. This enters the string in the (global) table of interned strings whose purpose is to speed up dictionary lookups. Return the string itself or the previously interned string object with the same value._getframemodulename($module, /, depth=0) -- Return the name of the module for a calling frame. The default depth returns the module containing the call to this API. A more typical use in a library will pass a depth of 1 to get the user's module rather than the library module. If no frame, module, or name can be found, returns None._getframe($module, depth=0, /) -- Return a frame object from the call stack. If optional integer depth is given, return the frame object that many calls below the top of the stack. If that is deeper than the call stack, ValueError is raised. The default for depth is zero, returning the frame at the top of the call stack. This function should be used for internal and specialized purposes only.getsizeof(object [, default]) -> int Return the size of object in bytes.getrecursionlimit($module, /) -- Return the current value of the recursion limit. The recursion limit is the maximum depth of the Python interpreter stack. This limit prevents infinite recursion from causing an overflow of the C stack and crashing Python.getrefcount($module, object, /) -- Return the reference count of object. The count returned is generally one higher than you might expect, because it includes the (temporary) reference as an argument to getrefcount().getfilesystemencodeerrors($module, /) -- Return the error mode used Unicode to OS filename conversion.getfilesystemencoding($module, /) -- Return the encoding used to convert Unicode filenames to OS filenames.getunicodeinternedsize($module, /, *, _only_immortal=False) -- Return the number of elements of the unicode interned dictionarygetallocatedblocks($module, /) -- Return the number of memory blocks currently allocated.getdlopenflags($module, /) -- Return the current value of the flags that are used for dlopen calls. The flag constants are defined in the os module.getdefaultencoding($module, /) -- Return the current default encoding used by the Unicode implementation.exit($module, status=None, /) -- Exit the interpreter by raising SystemExit(status). If the status is omitted or None, it defaults to zero (i.e., success). If the status is an integer, it will be used as the system exit status. If it is another kind of object, it will be printed and the system exit status will be one (i.e., failure).excepthook($module, exctype, value, traceback, /) -- Handle an exception by displaying it with a traceback on sys.stderr.exc_info($module, /) -- Return current exception information: (type, value, traceback). Return information about the most recent exception caught by an except clause in the current stack frame or in an older stack frame.exception($module, /) -- Return the current exception. Return the most recent exception caught by an except clause in the current stack frame or in an older stack frame, or None if no such exception exists.displayhook($module, object, /) -- Print an object to sys.stdout and also save it in builtins.__current_exceptions($module, /) -- Return a dict mapping each thread's identifier to its current raised exception. This function should be used for specialized purposes only._current_frames($module, /) -- Return a dict mapping each thread's thread id to its current stack frame. This function should be used for specialized purposes only._clear_type_cache($module, /) -- Clear the internal type lookup cache.breakpointhook(*args, **kws) This hook function is called by built-in breakpoint(). audit(event, *args) Passes the event to any audit hooks that are attached.addaudithook($module, /, hook) -- Adds a new audit hook callback.sys.flags Flags provided through command line arguments or environment vars.sys.version_info Version information as a named tuple.This module provides access to some objects used or maintained by the interpreter and to functions that interact strongly with the interpreter. Dynamic objects: argv -- command line arguments; argv[0] is the script pathname if known path -- module search path; path[0] is the script directory, else '' modules -- dictionary of loaded modules displayhook -- called to show results in an interactive session excepthook -- called to handle any uncaught exception other than SystemExit To customize printing in an interactive session or to install a custom top-level exception handler, assign other functions to replace these. stdin -- standard input file object; used by input() stdout -- standard output file object; used by print() stderr -- standard error object; used for error messages By assigning other file objects (or objects that behave like files) to these, it is possible to redirect all of the interpreter's I/O. last_exc - the last uncaught exception Only available in an interactive session after a traceback has been printed. last_type -- type of last uncaught exception last_value -- value of last uncaught exception last_traceback -- traceback of last uncaught exception These three are the (deprecated) legacy representation of last_exc. Static objects: builtin_module_names -- tuple of module names built into this interpreter copyright -- copyright notice pertaining to this interpreter exec_prefix -- prefix used to find the machine-specific Python library executable -- absolute path of the executable binary of the Python interpreter float_info -- a named tuple with information about the float implementation. float_repr_style -- string indicating the style of repr() output for floats hash_info -- a named tuple with information about the hash algorithm. hexversion -- version information encoded as a single integer implementation -- Python implementation information. int_info -- a named tuple with information about the int implementation. maxsize -- the largest supported length of containers. maxunicode -- the value of the largest Unicode code point platform -- platform identifier prefix -- prefix used to find the Python library thread_info -- a named tuple with information about the thread implementation. version -- the version of this interpreter as a string version_info -- version information as a named tuple __stdin__ -- the original stdin; don't touch! __stdout__ -- the original stdout; don't touch! __stderr__ -- the original stderr; don't touch! __displayhook__ -- the original displayhook; don't touch! __excepthook__ -- the original excepthook; don't touch! Functions: displayhook() -- print an object to the screen, and save it in builtins._ excepthook() -- print an exception and its traceback to sys.stderr exception() -- return the current thread's active exception exc_info() -- return information about the current thread's active exception exit() -- exit the interpreter by raising SystemExit getdlopenflags() -- returns flags to be used for dlopen() calls getprofile() -- get the global profiling function getrefcount() -- return the reference count for an object (plus one :-) getrecursionlimit() -- return the max recursion depth for the interpreter getsizeof() -- return the size of an object in bytes gettrace() -- get the global debug tracing function setdlopenflags() -- set the flags to be used for dlopen() calls setprofile() -- set the global profiling function setrecursionlimit() -- set the max recursion depth for the interpreter settrace() -- set the global debug tracing function   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~loads($module, bytes, /) -- Convert the bytes-like object to a value. If no valid value is found, raise EOFError, ValueError or TypeError. Extra bytes in the input are ignored.dumps($module, value, version=version, /) -- Return the bytes object that would be written to a file by dump(value, file). value Must be a supported type. version Indicates the data format that dumps should use. Raise a ValueError exception if value has (or contains an object that has) an unsupported type.load($module, file, /) -- Read one value from the open file and return it. file Must be readable binary file. If no valid value is read (e.g. because the data has a different Python version's incompatible marshal format), raise EOFError, ValueError or TypeError. Note: If an object containing an unsupported type was marshalled with dump(), load() will substitute None for the unmarshallable type.dump($module, value, file, version=version, /) -- Write the value on the open file. value Must be a supported type. file Must be a writeable binary file. version Indicates the data format that dump should use. If the value has (or contains an object that has) an unsupported type, a ValueError exception is raised - but garbage data will also be written to the file. The object will not be properly read back by load().This module contains functions that can read and write Python values in a binary format. The format is specific to Python, but independent of machine architecture issues. Not all Python object types are supported; in general, only objects whose value is independent from a particular invocation of Python can be written and read by this module. The following types are supported: None, integers, floating-point numbers, strings, bytes, bytearrays, tuples, lists, sets, dictionaries, and code objects, where it should be understood that tuples, lists and dictionaries are only supported as long as the values contained therein are themselves supported; and recursive lists and dictionaries should not be written (they will cause infinite loops). Variables: version -- indicates the format that the module uses. Version 0 is the historical format, version 1 shares interned strings and version 2 uses a binary format for floating-point numbers. Version 3 shares common object references (New in version 3.4). Functions: dump() -- write value to a file load() -- read value from a file dumps() -- marshal value as a bytes object loads() -- read value from a bytes-like object_all_events($module, /) -- restart_events($module, /) -- set_local_events($module, tool_id, code, event_set, /) -- get_local_events($module, tool_id, code, /) -- set_events($module, tool_id, event_set, /) -- get_events($module, tool_id, /) -- register_callback($module, tool_id, event, func, /) -- get_tool($module, tool_id, /) -- free_tool_id($module, tool_id, /) -- use_tool_id($module, tool_id, name, /) -- source_hash($module, /, key, source) -- _fix_co_filename($module, code, path, /) -- Changes code.co_filename to specify the passed-in file path. code Code object to change. path File path to use.exec_builtin($module, mod, /) -- Initialize a built-in module.exec_dynamic($module, mod, /) -- Initialize an extension module.create_dynamic($module, spec, file=, /) -- Create an extension module._override_multi_interp_extensions_check($module, override, /) -- (internal-only) Override PyInterpreterConfig.check_multi_interp_extensions. (-1: "never", 1: "always", 0: no override)_override_frozen_modules_for_tests($module, override, /) -- (internal-only) Override PyConfig.use_frozen_modules. (-1: "off", 1: "on", 0: no override) See frozen_modules() in Lib/test/support/import_helper.py._frozen_module_names($module, /) -- Returns the list of available frozen modules.is_frozen($module, name, /) -- Returns True if the module name corresponds to a frozen module.is_builtin($module, name, /) -- Returns True if the module name corresponds to a built-in module.init_frozen($module, name, /) -- Initializes a frozen module.create_builtin($module, spec, /) -- Create an extension module.is_frozen_package($module, name, /) -- Returns True if the module name is of a frozen package.get_frozen_object($module, name, data=None, /) -- Create a code object for a frozen module.find_frozen($module, name, /, *, withdata=False) -- Return info about the corresponding frozen module (if there is one) or None. The returned info (a 2-tuple): * data the raw marshalled bytes * is_package whether or not it is a package * origname the originally frozen module's name, or None if not a stdlib module (this will usually be the same as the module's current name)release_lock($module, /) -- Release the interpreter's import lock. On platforms without threads, this function does nothing.acquire_lock($module, /) -- Acquires the interpreter's import lock for the current thread. This lock should be used by import hooks to ensure thread-safety when importing modules. On platforms without threads, this function does nothing.lock_held($module, /) -- Return True if the import lock is currently held, else False. On platforms without threads, return False.extension_suffixes($module, /) -- Returns the list of file suffixes used to identify extension modules.(Extremely) low-level import machinery bits as used by importlib. UnraisableHookArgs Type used to pass arguments to sys.unraisablehook.copy($self, /) -- Return a shallow copy of the context object.values($self, /) -- Return a list of all variables' values in the context object.keys($self, /) -- Return a list of all variables in the context object.items($self, /) -- Return all variables and their values in the context object. The result is returned as a list of 2-tuples (variable, value).get($self, key, default=None, /) -- Return the value for `key` if `key` has the value in the context object. If `key` does not exist, return `default`. If `default` is not given, return None.reset($self, token, /) -- Reset the context variable. The variable is reset to the value it had before the `ContextVar.set()` that created the token was used.set($self, value, /) -- Call to set a new value for the context variable in the current context. The required value argument is the new value for the context variable. Returns a Token object that can be used to restore the variable to its previous value via the `ContextVar.reset()` method.get($self, default=, /) -- Return a value for the context variable for the current context. If there is no value for the variable in the current context, the method will: * return the value of the default argument of the method, if provided; or * return the default value for the context variable, if it was created with one; or * raise a LookupError.filter(function or None, iterable) --> filter object Return an iterator yielding those items of iterable for which function(item) is true. If function is None, return the items that are true.map(func, *iterables) --> map object Make an iterator that computes the function using arguments from each of the iterables. Stops when the shortest iterable is exhausted.Set state information for unpickling.Return state information for pickling.zip(*iterables, strict=False) --> Yield tuples until an input is exhausted. >>> list(zip('abcdefg', range(3), range(4))) [('a', 0, 0), ('b', 1, 1), ('c', 2, 2)] The zip object yields n-length tuples, where n is the number of iterables passed as positional arguments to zip(). The i-th element in every tuple comes from the i-th iterable argument to zip(). This continues until the shortest argument is exhausted. If strict is true and one of the arguments is exhausted before the others, raise a ValueError.vars($module, object=, /) -- Show vars. Without arguments, equivalent to locals(). With an argument, equivalent to object.__dict__.sum($module, iterable, /, start=0) -- Return the sum of a 'start' value (default: 0) plus an iterable of numbers When the iterable is empty, return the start value. This function is intended specifically for use with numeric values and may reject non-numeric types.sorted($module, iterable, /, *, key=None, reverse=False) -- Return a new list containing all items from the iterable in ascending order. A custom key function can be supplied to customize the sort order, and the reverse flag can be set to request the result in descending order.setattr($module, obj, name, value, /) -- Sets the named attribute on the given object to the specified value. setattr(x, 'y', v) is equivalent to ``x.y = v``round($module, /, number, ndigits=None) -- Round a number to a given precision in decimal digits. The return value is an integer if ndigits is omitted or None. Otherwise the return value has the same type as the number. ndigits may be negative.repr($module, obj, /) -- Return the canonical string representation of the object. For many object types, including most builtins, eval(repr(obj)) == obj.print($module, /, *args, sep=' ', end='\n', file=None, flush=False) -- Prints the values to a stream, or to sys.stdout by default. sep string inserted between values, default a space. end string appended after the last value, default a newline. file a file-like object (stream); defaults to the current sys.stdout. flush whether to forcibly flush the stream.pow($module, /, base, exp, mod=None) -- Equivalent to base**exp with 2 arguments or base**exp % mod with 3 arguments Some types, such as ints, are able to use a more efficient algorithm when invoked using the three argument form.ord($module, c, /) -- Return the Unicode code point for a one-character string.oct($module, number, /) -- Return the octal representation of an integer. >>> oct(342391) '0o1234567'anext($module, aiterator, default=, /) -- async anext(aiterator[, default]) Return the next item from the async iterator. If default is given and the async iterator is exhausted, it is returned instead of raising StopAsyncIteration.next($module, iterator, default=, /) -- Return the next item from the iterator. If default is given and the iterator is exhausted, it is returned instead of raising StopIteration.min(iterable, *[, default=obj, key=func]) -> value min(arg1, arg2, *args, *[, key=func]) -> value With a single iterable argument, return its smallest item. The default keyword-only argument specifies an object to return if the provided iterable is empty. With two or more arguments, return the smallest argument.max(iterable, *[, default=obj, key=func]) -> value max(arg1, arg2, *args, *[, key=func]) -> value With a single iterable argument, return its biggest item. The default keyword-only argument specifies an object to return if the provided iterable is empty. With two or more arguments, return the largest argument.locals($module, /) -- Return a dictionary containing the current scope's local variables. NOTE: Whether or not updates to this dictionary will affect name lookups in the local scope and vice-versa is *implementation dependent* and not covered by any backwards compatibility guarantees.len($module, obj, /) -- Return the number of items in a container.aiter($module, async_iterable, /) -- Return an AsyncIterator for an AsyncIterable object.iter($module, object, sentinel=, /) -- Get an iterator from an object. In the first form, the argument must supply its own iterator, or be a sequence. In the second form, the callable is called until it returns the sentinel.issubclass($module, cls, class_or_tuple, /) -- Return whether 'cls' is derived from another class or is the same class. A tuple, as in ``issubclass(x, (A, B, ...))``, may be given as the target to check against. This is equivalent to ``issubclass(x, A) or issubclass(x, B) or ...``.isinstance($module, obj, class_or_tuple, /) -- Return whether an object is an instance of a class or of a subclass thereof. A tuple, as in ``isinstance(x, (A, B, ...))``, may be given as the target to check against. This is equivalent to ``isinstance(x, A) or isinstance(x, B) or ...`` etc.input($module, prompt='', /) -- Read a string from standard input. The trailing newline is stripped. The prompt string, if given, is printed to standard output without a trailing newline before reading input. If the user hits EOF (*nix: Ctrl-D, Windows: Ctrl-Z+Return), raise EOFError. On *nix systems, readline is used if available.id($module, obj, /) -- Return the identity of an object. This is guaranteed to be unique among simultaneously existing objects. (CPython uses the object's memory address.)hex($module, number, /) -- Return the hexadecimal representation of an integer. >>> hex(12648430) '0xc0ffee'hash($module, obj, /) -- Return the hash value for the given object. Two objects that compare equal must also have the same hash value, but the reverse is not necessarily true.hasattr($module, obj, name, /) -- Return whether the object has an attribute with the given name. This is done by calling getattr(obj, name) and catching AttributeError.globals($module, /) -- Return the dictionary containing the current scope's global variables. NOTE: Updates to this dictionary *will* affect name lookups in the current global scope and vice-versa.getattr($module, object, name, default=, /) -- Get a named attribute from an object. getattr(x, 'y') is equivalent to x.y When a default argument is given, it is returned when the attribute doesn't exist; without it, an exception is raised in that case.format($module, value, format_spec='', /) -- Return type(value).__format__(value, format_spec) Many built-in types implement format_spec according to the Format Specification Mini-language. See help('FORMATTING'). If type(value) does not supply a method named __format__ and format_spec is empty, then str(value) is returned. See also help('SPECIALMETHODS').exec($module, source, globals=None, locals=None, /, *, closure=None) -- Execute the given source in the context of globals and locals. The source may be a string representing one or more Python statements or a code object as returned by compile(). The globals must be a dictionary and locals can be any mapping, defaulting to the current globals and locals. If only globals is given, locals defaults to it. The closure must be a tuple of cellvars, and can only be used when source is a code object requiring exactly that many cellvars.eval($module, source, globals=None, locals=None, /) -- Evaluate the given source in the context of globals and locals. The source may be a string representing a Python expression or a code object as returned by compile(). The globals must be a dictionary and locals can be any mapping, defaulting to the current globals and locals. If only globals is given, locals defaults to it.divmod($module, x, y, /) -- Return the tuple (x//y, x%y). Invariant: div*y + mod == x.dir($module, arg=, /) -- Show attributes of an object. If called without an argument, return the names in the current scope. Else, return an alphabetized list of names comprising (some of) the attributes of the given object, and of attributes reachable from it. If the object supplies a method named __dir__, it will be used; otherwise the default dir() logic is used and returns: for a module object: the module's attributes. for a class object: its attributes, and recursively the attributes of its bases. for any other object: its attributes, its class's attributes, and recursively the attributes of its class's base classes.delattr($module, obj, name, /) -- Deletes the named attribute from the given object. delattr(x, 'y') is equivalent to ``del x.y``compile($module, /, source, filename, mode, flags=0, dont_inherit=False, optimize=-1, *, _feature_version=-1) -- Compile source into a code object that can be executed by exec() or eval(). The source code may represent a Python module, statement or expression. The filename will be used for run-time error messages. The mode must be 'exec' to compile a module, 'single' to compile a single (interactive) statement, or 'eval' to compile an expression. The flags argument, if present, controls which future statements influence the compilation of the code. The dont_inherit argument, if true, stops the compilation inheriting the effects of any future statements in effect in the code calling compile; if absent or false these statements do influence the compilation, in addition to any features explicitly specified.chr($module, i, /) -- Return a Unicode string of one character with ordinal i; 0 <= i <= 0x10ffff.callable($module, obj, /) -- Return whether the object is callable (i.e., some kind of function). Note that classes are callable, as are instances of classes with a __call__() method.breakpoint(*args, **kws) Call sys.breakpointhook(*args, **kws). sys.breakpointhook() must accept whatever arguments are passed. By default, this drops you into the pdb debugger.bin($module, number, /) -- Return the binary representation of an integer. >>> bin(2796202) '0b1010101010101010101010'ascii($module, obj, /) -- Return an ASCII-only representation of an object. As repr(), return a string containing a printable representation of an object, but escape the non-ASCII characters in the string returned by repr() using \\x, \\u or \\U escapes. This generates a string similar to that returned by repr() in Python 2.any($module, iterable, /) -- Return True if bool(x) is True for any x in the iterable. If the iterable is empty, return False.all($module, iterable, /) -- Return True if bool(x) is True for all values x in the iterable. If the iterable is empty, return True.abs($module, x, /) -- Return the absolute value of the argument.__import__($module, /, name, globals=None, locals=None, fromlist=(), level=0) -- Import a module. Because this function is meant for use by the Python interpreter and not for general use, it is better to use importlib.import_module() to programmatically import a module. The globals argument is only used to determine the context; they are not modified. The locals argument is unused. The fromlist should be a list of names to emulate ``from name import ...``, or an empty list to emulate ``import name``. When importing a module from a package, note that __import__('A.B', ...) returns package A when fromlist is empty, but its submodule B when fromlist is not empty. The level argument is used to determine whether to perform absolute or relative imports: 0 is absolute, while a positive number is the number of parent directories to search relative to the current module.__build_class__(func, name, /, *bases, [metaclass], **kwds) -> class Internal helper function used by the class statement.Built-in functions, types, exceptions, and other objects. This module provides direct access to all 'built-in' identifiers of Python; for example, builtins.len is the full name for the built-in function len(). This module is not normally accessed explicitly by most applications, but can be useful in modules that provide objects with the same name as a built-in value, but in which the built-in of that name is also needed._filters_mutated($module, /) -- warn_explicit($module, /, message, category, filename, lineno, module=, registry=None, module_globals=None, source=None) -- Issue a warning, or maybe ignore it or raise an exception.warn($module, /, message, category=None, stacklevel=1, source=None, *, skip_file_prefixes=) -- Issue a warning, or maybe ignore it or raise an exception. message Text of the warning message. category The Warning category subclass. Defaults to UserWarning. stacklevel How far up the call stack to make this warning appear. A value of 2 for example attributes the warning to the caller of the code calling warn(). source If supplied, the destroyed object which emitted a ResourceWarning skip_file_prefixes An optional tuple of module filename prefixes indicating frames to skip during stacklevel computations for stack frame attribution._warnings provides basic warning filtering support. It is a helper module to speed up interpreter start-up.ssSSSsi0InNsSj J Ee5R5pqrstuvwxyz{|}~24>A!B"B"J*cbKJh1H1tTw W y Y aAa`ssPRTVBB           (!)"*#+$,%-&.'/ (!)"*#+$,%-&.'/`haibjckdlemfngo`haibjckdlemfngopEEBBBBBEtEEBBBBBEBBBBBBBB|EEBBBBBEpqrstuvwxyz{|}~ffFFFffiFIFiflFLFlffiFFIFfifflFFLFflstSTStstSTSttvDFDvteD5DetkD;Dk~vNFNvtmD=Dm 0   ' ' '   g   gyy '' '   g '  g' g ''''O''''aa ''' '' '''''88 ''A' ' '  g''~'+*']'(*'?*?* '='E'G'** '** '** '.. '22 '33 '66 '55 'OO 'KK '11 '(( 'DD '// '-- ')) 'AA ')) '++ '** ')) '&& 'CC '** ' ''' ' '%% ' ' ' 7v 4t'&'%'@'?'!0! g ' '($0( g-+- g ' ''0.0 g313 g'646 g979 g '<:< g?=? g ' ''B@B g'P' '' '0' 'FC H g`' ' LJLgOMOgRPRgUSUgXVXg[Y[g^\^ga_agdbdggeggjhjgmkmgpnpgsqsgvtvgywyg|z|g}gggggggggggggggggggggggggggggggggggggggggggggg  g   g gggggg!!g$"$g'%'g*(*g-+-g0.0g313g646g979g<:<g?=?gB@BgECEgHFHgKIKgNLN gQOQ gTRT gWUW gZXZ g][] g`^` gcac gfdf gigi gljl gomo grpr gusu gxvx g@' ' '88 '|y | g~  g  g  g  g g g ''  g0 g0 g0 gJJ 'VV 'dd ' 'pp '~~ '  g  g  g  g  g  g  g  g Ag Ag Ag Ag Ag Ag   Ag  Ag  g  g" $ g(% * g.+ 0 g41 6 g:7 < g@= B gFC HAgLI NAgRO TAgXU ZAg^[ `Agda fAgjg lAgpm rAgvs x g|y ~ g  g  g  g  g  g  g Ag Ag Ag Ag Ag Ag Ag Ag  g  g  g  g0 g' Ag g  g    g   g  g0 g'%" 'Ag,(0, g3/03 g96 9 g?;0? g'FB0F gMI0M gSP S gXU X g^Z0^ g'da f gkh m gqn s gxu x g~z0 g'' Ag       'A''' '//$$ ''' ' '''''' 'u'Z'00 'Z'Z'Z'Z'Z'Z'Z'''Z'u'`` ' g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g   g    g g g g g g g" " g%#% g(&( g+)+ g.,. g1/1 g424 g757 g:8: g=;= g@>@ gCAC gFDF gIGI gLJL gOMO gRPR gUSU gXVX g[Y[ g^\^ ga_a gdbd ggeg gjhj gmkm gpnp gsqs gvtv gywy g}z  g  g  g0 g0 g  g  g  g  g  g  g  g(' ''' '"' '$  !"#$%&''()*'+,-./-01233344567666689:89:89:;<89:=>?@ABCCDEFGHIJKLLMNOLPQRSTUSVWUXYZ[\]\^\_``ab6cdeeeeeeeeefffffffeeffffffffffffeeeeeffgfh111ijkkklmmnopppqrsttuvwxxxyz{|}~???f666666666666666666666666666666666666666666666666666666666666666f6666666666 666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666ff66 66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666 666666666666666666666666666666666fff6666666666666666666666fff66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666f666666666666666666666666666666666666666666666666666666666666666666 f666666666666666666666666666666666666666666666666666666666666666666 666666666666666666666666666666666666666666666666666 6666666666666666666666666666666666666666666666666666666 66666666666666666666666666666666666666666666666666666 66666666666666666666666666666666666666 666666666666666666666666666666666666666666666666666666666 6666666666666666666666666666666666666666666666666666666 666666666666666666666666666666666666666666666666666666666666666 66666666666666666666666666666666666666666666666666666666666666666 6666666666666666666666666666666666666666666666666666666f 66666666666666666666666666666666666666666666666666f 66666 666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666 666666666666666666666666666666 e6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666f6  66666666666666666666666666666666666f66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666 666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666 6666666666666666666666666666666666666666666666666666666666666666666666666666  f6666666666666666666666666666666666666666666666666666666 66666666666666666666666666666666 66666666666666666666666666666666666666666666666666666666666666666666666666666666 666 666666666666666666666666666666ffffff6666666666666eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee                                                     !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGH  IIJKLMNOPQQQQRSTUV  WWXYZ~[\  ]]^_`abccddefeghijklefghijkleeeeeeeeeeeeexxxxxxxxxmxxxxxxnxopxxmxxqx6666xxxrssssssssssssssssttttttttttttttttghijklghijklghijkluuuuuuuuuuuuuuuuuuuuuuuuuuvvvvvvvvvvvvvvvvvvvvvvvvvvfghijklfghijklghijklghijklwxyz{|}~ee66666666666666666666666666666666666666666666666666666666f6666666666666666666666666666666666666666666666666666666666666666666666666666666f6ffffff666666666666666666666666666666666666666666666666666666666666666666666666666666666666666ff6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666fff6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666f666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666ffffff666666666666f6666666666666666 666fee6666666666666666666666666666666666666666666666666666666666666666666666fffffffffef6eee6ee6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666 666666666 6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666f 66666f666666666 666666666666666666666666666666666666666666666666666666666 6666666666666666f666666666666666666666666666666666666666666666666666666666666666666666f666666666666ff66666666666666666666666666666666eeeee66666666666666666666666666666666666 6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666 6666666666f666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666 666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666effeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666g6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666lllllllllllllllllllllllllllllllllllllllllllllllllllsssssssssssssssssssssssssssssssssssssssssssssssssss666666666666666666666666666666666666 ghijkl6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666ghijkl 6666666666666666666666666666666666666666666666666666666666666666666666666 666666666666666666666666666666666666 666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666 66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666 66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666 666666666666666666666666666666666666666666666666666666 6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666 66666666666666666666666666666666666666666666 666666666666666666666666666 666666666666666666666666666666666666666666666666666 666666666666666666666666666666666666666666666 6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666 666666666666666666666666666666666666666666666666666666666666666666666666666666 66666666666666666666666666666666666666666 6666666666666666666666666666666666666666666666666666666666666666666 666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666 6666666666666666666666666666666666666666666666666666666666666666666666666666666 666666666666666666666666666666666666666666666666666666666666666666666666666666ffff 66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666ffffffffffffffff66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666fffffffffffff66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx     6eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee666666666666666666666666666666666666666666666fffffff 666666666666666666666666666666666666666666666666666666666666666666666666666 666666666666666666666666666f 6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666f 666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666ffghijkl 666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666  !""#$%&'"""()*+,-./0123456789:;<=>?@@@@AB@@@@CD@@@@@@EFGHIJKL@MNOPQRS@@TU""""""V"""""W""""""""""""""""""""""""""""""""""""XYZ["""\"""]^"""""_"""`""""""""""abc""""""de""""""""f""""""""""""""g""""""""h""""d""""""""""""""""""""g""""""i""""""""""""""""jk"""""""""""""""""lm""""""""""""""""""n""""""""o""pqrstuvwxyz{"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""|}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~"}""}}}}}}""""""""}}}}}}}}}}}}}}}}}}}}""""""""}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}""""}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}""""}}}}""""""""""""""""""""""""""""""""""""""""""""""""""""""""}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}""""}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}@}@@@@}}}}}}}}}}}}}}}}}}}"}}}}}}}}}@@@@@@@@@}}}}}}}}"""""""""""""""V "  """""""""""""""""""""""""""""""""""""""""""""""" """"""""""" """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""}}}}}}}}}}}}}}}}}}}}}}}}" ""}}}}}}}}}}}""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}size($self, /) -- Return the size (in bytes) of this object.__sizeof__($self, /) -- Return the size of the string in memory, in bytes.maketrans(x, y=, z=, /) -- Return a translation table usable for str.translate(). If there is only one argument, it must be a dictionary mapping Unicode ordinals (integers) or characters to Unicode ordinals, strings or None. Character keys will be then converted to ordinals. If there are two arguments, they must be strings of equal length, and in the resulting dictionary, each character in x will be mapped to the character at the same position in y. If there is a third argument, it must be a string, whose characters will be mapped to None in the result.__format__($self, format_spec, /) -- Return a formatted version of the string as described by format_spec.S.format_map(mapping) -> str Return a formatted version of S, using substitutions from mapping. The substitutions are identified by braces ('{' and '}').S.format(*args, **kwargs) -> str Return a formatted version of S, using substitutions from args and kwargs. The substitutions are identified by braces ('{' and '}').zfill($self, width, /) -- Pad a numeric string with zeros on the left, to fill a field of the given width. The string is never truncated.isprintable($self, /) -- Return True if the string is printable, False otherwise. A string is printable if all of its characters are considered printable in repr() or if it is empty.isidentifier($self, /) -- Return True if the string is a valid Python identifier, False otherwise. Call keyword.iskeyword(s) to test whether string s is a reserved identifier, such as "def" or "class".isalnum($self, /) -- Return True if the string is an alpha-numeric string, False otherwise. A string is alpha-numeric if all characters in the string are alpha-numeric and there is at least one character in the string.isalpha($self, /) -- Return True if the string is an alphabetic string, False otherwise. A string is alphabetic if all characters in the string are alphabetic and there is at least one character in the string.isnumeric($self, /) -- Return True if the string is a numeric string, False otherwise. A string is numeric if all characters in the string are numeric and there is at least one character in the string.isdigit($self, /) -- Return True if the string is a digit string, False otherwise. A string is a digit string if all characters in the string are digits and there is at least one character in the string.isdecimal($self, /) -- Return True if the string is a decimal string, False otherwise. A string is a decimal string if all characters in the string are decimal and there is at least one character in the string.isspace($self, /) -- Return True if the string is a whitespace string, False otherwise. A string is whitespace if all characters in the string are whitespace and there is at least one character in the string.istitle($self, /) -- Return True if the string is a title-cased string, False otherwise. In a title-cased string, upper- and title-case characters may only follow uncased characters and lowercase characters only cased ones.isupper($self, /) -- Return True if the string is an uppercase string, False otherwise. A string is uppercase if all cased characters in the string are uppercase and there is at least one cased character in the string.islower($self, /) -- Return True if the string is a lowercase string, False otherwise. A string is lowercase if all cased characters in the string are lowercase and there is at least one cased character in the string.isascii($self, /) -- Return True if all characters in the string are ASCII, False otherwise. ASCII characters have code points in the range U+0000-U+007F. Empty string is ASCII too.removesuffix($self, suffix, /) -- Return a str with the given suffix string removed if present. If the string ends with the suffix string and that suffix is not empty, return string[:-len(suffix)]. Otherwise, return a copy of the original string.removeprefix($self, prefix, /) -- Return a str with the given prefix string removed if present. If the string starts with the prefix string, return string[len(prefix):]. Otherwise, return a copy of the original string.S.endswith(suffix[, start[, end]]) -> bool Return True if S ends with the specified suffix, False otherwise. With optional start, test S beginning at that position. With optional end, stop comparing S at that position. suffix can also be a tuple of strings to try.S.startswith(prefix[, start[, end]]) -> bool Return True if S starts with the specified prefix, False otherwise. With optional start, test S beginning at that position. With optional end, stop comparing S at that position. prefix can also be a tuple of strings to try.upper($self, /) -- Return a copy of the string converted to uppercase.translate($self, table, /) -- Replace each character in the string using the given translation table. table Translation table, which must be a mapping of Unicode ordinals to Unicode ordinals, strings, or None. The table must implement lookup/indexing via __getitem__, for instance a dictionary or list. If this operation raises LookupError, the character is left untouched. Characters mapped to None are deleted.swapcase($self, /) -- Convert uppercase characters to lowercase and lowercase characters to uppercase.strip($self, chars=None, /) -- Return a copy of the string with leading and trailing whitespace removed. If chars is given and not None, remove characters in chars instead.splitlines($self, /, keepends=False) -- Return a list of the lines in the string, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.rpartition($self, sep, /) -- Partition the string into three parts using the given separator. This will search for the separator in the string, starting at the end. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it. If the separator is not found, returns a 3-tuple containing two empty strings and the original string.rstrip($self, chars=None, /) -- Return a copy of the string with trailing whitespace removed. If chars is given and not None, remove characters in chars instead.rjust($self, width, fillchar=' ', /) -- Return a right-justified string of length width. Padding is done using the specified fill character (default is a space).S.rindex(sub[, start[, end]]) -> int Return the highest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation. Raises ValueError when the substring is not found.S.rfind(sub[, start[, end]]) -> int Return the highest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.lstrip($self, chars=None, /) -- Return a copy of the string with leading whitespace removed. If chars is given and not None, remove characters in chars instead.lower($self, /) -- Return a copy of the string converted to lowercase.ljust($self, width, fillchar=' ', /) -- Return a left-justified string of length width. Padding is done using the specified fill character (default is a space).S.index(sub[, start[, end]]) -> int Return the lowest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation. Raises ValueError when the substring is not found.partition($self, sep, /) -- Partition the string into three parts using the given separator. This will search for the separator in the string. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it. If the separator is not found, returns a 3-tuple containing the original string and two empty strings.S.find(sub[, start[, end]]) -> int Return the lowest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.expandtabs($self, /, tabsize=8) -- Return a copy where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.S.count(sub[, start[, end]]) -> int Return the number of non-overlapping occurrences of substring sub in string S[start:end]. Optional arguments start and end are interpreted as in slice notation.center($self, width, fillchar=' ', /) -- Return a centered string of length width. Padding is done using the specified fill character (default is a space).title($self, /) -- Return a version of the string where each word is titlecased. More specifically, words start with uppercased characters and all remaining cased characters have lower case.casefold($self, /) -- Return a version of the string suitable for caseless comparisons.capitalize($self, /) -- Return a capitalized version of the string. More specifically, make the first character have upper case and the rest lower case.join($self, iterable, /) -- Concatenate any number of strings. The string whose method is called is inserted in between each given string. The result is returned as a new string. Example: '.'.join(['ab', 'pq', 'rs']) -> 'ab.pq.rs'rsplit($self, /, sep=None, maxsplit=-1) -- Return a list of the substrings in the string, using sep as the separator string. sep The separator used to split the string. When set to None (the default value), will split on any whitespace character (including \n \r \t \f and spaces) and will discard empty strings from the result. maxsplit Maximum number of splits. -1 (the default value) means no limit. Splitting starts at the end of the string and works to the front.split($self, /, sep=None, maxsplit=-1) -- Return a list of the substrings in the string, using sep as the separator string. sep The separator used to split the string. When set to None (the default value), will split on any whitespace character (including \n \r \t \f and spaces) and will discard empty strings from the result. maxsplit Maximum number of splits. -1 (the default value) means no limit. Splitting starts at the front of the string and works to the end. Note, str.split() is mainly useful for data that has been intentionally delimited. With natural text that includes punctuation, consider using the regular expression module.replace($self, old, new, count=-1, /) -- Return a copy with all occurrences of substring old replaced by new. count Maximum number of occurrences to replace. -1 (the default value) means replace all occurrences. If the optional argument count is given, only the first count occurrences are replaced.encode($self, /, encoding='utf-8', errors='strict') -- Encode the string using the codec registered for encoding. encoding The encoding in which to encode the string. errors The error handling scheme to use for encoding errors. The default is 'strict' meaning that encoding errors raise a UnicodeEncodeError. Other possible values are 'ignore', 'replace' and 'xmlcharrefreplace' as well as any other name registered with codecs.register_error that can handle UnicodeEncodeErrors.str(object='') -> str str(bytes_or_buffer[, encoding[, errors]]) -> str Create a new string object from the given object. If encoding or errors is specified, then the object must expose a data buffer that will be decoded using the given encoding and error handler. Otherwise, returns the result of object.__str__() (if defined) or repr(object). encoding defaults to sys.getdefaultencoding(). errors defaults to 'strict'.Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).__reduce__($self, /) -- __typing_subst__($self, /, arg) -- Type variable. The preferred way to construct a type variable is via the dedicated syntax for generic functions, classes, and type aliases:: class Sequence[T]: # T is a TypeVar ... This syntax can also be used to create bound and constrained type variables:: # S is a TypeVar bound to str class StrSequence[S: str]: ... # A is a TypeVar constrained to str or bytes class StrOrBytesSequence[A: (str, bytes)]: ... However, if desired, reusable type variables can also be constructed manually, like so:: T = TypeVar('T') # Can be anything S = TypeVar('S', bound=str) # Can be any subtype of str A = TypeVar('A', str, bytes) # Must be exactly str or bytes Type variables exist primarily for the benefit of static type checkers. They serve as the parameters for generic types as well as for generic function and type alias definitions. The variance of type variables is inferred by type checkers when they are created through the type parameter syntax and when ``infer_variance=True`` is passed. Manually created type variables may be explicitly marked covariant or contravariant by passing ``covariant=True`` or ``contravariant=True``. By default, manually created type variables are invariant. See PEP 484 and PEP 695 for more details. The args for a ParamSpec object. Given a ParamSpec object P, P.args is an instance of ParamSpecArgs. ParamSpecArgs objects have a reference back to their ParamSpec:: >>> P = ParamSpec("P") >>> P.args.__origin__ is P True This type is meant for runtime introspection and has no special meaning to static type checkers. The kwargs for a ParamSpec object. Given a ParamSpec object P, P.kwargs is an instance of ParamSpecKwargs. ParamSpecKwargs objects have a reference back to their ParamSpec:: >>> P = ParamSpec("P") >>> P.kwargs.__origin__ is P True This type is meant for runtime introspection and has no special meaning to static type checkers. __reduce__($self, /) -- __typing_prepare_subst__($self, /, alias, args) -- __typing_subst__($self, /, arg) -- Parameter specification variable. The preferred way to construct a parameter specification is via the dedicated syntax for generic functions, classes, and type aliases, where the use of '**' creates a parameter specification:: type IntFunc[**P] = Callable[P, int] For compatibility with Python 3.11 and earlier, ParamSpec objects can also be created as follows:: P = ParamSpec('P') Parameter specification variables exist primarily for the benefit of static type checkers. They are used to forward the parameter types of one callable to another callable, a pattern commonly found in higher-order functions and decorators. They are only valid when used in ``Concatenate``, or as the first argument to ``Callable``, or as parameters for user-defined Generics. See class Generic for more information on generic types. An example for annotating a decorator:: def add_logging[**P, T](f: Callable[P, T]) -> Callable[P, T]: '''A type-safe decorator to add logging to a function.''' def inner(*args: P.args, **kwargs: P.kwargs) -> T: logging.info(f'{f.__name__} was called') return f(*args, **kwargs) return inner @add_logging def add_two(x: float, y: float) -> float: '''Add two numbers together.''' return x + y Parameter specification variables can be introspected. e.g.:: >>> P = ParamSpec("P") >>> P.__name__ 'P' Note that only parameter specification variables defined in the global scope can be pickled. __reduce__($self, /) -- __typing_prepare_subst__($self, /, alias, args) -- __typing_subst__($self, /, arg) -- Type variable tuple. A specialized form of type variable that enables variadic generics. The preferred way to construct a type variable tuple is via the dedicated syntax for generic functions, classes, and type aliases, where a single '*' indicates a type variable tuple:: def move_first_element_to_last[T, *Ts](tup: tuple[T, *Ts]) -> tuple[*Ts, T]: return (*tup[1:], tup[0]) For compatibility with Python 3.11 and earlier, TypeVarTuple objects can also be created as follows:: Ts = TypeVarTuple('Ts') # Can be given any name Just as a TypeVar (type variable) is a placeholder for a single type, a TypeVarTuple is a placeholder for an *arbitrary* number of types. For example, if we define a generic class using a TypeVarTuple:: class C[*Ts]: ... Then we can parameterize that class with an arbitrary number of type arguments:: C[int] # Fine C[int, str] # Also fine C[()] # Even this is fine For more details, see PEP 646. Note that only TypeVarTuples defined in the global scope can be pickled. __reduce__($self, /) -- Type alias. Type aliases are created through the type statement:: type Alias = int In this example, Alias and int will be treated equivalently by static type checkers. At runtime, Alias is an instance of TypeAliasType. The __name__ attribute holds the name of the type alias. The value of the type alias is stored in the __value__ attribute. It is evaluated lazily, so the value is computed only if the attribute is accessed. Type aliases can also be generic:: type ListOrSet[T] = list[T] | set[T] In this case, the type parameters of the alias are stored in the __type_params__ attribute. See PEP 695 for more information. Parameterizes a generic class. At least, parameterizing a generic class is the *main* thing this method does. For example, for some generic class `Foo`, this is called when we do `Foo[int]` - there, with `cls=Foo` and `params=int`. However, note that this method is also called when defining generic classes in the first place with `class Foo[T]: ...`. Abstract base class for generic types. On Python 3.12 and newer, generic classes implicitly inherit from Generic when they declare a parameter list after the class's name:: class Mapping[KT, VT]: def __getitem__(self, key: KT) -> VT: ... # Etc. On older versions of Python, however, generic classes have to explicitly inherit from Generic. After a class has been declared to be generic, it can then be used as follows:: def lookup_name[KT, VT](mapping: Mapping[KT, VT], key: KT, default: VT) -> VT: try: return mapping[key] except KeyError: return default __sizeof__($self, /) -- Return memory consumption of the type object.__dir__($self, /) -- Specialized __dir__ implementation for types.__subclasscheck__($self, subclass, /) -- Check if a class is a subclass.__instancecheck__($self, instance, /) -- Check if an object is an instance.__subclasses__($self, /) -- Return a list of immediate subclasses.mro($self, /) -- Return a type's method resolution order.type(object) -> the object's type type(name, bases, dict, **kwds) -> a new type__dir__($self, /) -- Default dir() implementation.__sizeof__($self, /) -- Size of object in memory, in bytes.__format__($self, format_spec, /) -- Default object formatter. Return str(self) if format_spec is empty. Raise TypeError otherwise.This method is called when a class is subclassed. The default implementation does nothing. It may be overridden to extend subclasses. Abstract classes can override this to customize issubclass(). This is invoked early on by abc.ABCMeta.__subclasscheck__(). It should return True, False or NotImplemented. If it returns NotImplemented, the normal algorithm is used. Otherwise, it overrides the normal algorithm (and the outcome is cached). __getstate__($self, /) -- Helper for pickle.__reduce__($self, /) -- Helper for pickle.__reduce_ex__($self, protocol, /) -- Helper for pickle.object() -- The base class of the class hierarchy. When called, it accepts no arguments and returns a new featureless instance that has no instance attributes and cannot be given any. super() -> same as super(__class__, ) super(type) -> unbound super object super(type, obj) -> bound super object; requires isinstance(obj, type) super(type, type2) -> bound super object; requires issubclass(type2, type) Typical use to call a cooperative superclass method: class C(B): def meth(self, arg): super().meth(arg) This works for class methods too: class C(B): @classmethod def cmeth(cls, arg): super().cmeth(arg) count($self, value, /) -- Return number of occurrences of value.index($self, value, start=0, stop=sys.maxsize, /) -- Return first index of value. Raises ValueError if the value is not present.__getnewargs__($self, /) -- tuple(iterable=(), /) -- Built-in immutable sequence. If no argument is given, the constructor returns an empty tuple. If iterable is specified the tuple is initialized from iterable's items. If the argument is a tuple, the return value is the same object.Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).Return state information for pickling.S.indices(len) -> (start, stop, stride) Assuming a sequence of length len, calculate the start and stop indices, and the stride length of the extended slice described by S. Out of bounds indices are clipped in a manner consistent with the handling of normal slices.slice(stop) slice(start, stop[, step]) Create a slice object. This is used for extended slicing (e.g. a[0:10:2]).Private method returning an estimate of len(list(it)).Update a set with the union of itself and others.Update a set with the symmetric difference of itself and another.Remove an element from a set; it must be a member. If the element is not a member, raise a KeyError.Remove and return an arbitrary set element. Raises KeyError if the set is empty.Update a set with the intersection of itself and another.Remove all elements of another set from this set.Remove an element from a set if it is a member. Unlike set.remove(), the discard() method does not raise an exception when an element is missing from the set.Remove all elements from this set.Add an element to a set. This has no effect if the element is already present.set() -> new empty set object set(iterable) -> new set object Build an unordered collection of unique elements.Return the union of sets as a new set. (i.e. all elements that are in either set.)Return the symmetric difference of two sets as a new set. (i.e. all elements that are in exactly one of the sets.)S.__sizeof__() -> size of S in memory, in bytesReturn state information for pickling.issuperset($self, other, /) -- Test whether every element in other is in the set.issubset($self, other, /) -- Test whether every element in the set is in other.Return True if two sets have a null intersection.Return the intersection of two sets as a new set. (i.e. all elements that are in both sets.)Return the difference of two or more sets as a new set. (i.e. all elements that are in this set but not the others.)Return a shallow copy of a set.x.__contains__(y) <==> y in x.frozenset() -> empty frozenset object frozenset(iterable) -> frozenset object Build an immutable unordered collection of unique elements.rangeobject.index(value) -> integer -- return index of value. Raise ValueError if the value is not present.rangeobject.count(value) -> integer -- return number of occurrences of valueReturn a reverse iterator.range(stop) -> range object range(start, stop[, step]) -> range object Return an object that produces a sequence of integers from start (inclusive) to stop (exclusive) by step. range(i, j) produces i, i+1, i+2, ..., j-1. start defaults to 0, and stop is omitted! range(4) produces 0, 1, 2, 3. These are exactly the valid indices for a list of 4 elements. When step is given, it specifies the increment (or decrement).Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).release($self, /) -- Release the underlying buffer exposed by the PickleBuffer object.raw($self, /) -- Return a memoryview of the raw memory underlying this buffer. Will raise BufferError is the buffer isn't contiguous.Return state information for picklingA simple attribute-based namespace. SimpleNamespace(**kwargs)module(name, doc=None) -- Create a module object. The name must be a string; the optional doc argument can have any type.A bool indicating whether the memory is contiguous.A bool indicating whether the memory is Fortran contiguous.A bool indicating whether the memory is C contiguous.A tuple of integers used internally for PIL-style arrays.A tuple of ndim integers giving the size in bytes to access each element for each dimension of the array.A tuple of ndim integers giving the shape of the memory as an N-dimensional array.An integer indicating how many dimensions of a multi-dimensional array the memory represents.A string containing the format (in struct module style) for each element in the view.The size in bytes of each element of the memoryview.A bool indicating whether the memory is read only.The amount of space in bytes that the array would use in a contiguous representation.The underlying object of the memoryview._from_flags($type, /, object, flags) -- Create a new memoryview object which references the given object.toreadonly($self, /) -- Return a readonly version of the memoryview.cast($self, /, format, shape=) -- Cast a memoryview to a new format or shape.tolist($self, /) -- Return the data in the buffer as a list of elements.hex($self, /, sep=, bytes_per_sep=1) -- Return the data in the buffer as a str of hexadecimal numbers. sep An optional single character or byte to separate hex bytes. bytes_per_sep How many bytes between separators. Positive values count from the right, negative values count from the left. Example: >>> value = memoryview(b'\xb9\x01\xef') >>> value.hex() 'b901ef' >>> value.hex(':') 'b9:01:ef' >>> value.hex(':', 2) 'b9:01ef' >>> value.hex(':', -2) 'b901:ef'tobytes($self, /, order='C') -- Return the data in the buffer as a byte string. Order can be {'C', 'F', 'A'}. When order is 'C' or 'F', the data of the original array is converted to C or Fortran order. For contiguous views, 'A' returns an exact copy of the physical memory. In particular, in-memory Fortran order is preserved. For non-contiguous views, the data is converted to C first. order=None is the same as order='C'.release($self, /) -- Release the underlying buffer exposed by the memoryview object.memoryview(object) -- Create a new memoryview object which references the given object.move_to_end($self, /, key, last=True) -- Move an existing element to the end (or beginning if last is false). Raise KeyError if the element does not exist.od.__reversed__() <==> reversed(od)od.copy() -> a shallow copy of odod.clear() -> None. Remove all items from od.popitem($self, /, last=True) -- Remove and return a (key, value) pair from the dictionary. Pairs are returned in LIFO order if last is true or FIFO order if false.pop($self, /, key, default=) -- od.pop(key[,default]) -> v, remove specified key and return the corresponding value. If the key is not found, return the default if given; otherwise, raise a KeyError.setdefault($self, /, key, default=None) -- Insert key with a value of default if key is not in the dictionary. Return the value for key if key is in the dictionary, else default.Return state information for picklingfromkeys($type, /, iterable, value=None) -- Create a new ordered dictionary with keys from iterable and values set to value.Dictionary that remembers insertion orderReturn state information for pickling__reversed__($self, /) -- Return a reverse iterator over the dict keys.D.copy() -> a shallow copy of DD.clear() -> None. Remove all items from D.fromkeys($type, iterable, value=None, /) -- Create a new dictionary with keys from iterable and values set to value.D.update([E, ]**F) -> None. Update D from dict/iterable E and F. If E is present and has a .keys() method, then does: for k in E: D[k] = E[k] If E is present and lacks a .keys() method, then does: for k, v in E: D[k] = v In either case, this is followed by: for k in F: D[k] = F[k]D.values() -> an object providing a view on D's valuesD.items() -> a set-like object providing a view on D's itemsD.keys() -> a set-like object providing a view on D's keyspopitem($self, /) -- Remove and return a (key, value) pair as a 2-tuple. Pairs are returned in LIFO (last-in, first-out) order. Raises KeyError if the dict is empty.pop($self, key, default=, /) -- D.pop(k[,d]) -> v, remove specified key and return the corresponding value. If the key is not found, return the default if given; otherwise, raise a KeyError.setdefault($self, key, default=None, /) -- Insert key with a value of default if key is not in the dictionary. Return the value for key if key is in the dictionary, else default.get($self, key, default=None, /) -- Return the value for key if key is in the dictionary, else default.D.__sizeof__() -> size of D in memory, in bytes__getitem__($self, key, /) -- Return self[key].__contains__($self, key, /) -- True if the dictionary has the specified key, else False.dict() -> new empty dictionary dict(mapping) -> new dictionary initialized from a mapping object's (key, value) pairs dict(iterable) -> new dictionary initialized as if via: d = {} for k, v in iterable: d[k] = v dict(**kwargs) -> new dictionary initialized with the name=value pairs in the keyword argument list. For example: dict(one=1, two=2)Return state information for pickling.Private method returning an estimate of len(list(it)).Return a reverse iterator over the dict keys.Return a reverse iterator over the dict items.Return True if the view and the given iterable have a null intersection.Return a reverse iterator over the dict values.is_integer($self, /) -- Returns True. Exists for duck type compatibility with float.is_integer.__sizeof__($self, /) -- Returns size in memory, in bytes.__format__($self, format_spec, /) -- Convert to a string according to format_spec.__getnewargs__($self, /) -- __round__($self, ndigits=, /) -- Rounding an Integral returns itself. Rounding with an ndigits argument also returns an integer.as_integer_ratio($self, /) -- Return a pair of integers, whose ratio is equal to the original int. The ratio is in lowest terms and has a positive denominator. >>> (10).as_integer_ratio() (10, 1) >>> (-10).as_integer_ratio() (-10, 1) >>> (0).as_integer_ratio() (0, 1)from_bytes($type, /, bytes, byteorder='big', *, signed=False) -- Return the integer represented by the given array of bytes. bytes Holds the array of bytes to convert. The argument must either support the buffer protocol or be an iterable object producing bytes. Bytes and bytearray are examples of built-in objects that support the buffer protocol. byteorder The byte order used to represent the integer. If byteorder is 'big', the most significant byte is at the beginning of the byte array. If byteorder is 'little', the most significant byte is at the end of the byte array. To request the native byte order of the host system, use `sys.byteorder' as the byte order value. Default is to use 'big'. signed Indicates whether two's complement is used to represent the integer.to_bytes($self, /, length=1, byteorder='big', *, signed=False) -- Return an array of bytes representing an integer. length Length of bytes object to use. An OverflowError is raised if the integer is not representable with the given number of bytes. Default is length 1. byteorder The byte order used to represent the integer. If byteorder is 'big', the most significant byte is at the beginning of the byte array. If byteorder is 'little', the most significant byte is at the end of the byte array. To request the native byte order of the host system, use `sys.byteorder' as the byte order value. Default is to use 'big'. signed Determines whether two's complement is used to represent the integer. If signed is False and a negative integer is given, an OverflowError is raised.bit_count($self, /) -- Number of ones in the binary representation of the absolute value of self. Also known as the population count. >>> bin(13) '0b1101' >>> (13).bit_count() 3bit_length($self, /) -- Number of bits necessary to represent self in binary. >>> bin(37) '0b100101' >>> (37).bit_length() 6int([x]) -> integer int(x, base=10) -> integer Convert a number or string to an integer, or return 0 if no arguments are given. If x is a number, return x.__int__(). For floating-point numbers, this truncates towards zero. If x is not a number or if base is given, then x must be a string, bytes, or bytearray instance representing an integer literal in the given base. The literal can be preceded by '+' or '-' and be surrounded by whitespace. The base defaults to 10. Valid bases are 0 and 2-36. Base 0 means to interpret the base from the string as an integer literal. >>> int('0b100', base=0) 4sys.int_info A named tuple that holds information about Python's internal representation of integers. The attributes are read only.sort($self, /, *, key=None, reverse=False) -- Sort the list in ascending order and return None. The sort is in-place (i.e. the list itself is modified) and stable (i.e. the order of two equal elements is maintained). If a key function is given, apply it once to each list item and sort them, ascending or descending, according to their function values. The reverse flag can be set to sort in descending order.reverse($self, /) -- Reverse *IN PLACE*.count($self, value, /) -- Return number of occurrences of value.index($self, value, start=0, stop=sys.maxsize, /) -- Return first index of value. Raises ValueError if the value is not present.remove($self, value, /) -- Remove first occurrence of value. Raises ValueError if the value is not present.pop($self, index=-1, /) -- Remove and return item at index (default last). Raises IndexError if list is empty or index is out of range.extend($self, iterable, /) -- Extend list by appending elements from the iterable.insert($self, index, object, /) -- Insert object before index.append($self, object, /) -- Append object to the end of the list.copy($self, /) -- Return a shallow copy of the list.clear($self, /) -- Remove all items from list.__sizeof__($self, /) -- Return the size of the list in memory, in bytes.__reversed__($self, /) -- Return a reverse iterator over the list.list(iterable=(), /) -- Built-in mutable sequence. If no argument is given, the constructor creates a new empty list. The argument must be an iterable if specified.Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).Set state information for unpickling.Private method returning an estimate of len(list(it)).Return state information for pickling.close() -> raise GeneratorExit inside generator.throw(value) throw(typ[,val[,tb]]) raise exception in the wrapped iterator, return next yielded value or raise StopIteration. the (type, val, tb) signature is deprecated, and may be removed in a future version of Python.send(arg) -> send 'arg' into the wrapped iterator, return next yielded value or raise StopIteration.A interpreter ID identifies a interpreter and may be used as an int.function(code, globals, name=None, argdefs=None, closure=None) -- Create a function object. code a code object globals the globals dictionary name a string that overrides the name from the code object argdefs a tuple that specifies the default argument values closure a tuple that supplies the bindings for free variablesclassmethod(function) -> method Convert a function to be a class method. A class method receives the class as implicit first argument, just like an instance method receives the instance. To declare a class method, use this idiom: class C: @classmethod def f(cls, arg1, arg2, argN): ... It can be called either on the class (e.g. C.f()) or on an instance (e.g. C().f()). The instance is ignored except for its class. If a class method is called for a derived class, the derived class object is passed as the implied first argument. Class methods are different than C++ or Java static methods. If you want those, see the staticmethod builtin.staticmethod(function) -> method Convert a function to be a static method. A static method does not receive an implicit first argument. To declare a static method, use this idiom: class C: @staticmethod def f(arg1, arg2, argN): ... It can be called either on the class (e.g. C.f()) or on an instance (e.g. C().f()). Both the class and the instance are ignored, and neither is passed implicitly as the first argument to the method. Static methods in Python are similar to those found in Java or C++. For a more advanced concept, see the classmethod builtin.F.__sizeof__() -> size of F in memory, in bytesF.clear(): clear most references held by the framesys.float_info A named tuple holding information about the float type. It contains low level information about the precision and internal representation. Please study your system's :file:`float.h` for more information.__format__($self, format_spec, /) -- Formats the float according to format_spec.__getformat__($type, typestr, /) -- You probably don't want to use this function. typestr Must be 'double' or 'float'. It exists mainly to be used in Python's test suite. This function returns whichever of 'unknown', 'IEEE, big-endian' or 'IEEE, little-endian' best describes the format of floating-point numbers used by the C type named by typestr.__getnewargs__($self, /) -- is_integer($self, /) -- Return True if the float is an integer.hex($self, /) -- Return a hexadecimal representation of a floating-point number. >>> (-0.1).hex() '-0x1.999999999999ap-4' >>> 3.14159.hex() '0x1.921f9f01b866ep+1'fromhex($type, string, /) -- Create a floating-point number from a hexadecimal string. >>> float.fromhex('0x1.ffffp10') 2047.984375 >>> float.fromhex('-0x1p-1074') -5e-324as_integer_ratio($self, /) -- Return a pair of integers, whose ratio is exactly equal to the original float. The ratio is in lowest terms and has a positive denominator. Raise OverflowError on infinities and a ValueError on NaNs. >>> (10.0).as_integer_ratio() (10, 1) >>> (0.0).as_integer_ratio() (0, 1) >>> (-.25).as_integer_ratio() (-1, 4)__round__($self, ndigits=None, /) -- Return the Integral closest to x, rounding half toward even. When an argument is passed, work like built-in round(x, ndigits).__ceil__($self, /) -- Return the ceiling as an Integral.__floor__($self, /) -- Return the floor as an Integral.__trunc__($self, /) -- Return the Integral closest to x between 0 and x.conjugate($self, /) -- Return self, the complex conjugate of any float.float(x=0, /) -- Convert a string or number to a floating-point number, if possible.close() -> raise GeneratorExit inside coroutine.throw(value) throw(type[,value[,traceback]]) Raise exception in coroutine, return next iterated value or raise StopIteration. the (type, val, tb) signature is deprecated, and may be removed in a future version of Python.send(arg) -> send 'arg' into coroutine, return next iterated value or raise StopIteration.gen.__sizeof__() -> size of gen in memory, in bytesaclose() -> raise GeneratorExit inside generator.athrow(value) athrow(type[,value[,tb]]) raise exception in generator. the (type, val, tb) signature is deprecated, and may be removed in a future version of Python.asend(v) -> send 'v' in generator.close() -> raise GeneratorExit inside generator.throw(value) throw(type[,value[,tb]]) Raise exception in generator, return next yielded value or raise StopIteration. the (type, val, tb) signature is deprecated, and may be removed in a future version of Python.send(arg) -> send 'arg' into generator, return next yielded value or raise StopIteration.Represent a PEP 585 generic type E.g. for t = list[int], t.__origin__ is list and t.__args__ is (int,).Exception.add_note(note) -- add a note to the exceptionException.with_traceback(tb) -- set self.__traceback__ to tb and return self.enumerate(iterable, start=0) -- Return an enumerate object. iterable an object supporting iteration The enumerate object yields pairs containing a count (from start, which defaults to zero) and a value yielded by the iterable argument. enumerate is useful for obtaining an indexed list: (0, seq[0]), (1, seq[1]), (2, seq[2]), ...Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).reversed(sequence, /) -- Return a reverse iterator over the values of the given sequence.Method to set name of a property.Descriptor to obtain a copy of the property with a different deleter.Descriptor to obtain a copy of the property with a different setter.Descriptor to obtain a copy of the property with a different getter.property(fget=None, fset=None, fdel=None, doc=None) -- Property attribute. fget function to be used for getting an attribute value fset function to be used for setting an attribute value fdel function to be used for del'ing an attribute doc docstring Typical use is to define a managed attribute x: class C(object): def getx(self): return self._x def setx(self, value): self._x = value def delx(self): del self._x x = property(getx, setx, delx, "I'm the 'x' property.") Decorators make defining new properties or modifying existing ones easy: class C(object): @property def x(self): "I am the 'x' property." return self._x @x.setter def x(self, value): self._x = value @x.deleter def x(self): del self._x__format__($self, format_spec, /) -- Convert to a string according to format_spec.__getnewargs__($self, /) -- __complex__($self, /) -- Convert this value to exact type complex.conjugate($self, /) -- Return the complex conjugate of its argument. (3-4j).conjugate() == 3+4j.complex(real=0, imag=0) -- Create a complex number from a string or numbers. If a string is given, parse it as a complex number. If a single number is given, convert it to a complex number. If the 'real' or 'imag' arguments are given, create a complex number with the specified real and imaginary components._varname_from_oparg($self, /, oparg) -- (internal-only) Return the local variable name for the given oparg. WARNING: this method is for internal use only and may change or go away.replace($self, /, **changes) -- Return a copy of the code object with new values for the specified fields.code(argcount, posonlyargcount, kwonlyargcount, nlocals, stacksize, flags, codestring, constants, names, varnames, filename, name, qualname, firstlineno, linetable, exceptiontable, freevars=(), cellvars=(), /) -- Create a code object. Not for the faint of heart.__reduce__($self, /) -- method(function, instance, /) -- Create a bound instance method object.instancemethod(function, /) -- Bind a function to a class.cell([contents]) -- Create a new cell object. contents the contents of the cell. If not specified, the cell will be empty, and further attempts to access its cell_contents attribute will raise a ValueError.Capsule objects let you wrap a C "void *" pointer in a Python object. They're a way of passing data through the Python interpreter without creating your own custom type. Capsules are used for communication between extension modules. They provide a way for an extension module to export a C interface to other extension modules, so that extension modules can use the Python import mechanism to link to one another. zfill($self, width, /) -- Pad a numeric string with zeros on the left, to fill a field of the given width. The original string is never truncated.translate($self, table, /, delete=b'') -- Return a copy with each character mapped by the given translation table. table Translation table, which must be a bytes object of length 256. All characters occurring in the optional argument delete are removed. The remaining characters are mapped through the given translation table.strip($self, bytes=None, /) -- Strip leading and trailing bytes contained in the argument. If the argument is omitted or None, strip leading and trailing ASCII whitespace.splitlines($self, /, keepends=False) -- Return a list of the lines in the bytes, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.split($self, /, sep=None, maxsplit=-1) -- Return a list of the sections in the bytes, using sep as the delimiter. sep The delimiter according which to split the bytes. None (the default value) means split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). maxsplit Maximum number of splits to do. -1 (the default value) means no limit.rstrip($self, bytes=None, /) -- Strip trailing bytes contained in the argument. If the argument is omitted or None, strip trailing ASCII whitespace.rsplit($self, /, sep=None, maxsplit=-1) -- Return a list of the sections in the bytes, using sep as the delimiter. sep The delimiter according which to split the bytes. None (the default value) means split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). maxsplit Maximum number of splits to do. -1 (the default value) means no limit. Splitting is done starting at the end of the bytes and working to the front.rpartition($self, sep, /) -- Partition the bytes into three parts using the given separator. This will search for the separator sep in the bytes, starting at the end. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it. If the separator is not found, returns a 3-tuple containing two empty bytes objects and the original bytes object.rjust($self, width, fillchar=b' ', /) -- Return a right-justified string of length width. Padding is done using the specified fill character.removesuffix($self, suffix, /) -- Return a bytes object with the given suffix string removed if present. If the bytes ends with the suffix string and that suffix is not empty, return bytes[:-len(prefix)]. Otherwise, return a copy of the original bytes.removeprefix($self, prefix, /) -- Return a bytes object with the given prefix string removed if present. If the bytes starts with the prefix string, return bytes[len(prefix):]. Otherwise, return a copy of the original bytes.replace($self, old, new, count=-1, /) -- Return a copy with all occurrences of substring old replaced by new. count Maximum number of occurrences to replace. -1 (the default value) means replace all occurrences. If the optional argument count is given, only the first count occurrences are replaced.partition($self, sep, /) -- Partition the bytes into three parts using the given separator. This will search for the separator sep in the bytes. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it. If the separator is not found, returns a 3-tuple containing the original bytes object and two empty bytes objects.maketrans(frm, to, /) -- Return a translation table useable for the bytes or bytearray translate method. The returned table will be one where each byte in frm is mapped to the byte at the same position in to. The bytes objects frm and to must be of the same length.lstrip($self, bytes=None, /) -- Strip leading bytes contained in the argument. If the argument is omitted or None, strip leading ASCII whitespace.ljust($self, width, fillchar=b' ', /) -- Return a left-justified string of length width. Padding is done using the specified fill character.join($self, iterable_of_bytes, /) -- Concatenate any number of bytes objects. The bytes whose method is called is inserted in between each pair. The result is returned as a new bytes object. Example: b'.'.join([b'ab', b'pq', b'rs']) -> b'ab.pq.rs'.hex($self, /, sep=, bytes_per_sep=1) -- Create a string of hexadecimal numbers from a bytes object. sep An optional single character or byte to separate hex bytes. bytes_per_sep How many bytes between separators. Positive values count from the right, negative values count from the left. Example: >>> value = b'\xb9\x01\xef' >>> value.hex() 'b901ef' >>> value.hex(':') 'b9:01:ef' >>> value.hex(':', 2) 'b9:01ef' >>> value.hex(':', -2) 'b901:ef'fromhex($type, string, /) -- Create a bytes object from a string of hexadecimal numbers. Spaces between two numbers are accepted. Example: bytes.fromhex('B9 01EF') -> b'\\xb9\\x01\\xef'.expandtabs($self, /, tabsize=8) -- Return a copy where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.decode($self, /, encoding='utf-8', errors='strict') -- Decode the bytes using the codec registered for encoding. encoding The encoding with which to decode the bytes. errors The error handling scheme to use for the handling of decoding errors. The default is 'strict' meaning that decoding errors raise a UnicodeDecodeError. Other possible values are 'ignore' and 'replace' as well as any other name registered with codecs.register_error that can handle UnicodeDecodeErrors.center($self, width, fillchar=b' ', /) -- Return a centered string of length width. Padding is done using the specified fill character.__bytes__($self, /) -- Convert this value to exact type bytes.bytes(iterable_of_ints) -> bytes bytes(string, encoding[, errors]) -> bytes bytes(bytes_or_buffer) -> immutable copy of bytes_or_buffer bytes(int) -> bytes object of size given by the parameter initialized with null bytes bytes() -> empty bytes object Construct an immutable array of bytes from: - an iterable yielding integers in range(256) - a text string encoded using the specified encoding - any object implementing the buffer API. - an integerSet state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).zfill($self, width, /) -- Pad a numeric string with zeros on the left, to fill a field of the given width. The original string is never truncated.translate($self, table, /, delete=b'') -- Return a copy with each character mapped by the given translation table. table Translation table, which must be a bytes object of length 256. All characters occurring in the optional argument delete are removed. The remaining characters are mapped through the given translation table.strip($self, bytes=None, /) -- Strip leading and trailing bytes contained in the argument. If the argument is omitted or None, strip leading and trailing ASCII whitespace.splitlines($self, /, keepends=False) -- Return a list of the lines in the bytearray, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.split($self, /, sep=None, maxsplit=-1) -- Return a list of the sections in the bytearray, using sep as the delimiter. sep The delimiter according which to split the bytearray. None (the default value) means split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). maxsplit Maximum number of splits to do. -1 (the default value) means no limit.rstrip($self, bytes=None, /) -- Strip trailing bytes contained in the argument. If the argument is omitted or None, strip trailing ASCII whitespace.rsplit($self, /, sep=None, maxsplit=-1) -- Return a list of the sections in the bytearray, using sep as the delimiter. sep The delimiter according which to split the bytearray. None (the default value) means split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). maxsplit Maximum number of splits to do. -1 (the default value) means no limit. Splitting is done starting at the end of the bytearray and working to the front.rpartition($self, sep, /) -- Partition the bytearray into three parts using the given separator. This will search for the separator sep in the bytearray, starting at the end. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it as new bytearray objects. If the separator is not found, returns a 3-tuple containing two empty bytearray objects and the copy of the original bytearray object.rjust($self, width, fillchar=b' ', /) -- Return a right-justified string of length width. Padding is done using the specified fill character.reverse($self, /) -- Reverse the order of the values in B in place.removesuffix($self, suffix, /) -- Return a bytearray with the given suffix string removed if present. If the bytearray ends with the suffix string and that suffix is not empty, return bytearray[:-len(suffix)]. Otherwise, return a copy of the original bytearray.removeprefix($self, prefix, /) -- Return a bytearray with the given prefix string removed if present. If the bytearray starts with the prefix string, return bytearray[len(prefix):]. Otherwise, return a copy of the original bytearray.replace($self, old, new, count=-1, /) -- Return a copy with all occurrences of substring old replaced by new. count Maximum number of occurrences to replace. -1 (the default value) means replace all occurrences. If the optional argument count is given, only the first count occurrences are replaced.remove($self, value, /) -- Remove the first occurrence of a value in the bytearray. value The value to remove.pop($self, index=-1, /) -- Remove and return a single item from B. index The index from where to remove the item. -1 (the default value) means remove the last item. If no index argument is given, will pop the last item.partition($self, sep, /) -- Partition the bytearray into three parts using the given separator. This will search for the separator sep in the bytearray. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it as new bytearray objects. If the separator is not found, returns a 3-tuple containing the copy of the original bytearray object and two empty bytearray objects.maketrans(frm, to, /) -- Return a translation table useable for the bytes or bytearray translate method. The returned table will be one where each byte in frm is mapped to the byte at the same position in to. The bytes objects frm and to must be of the same length.lstrip($self, bytes=None, /) -- Strip leading bytes contained in the argument. If the argument is omitted or None, strip leading ASCII whitespace.ljust($self, width, fillchar=b' ', /) -- Return a left-justified string of length width. Padding is done using the specified fill character.join($self, iterable_of_bytes, /) -- Concatenate any number of bytes/bytearray objects. The bytearray whose method is called is inserted in between each pair. The result is returned as a new bytearray object.insert($self, index, item, /) -- Insert a single item into the bytearray before the given index. index The index where the value is to be inserted. item The item to be inserted.hex($self, /, sep=, bytes_per_sep=1) -- Create a string of hexadecimal numbers from a bytearray object. sep An optional single character or byte to separate hex bytes. bytes_per_sep How many bytes between separators. Positive values count from the right, negative values count from the left. Example: >>> value = bytearray([0xb9, 0x01, 0xef]) >>> value.hex() 'b901ef' >>> value.hex(':') 'b9:01:ef' >>> value.hex(':', 2) 'b9:01ef' >>> value.hex(':', -2) 'b901:ef'fromhex($type, string, /) -- Create a bytearray object from a string of hexadecimal numbers. Spaces between two numbers are accepted. Example: bytearray.fromhex('B9 01EF') -> bytearray(b'\\xb9\\x01\\xef')extend($self, iterable_of_ints, /) -- Append all the items from the iterator or sequence to the end of the bytearray. iterable_of_ints The iterable of items to append.expandtabs($self, /, tabsize=8) -- Return a copy where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.decode($self, /, encoding='utf-8', errors='strict') -- Decode the bytearray using the codec registered for encoding. encoding The encoding with which to decode the bytearray. errors The error handling scheme to use for the handling of decoding errors. The default is 'strict' meaning that decoding errors raise a UnicodeDecodeError. Other possible values are 'ignore' and 'replace' as well as any other name registered with codecs.register_error that can handle UnicodeDecodeErrors.copy($self, /) -- Return a copy of B.clear($self, /) -- Remove all items from the bytearray.center($self, width, fillchar=b' ', /) -- Return a centered string of length width. Padding is done using the specified fill character.append($self, item, /) -- Append a single item to the end of the bytearray. item The item to be appended.__sizeof__($self, /) -- Returns the size of the bytearray object in memory, in bytes.__reduce_ex__($self, proto=0, /) -- Return state information for pickling.B.__alloc__() -> int Return the number of bytes actually allocated.bytearray(iterable_of_ints) -> bytearray bytearray(string, encoding[, errors]) -> bytearray bytearray(bytes_or_buffer) -> mutable copy of bytes_or_buffer bytearray(int) -> bytes array of size given by the parameter initialized with null bytes bytearray() -> empty bytes array Construct a mutable bytearray object from: - an iterable yielding integers in range(256) - a text string encoded using the specified encoding - a bytes or a buffer object - any object implementing the buffer API. - an integerSet state information for unpickling.__reduce__($self, /) -- Return state information for pickling.Private method returning an estimate of len(list(it)).B.isspace() -> bool Return True if all characters in B are whitespace and there is at least one character in B, False otherwise.B.isalpha() -> bool Return True if all characters in B are alphabetic and there is at least one character in B, False otherwise.B.isalnum() -> bool Return True if all characters in B are alphanumeric and there is at least one character in B, False otherwise.B.isascii() -> bool Return True if B is empty or all characters in B are ASCII, False otherwise.B.isdigit() -> bool Return True if all characters in B are digits and there is at least one character in B, False otherwise.B.islower() -> bool Return True if all cased characters in B are lowercase and there is at least one cased character in B, False otherwise.B.isupper() -> bool Return True if all cased characters in B are uppercase and there is at least one cased character in B, False otherwise.B.istitle() -> bool Return True if B is a titlecased string and there is at least one character in B, i.e. uppercase characters may only follow uncased characters and lowercase characters only cased ones. Return False otherwise.B.lower() -> copy of B Return a copy of B with all ASCII characters converted to lowercase.B.upper() -> copy of B Return a copy of B with all ASCII characters converted to uppercase.B.title() -> copy of B Return a titlecased version of B, i.e. ASCII words start with uppercase characters, all remaining cased characters have lowercase.B.capitalize() -> copy of B Return a copy of B with only its first character capitalized (ASCII) and the rest lower-cased.B.swapcase() -> copy of B Return a copy of B with uppercase ASCII characters converted to lowercase ASCII and vice versa.B.find(sub[, start[, end]]) -> int Return the lowest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.B.index(sub[, start[, end]]) -> int Return the lowest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation. Raises ValueError when the subsection is not found.B.rfind(sub[, start[, end]]) -> int Return the highest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.B.rindex(sub[, start[, end]]) -> int Return the highest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation. Raise ValueError when the subsection is not found.B.count(sub[, start[, end]]) -> int Return the number of non-overlapping occurrences of subsection sub in bytes B[start:end]. Optional arguments start and end are interpreted as in slice notation.B.startswith(prefix[, start[, end]]) -> bool Return True if B starts with the specified prefix, False otherwise. With optional start, test B beginning at that position. With optional end, stop comparing B at that position. prefix can also be a tuple of bytes to try.B.endswith(suffix[, start[, end]]) -> bool Return True if B ends with the specified suffix, False otherwise. With optional start, test B beginning at that position. With optional end, stop comparing B at that position. suffix can also be a tuple of bytes to try.bool(x) -> bool Returns True when the argument x is true, False otherwise. The builtins True and False are the only two instances of the class bool. The class bool is a subclass of the class int, and cannot be subclassed. ( )    Y ?>  & .B : & .> 5?55?5? P ^4@ _Bi?qq????$I$I???y??mB????aCoc?`(?yPD?<;ܿpP܍$X$ %+0;|N؏a8p{ ddĒh T̄D8@ |t) 23L3x34ԡ5|55t50$6$H67d78h88Ե888x 94`9@t99d9Ȼ9D:8:Tl:\:l: :;$@;;>H?\?p????@@??,?@?Tp@xAAA$BBB0HCTCxDEE4FXG|G\II|J`KPL@Ld M4M8M >D4?p???@4BB<HHIILJJ4KlKN$NXN\N`N0lNDxNXxOxPQlR4SSULUpV<\p\4^L^|xabb b b4bL(ep4fgghhk4hlplpmm  o<Lplhplpqrhr rD8shsttu`vPwD$xlLxly,z0{$}~  4xl||$ 8 $L @` \t d l    T !0!$T!lx!t!!!`!"H"\"0"\"""##(#P#tt#H#4#@#L#X$d$̌8$p$$ $$x%L%t%p%,%&$0&X&h&$&&'H'|x'p''(Ģ,(بX(P((( ),P)d|))L)*d4*(d****@+8+h\++T+`+++ ,H,h,<,,<, -`0-@T--t- -l-@.h.\...@/p=?=?=(A=,A>@G@>\Ht>`H>H>,L>L?trP@rBrCsD?@A<BPETFFؗhGH$H\,J8M(NN8O@OpPPP̙PQQ8QTQ0pQDQXR|RTTؚT`U\VDXt^H^؛P^^b\ccd̜dde,e8de\fnn TrLls,ttȞtuXvv8Hw`y@zz`{|(|Hd}hHXp,<t|<$ء8H̉|L4HXl`Ԑpģ|أБ4$,Tx X̖H$ЗHLtؙlȥĜ0xd8p 44ȦX̧<(T,lШP @(l̰pĩP Lx|DĪ ܷ48dPԫ Dl,L@4 4Hh44P8`0Į$(H\<ԯp@4t$(Hhh@ȱ(H\h4Ȳp(@Hhp(Tt  4`t8DĵPص$Dh@̶@`xx4ܷHl`L4` Թ  , P|@ĺXLx,`Lp D! ""0#`|$D% &Խ''H)@*t+t,<-/00P0p012p: ;L 8?@@hAlCtCDD$ETEh FG I J@JdJK4?88AxBpDF H<@IlJMO xRDU@W4Y[$\Xac`d,f0ghjhmo(q8spt(xHyT x>x `B B B B B C@ hDl pD F hG I KH Mx N HO O HP( PL R S DUU8tV\8X[[]p^t^_`a$d(fTfixjkklDnPrTtu,yȀd܀xT`|d l X<T,|p@ĩ84hp ЯLD$0Hth8 @P`\td08HPL , \\ (   D!L$!`X!ll!x!!!\"H"0p""" "#`(#H#l##@#`#0# $<$`$8$$$D%<%`%%% &L&|&&@&L '0'@`','P''@(l((@ X( |( ( ( ( ) @) d)P ) ))T)*P**** +@+h x+ +!+#,0%H,T',),*,,4--\-T0-81-9,.9T.:.=.>/4?,/?d/?x/?/?/B/4C0C,0C@0E|0F0 F0(F00F0F 1F 1F41FH1F\1Fp14H1I1I1J2LD2xNp2|$> ܶ4Xhxظ,(XHx@ThL`HXtL X|HTxxH  ( 8pT8`t($ p !$'h)H*|+(.T//40XH112h3$3H(@HBLEtElFH(HM4N\XR8T,U<"?(d@\+@1AlCBxCBH@CKCKCXLDxPEQ0E(U\FxY G,[m(?n?8nH@n@n(EnHoLKpOqQq RqThrXUrUshVtV$tlXdu[v \v]$w]pwX^wH_wx_w_wl`x8eyeyezgTzhzXi\{hi{lL|k>l>(sl?(t?8t?t@uL@TB C,LC\XCpDExFXHlhHHHhIl,J8KHO(RxSS (T TPTdZ4ZH\x(a,cdexf gPhiij(klLm(mH>>?(? @4@xX@@@@,AH P>zRx Q0,R< @4RHA BNd`R|XR`C@S A RpA BX,RADT A R4hSAABAB@?K>aK A A>B A (LTtA DWLTpA S A lT`C@S A @,U A&%B$#E"!E M A ,VA` D CY A ,WA` D CW A 00XxA0BCR A DDdPXADCY A Bc A EBACS A $YAP D] A ZZt \[pC CL A [hA BF A DpDX 4l[`A0BEICA0B [HA BL A \8A BJ8\,4C G A 4\DA:9D43G12C78K56B/0BABIA876543210/:9HA78A56A12A/0s ABAA ZN8765210/KA BB BAB8765210/c$cLA0CN,c,AILcH`cA` B EJWN A AK J AU 8eA0FT A `eBP BDBSCP T A L A P4fdCKcMBHAFAAAABAB\h AD B B Gi A A A Lj A ABM B ihA BG A j ADGM E SA^A DB QAR A AC C$kDA BI A 4kA@BBCI A D4 l8DF A (L<l<PlDA` BBD Cv A (odA0CR A ppXAP A 0DpA` D FVK A AC$ qdACRQBPOKMNCGHVKLkIJ\CFBK A AMNAKLAIJAGHD AB M AB MDFLKJIOG B kUKLL C EKLKE G L E H vdA BU, wA` B E A ( z4A BI4L {AP BIXJ A CD t|A65D.-B,+Y34B/0t12wNBMA43210/.-,+65| C KA34A12A/0 D Q C c C ^UK43210/CK43210/ A L LC N A ,l ȕAp D C S A $ HA0Da A 0 A` F U A A A BF l0 h<A` E Cu A @ tT dtC0V A $t A0Ec A  Pl BЀABDHkMAЀC B ENA A F0@ B CBCc A t @($ \(AD A A, dAD C R A < AP BDBPGH A PF L4 HAP DR A l<A BH A 04Cp F C] A $C Z A I ABJk A FD  TAAB A A A PIDHDIDIDIDIDKVI G D ] HS FW V BC Q AAA L A ,T@Ap B E  A dA0DP A (ԫdA BM F B 0pA BX T`A"!f A $xPA@CM A  A DBIECQAAK A CL BAA LA\BH BAA AAS B E B HIAJV B C B HCAAAJ$|PA BL A 0 $,A` B T A \԰A@IDCZDA@XBE A F A A B @A"!f A dCFEGAIAA SAB VAAA A A AM BAA P E pN BAA I Q AB S AA ,$DAAHGBFEEDY A Th|LHD(AP CDGdFAP X(DA BJ A B 08A BJT04CF B tD$HA Eu A ($>DA0CCZ A ,P>IpA BJ A M>xAN A 0>IB IHS HA GH >0JA ET A >J@ ?A0BIKCA0IGAC0P?TJtA0CBL A I(?0,A0BCc A ?4FD?P?PP?LA@CGn A H A N B F A L@lAM A <l@ B"DDJd_A"JLP B NUCVZD~IORZFYD A PX A BC P HDFXJ[BI A CBEhDNBGB$AA CT A ADHA"!q A LAHADF X CA j BB KI A A HBPK,B0H<hBAD B C CW A ,BK|A BS A GHBlKA@BDIAA@JA@H$CKP(8CL,A0Fg A \dCPAp B D [ A BR B } A N A DvNCB A B0CA BU A ] A CA Bb A 0DhA W A C A BN BA PD(|ZD(pDJhA0CK A IPDXHAp B C E` A \ A LDTTABDCC A W A JMPA A @EdJX(TEDA EO A I EA0BG A EA@BKatVAA@TMBA@^KHSCC@AE$HADBHFQ BCA JAMAA8@DA@CBz A \ C |wXA BPl4xHAP DFSCSALAP _ BB QRGBF8AP DINFAP BUO BBA GB BA AAGQFBABC D C B 4PH A C\ A S A M$̒(IPA Da A 0ypAP A (yA@DCb A @$z\AB C H ABMHBBAEA  GMR B ADGMBAA ABD C BBB RB C BBA GA A A BAAB BBAAA 0PtHA"!O Dl A |HPA` D EDCSiCBEA`  y B QGTG B TAK A d$DA@DHBdBDA@J BA A BB G BA C BC Dx|AF\ A A B C r AAB FNFA A A AOIAI|A` D T A OMAHq AAAB E BAAA A AAAC A BAAB BAAADXBABCEBKRJ Ap D F u A aNAXYbI_ C B B VM C RBBTE AA ABBb A H C GM BC BBHl BAB A AB E AAA ABA(lA0CC` A ԗTT8Ap D IB b]BACAp  QHgAFXDBC H B KBAB YA BAA AAF CBB ($A0BBT A 0̘WpA BO A C A PdA0DH` B WEA0WIB B CT hlXTD BJ A xXA@DIBxBDA@d BB u BA D BB OBHC BC \ hTA BO A T@AP CDCCIBBAA A HABAA<A0BFJEA0EDKTؚlA@BK A ADMABI AB ABAAD0A@BECHBB A HABLx@ZC@DCd A HA@lțA@DJJdCDA@NGc A VcFi C ^A(8\A@DCb A d@[A B_4ܐA0DIWEA0N,`A@BCDM0D[<A0BCoC A JL$AP BECCHBBC A HABAlt\A@DJUPZEA@SZEKFEBA F K B ABXAP DEIDQBFAP [BAC0@^AP BDCe A t^<A@DIBIHL BIHDA eIHDCA@HIVHIHHIC BIHD K BIHD CBIH$A DY A ,,hA0CCY A \TAP DHB\BDAP _WhBAEEBCIFFBAABABKC$_A DX A ,lA0D] A PlA` D IHNG[BACDA`  VBECCB C EGHCGBLؗAP BECCGBBB A HABAD<,A@BECIBD A HAB0_A0D[ A S A `LA@DHB_BDA@K BA H BA EBHCB,-`A BP A C@LL`A0DIgEA0M B E h`A BK A 0lA0BEI A H`^A@DJ[EMDA@GPGIE B A A ABPLxlAP DFi A kKB A I E INTO A C B CX_DAp F J i A Q AA lCOATCSBt8lA@DHB}BDA@K BA ZBECBEE BB t0ТH` cA@DIBQBEA@p BA FBHE BB CBdAP DEIDQBFAP TBGBAC4hA@BI A GNE A d?A` B ^ A 0pD CQ A wC <?A0BFXCA0A(0@A` D IHSbACEA`  BIGH A GBBEG C AAALCHHIAp C R A BH _BE BBD AALAAp  ABAA >dJ>J<>A0CGOC A YC C A<>JtA@CClPH A yCEC$8?NA B\ A `?OA FJ A ?O\BL A ?0d?T,?ȣ0CO A HA ?OpA BT A l @AB DC B AAAACA BAA$@O@AE A H0@OA BU A H A @LPtA0CF A (APA0DC] A A CU A $?A0D] A ,(?`A0BCK A pX? A` D Ho AA Y A O AA CI A AAAG]JG A C A K B F BXA BJ A B,BAC,8BApD C K A $hDpD CG A ,D\D BL A C $E@A BJ A $@EA`C Be A GLAB D BE[FA Fo B BYPLHLR A DNa C Q A O A MT`K B F} A UkHcHFR A aH|X  X xXA` B DGBH{AADA`  JAABH AAA DEBA,[ACBBs A `]TAM A ]PAH A $]TAM A D^,X](A87D65B43p A ^ ,^A0BC[ A h_,8_ACE M A bADCD D O MAEA U BA Z AA EA B IG c AA @(f<A0CF^BA A HO BA FB<$gA@BECHBC A HAB0DEK4PAp B G s A $ gA CQ A g gAEPgAP BEDI^BC A CAB A C,8\i$BDC [ A hPn,AFQFCoBALAIAACAAB AAA F BBA A BAA HoA@BDGHDA@J A DdpHA BL A hp0|\EpACB D KCNAMA [AABBDN AA d$tAP CFCCIBBCF A HABAAAG<uA@BECHBC A HAB u0A BHHuA@BDGZD A FP A A B K A H A H<8w<AE A ,\XwXA BN A CwDLD wA Be A Dx 4xA B\ A x(0A0DCC,HpxxA BQ A H,xxdA BQ A C4xA0BB\ A JTty(E@BEB[MGACA@(8LzA@BHd A d|($x|A B A TA Bl A  ,A Cb A FxpPG<0PAP DBCc A  dAOHI HIA N JA JJFJA JD F JC EJLJHJEJHJ\JH JC GJEJQ JC v JA D JA t JC S JA M JA R JA O JA H\HMhABBCGAAE A [ A TA BA cFHAe BA EFHApeHBABFPFG A DC A C BA m BA vO A KJJnmd BA KHBCQ B psCECBGCGA A 0A@BBDX(PtA0BCZ A |د<A CJDC0BCS A NB0H|A@BCC\D A JC FB A4@,HAB B DH nI A R AE cH(,@ ,\(8@A0CFF A (A,<(A\AE C BA A (CP(CA@BDFuHA@AZJ A $H)\EA Bq A p)FDA CL,)4FpA BT A C$)tFdKD C F)F,*FtA BU A CT0*GpAP BDBJdEAP PJA A * H *HC.-G)*C+,B'(M#$M%&AAAAHA,+*)('&%$#.-GGBAAB+,A)*A'(A%&A#$S A [C&%LC&%$#bC,+*)('&%$#C BAAAA KHBAAA,+*)('&%$#.-U B M A d0+N\A@BBBg A 4+OA0BFT CA IB( ,HPA0BBT A (L,P(A0CBX A x,QXADEW E A DAANA EB m BAA JA A A yKD JAA0-UhBQ A ,P-UDA BI A C-U8-UApC B BM[P A RJC$-(WA@Fd A ,-WA0BD\ A 0(.lXA` CD Bw A 0\.AP DCBt.Y .Y@A BJ A .Y$.A0D_ A (/YA0BCX A \0/\Ap CD I D A MfzAWG B C]E B CxH$/YA@E_ A T/Z A@BBRRHA@HBA A D80D[ABH` A <L0_LA@DCQ A y A ~,0CP FCg A 40aAP CZ A A A IHB80bA BI A J A E A 01b,,D1cAP D\ A t1c1cAp BC C bA_BBDAp  SAAA HAYAF B FDH CD A peBDBAA X2Lh ,l2HhBDB J A 2(jxAP CDDuEAP U A C A E^ABF B N A D A IAP AA e AA UBACF AA M AA hP3mADCG X A A A A Z PD D eR A C SA03

A0BDN A I A 8H>@A@GP A F A FW_A B 4>A0BCP A K A 0>ACBCX A >|?A` BC BATBABDA`  LABD A a A I,?ЋXA BN A C?4?A@BCO A R A <@Ԍ|APCBc A A A FPUD B A0@@lA@CP A RRTC A Dt@PAP BQ^P A AAHA A H B IEC,@xA BV A C8@A F A DDAA A(ALdC R A HANG(hA A` D CX A 0A`A BN A B A (AA0BC[ A AtA CW C BAC 8B̮HA BI A \BHA BI A $BhdAJ B KBAE(B4ADCk A `BAC B G m A O A nmUJ A A B H A Q B H A J A C^DXClCܗA@BC`CA@IMAAA A C AA F B F A I A EAA@FN BA DA DX$ DHAE ^ A HDК \Dܚ4pD ACB G TTiFB[AMA CAAK AA t A G A I A G A ~ A O A I^ A D A H A H A H A KgH4EP4HELdA0BCM A D<ExA0BHWEA0B B A$EA B] A E\EXF8HJG0FdtAK A 8PFA BV A I A F A E4FACB B C  A F PLG8FPAP BDBC[ A $ G(A@CB] A $HGA Bc A pGԦHA` BDD AQpPsAADA`  MAAB BSeEOBABA DAAA Bl4H`dAQ A H A I B A B B A K A A C E B A B A B E B DH@<A0BKkBHCA0] A F A H IAC,+B*)B('L%&QH"C#$HAAHL A A%&A#$AH"IAHCB&%$#H"K AHA KHeQ&%GE&%(IAP GHU A \IpA0CDqCAA0I CA I BC G BA RCJܰ8,JhA@Ep A b4hJ<A0CBt A SJijDKE JA EY A J A B`K(K 0K2A@DravBAAA@FAABI BAA A BAA C BAA A BAA C BAA F BAA F BAA A BAA C BAA FBAAFBAA BAA C BAA F BAA F BAA A BAA CBAAF BA F BA A BA CBAA BAA C BAA A BAA CBAAA BA C BA A BA C BA F BA F BA A BA CBAF B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B F B A B C B F B A B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B CBA BA CBAA B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C B A B C,UA0BB_ A 0VH|A`C BEs A 4VAC D BAN AADA BAA DAAJ CAAAB V dVA@BBHsACA@ABB@IAKXW,lWB$#D"!C BaA[BT A AA\ABA AA zT AA qIH AA E AA g AA D AA XAC F cHOAHDA CREHZAAAHB D A A A CHEBHA FB CDHNHABAA AAHJHABA HHX BAAHA D AAAHA @YL#Ap C C DCY A \Y40pYHAC\[BZYCXWBVj A ,Y`A BP A C$Y|A BJ A Yh\ZXACRQBLKKJCOPBMNfAAJ A AOPAMNAJL BAA OBApZAW A ZZ Z|A@Bf A $ZHA EW A [A@BDFiAA@KA@O AA D AA MA[ 0[A CJ B ] A [hC U A [0\lA BQ A C A $<\(0A B| A d\0 x\0LA BE A T\XdA0FRS C JD A DA0FBL\d@,]dA DL D C8]DAL A X]0l]DQ A H A CB ]|~A@Di]0|C T A ]TAp D I NCeAFB kAAJ A A AALGG AA OAKQKI BJ A EL AA A A G A GAu AA 4^"A0BCK A K A ^\" _L"00 _h"tA0BCR A CT_"A ] A t_P#A [ A _#<GG,_$\A@FBf A X_0%AC C GGCM A Af B I A PR] A @@`t(pA@BBV A Rg A AD`) D`dA` D BBP A LJECZA(`T)ApC B Cn A a+<Ap BF GFAp  \SOQOSOKOIT A [ A  B a;pTG,aA@BBCb A ,j>A BT A HLjL?dB@U A lj?A<;M9:D78C56B34C12}AAAAH A A9:A78A56A34A12f BAAAA OH:987654321|kEBC Q C B^BACA BB J BAA k0I(k IpA GH A J<kdItA` B CCCCa A lJ,lJA0CP A xHl KxAp C NR DMAK A A JQAC AG B DA AAO A A B M A BlM lMAE8lMAP BBG A DP B Y B 4mtNAEU A H A A A A I GJ Y YEBKAADA GGJ A H A HA J AAA A AE AA F B E AEA K JIBA EG L BAA N@n$RTn RTLHtnTRn\R`4nRA0BCSC A HBnS4Dn0SlA0BGr AA HG B G B At0oTTAI A Q hH AAA I GFH C A A A AABBA C(oUTA BF A JoV,oVA@REH A ALEFpVDT,pVAB B D BBZ A B A pY@ pY,A CFpY ,pYxA@CCp A q4\ @q0\t$AC C D C_ A ,Xq`\A@CDq A q$qhC U A q<AK A 4qA CN A K A EDrd,A@DMUIA@A\rHDAL A |rADrLrADr$AD(r$4A&%F$#B"~ A s jtC Y0C0z@@AN0@ @@XATH@XAT<@XAT\@XAT|@XAT((AA@DB_(BA@DB_$D$A@EB(EA@EBbHF ,\|FA0DX A IF FXA BR0GA` D BEHfHH H( H@AP EBG LIA@Df pHJA Ca$JA0BDj\KC r LA0Ck LA Be $0MA Be HM|A B[ lN|A B[ `N|A B[ N8A@F(P A0Dy A H QA B_ ((RA CgLRxVEl SB` xSA Bm TA BmTBg@UAb,UDA@EDHH0DWxA@BBB,x\LCP ECHH $^DC0EHD_dAW_dAW( _8A0BCG8`,CGX`,CGx`dG aA B]aAf`bAd bDA CL$ bA@BCHcBc hddPA BP d8A DH d8A DH d8A DH d@A BL d@A BL @e@A BL d e`A BT\exGGeTKH ehA DT,fxGG, f ADCBx<`g Plgdlg$ x|gA D` gA D^\h LhA D^ hA D^ $iA D^@i TiA D^ xiA D^ XjA De$ A D_ A jA D^$  A DY A 4jA Dl XkA De |(lA D^l(l@ADBnAaoBb xoA w @dxAp B D CDO `>A Bc >\A BS,>LHA@CID4>dA BP A N A C(?<A BH A B(DAL A BXWp>,AB B H Hd HA XH$X@D4AH A B,@XLDA` E DHfH,pXE`A CHI HA IHPXFAECCHm HA j HA SH$XHA C@YI40YIDYI XYIBD pYI<A` E  YK A` E |YLAP vYXMA` rYNA` rZN(,ZNPA0BC8XZP`ADCC L0ZQA0BCR A G0Z@RA0BCR A G0ZRA0BCR A G,0[R,BDC A,`[S,BDC A[T[T@[T,AP CDCG A w [UhA BV \UhA BV D\@VhA BV h\VhA BV \VhA BV$\ WAE n4\WA0CK A W(] XLAECI(<]@YA@DCs$h]ZA@DCl]Z(AG0]Z A@ECt A I0][A0BBP A Y,^0\A@BCBx0H^]PABF`|^h|AP DJDDRABE A BTCBAEF(^^,A@DCB __`A BT$0__tA0BDU4X_D`A0DDo A D _aA DZ _`aB@Dz _@bA DZ _bB@Dy$ `xcpA0BBVH`c\`cp`c`c`c`c`c `c `cTA DO adTA BQ 0a@d@A EI Ta\dB LU xadHA BNadadHJG ae`A BT aDeDA GH$bde$AD B A(@b`e`A CI A Ilbe beHA BN be,A BF be,A BF be`A BTce $ce8ce $LceA0BEt tcfxE CU cfA Bq,cgA BR A dcdh d\h dTh (dLh 4A@BCBD ?A D` \@A D`4(@$A0CGx A D`BlAY4CA0CG` A DDlAY0؍DTBP JH F$ EXA@F0H HA@CGi0|HAP CHx IA D` ԎJlA DU(\JlA0CV $KlA GR HKlA GR l,LA D{  M`A GO$HMA0BD\ ܏MXA FNM M (M (<MLA0CN$hNA0EF^<pOAB E vА,Q\A@U hQA FXQ8(QdC@U0H,RAp B C Dq,|R\A DL A DS\C@S<̑PSABC G x Ȗ8AH ,UA Er$PU|A0CZ xW<A BK<4WB0CBI A _ A C ܒWDB GG WdB GO $,XA@Dz HYXA BR(lHA BN?Ap,d@xA@BECRD @AA"!B GB A `h\D$CE`D$CE dDtA BY(DA@F\ B D 0E`A BT lE|A CZ@E$CE`E(tEA0Co4`FPAE C BxH$|HA0CCdLIlA0CFG C w A J A Cd J(AG4(JA0CFr A C0JB HD C N A B4LKTA0BCJ A C (hLA B\(LL@A BH A C xLA Bd TMA Dl,MHA BJ A C$NA0BBaN $,|NA@EC{ThOd4hOA0DX B H B I8LP0AD B B B,@RlA@DU, |StA@D0<UA@D,p|XA@Dv,=H=D<;E:9876b,<A:9D87E654s lxA BZtA[ ,A Bc TA CP$ dA0BBS,HA`E BCr x\A BS$XAP B B8@AN X8AFFltA[(|C [ HA B^(l|A` D CV A B_,8BDF X Ap F Z Ap E m4PA R0TdAp I H I JJHI( B@Fg$xADX,8A@CDE A&%D$\$0\A&%E$#j XA&%D$_L|hA0EH B E A H A g 4A@De A@De4DA CS B C A C(L,A`E BB@(x@A`E BBE,\AN B A B BA0ErA0Er,XTA BK B DD|C s(d8A0EV A L(A0EU A L(,A0EU A L,A0Ef A J(TA0EU A L(DA0EU A L,pD A0Ef A J C b$l 4AF B CDx dG@BBBBH HA FH$0 4AF B C,X \AN B A B B4 AC B E z4XA@FB A K4DA@EBu A R40A@EBw A d$h4A@E}C c0 A@EBl A R,A@Ek A J,HA@Ek A J$D A@EBwlC g(pTA`C BCK$APEBw$pA`E B~(dPA`C BCJ$4A@EBw$\`xC Q A H$A` G }$xC Q A H$xC Q A H0$P<08 A0DHX B Gl$AW B H$hAS C B$8PA BP ` Ap D b  Ap D _ @L!0A BH0dX!AP DC\@"PADC D ,&A` E CY  (C0g,(hC VL(lC0Wl@)lC0W)lC0W)lC0W$*lC0Wp*lC0W *lC0W,+lC0WLT+lC0Wl+lC0W+lC0W8,lC0W,lC0W,hC V -hC V,`-hC VL-hC Vl-hC V8.hC V$.AP DBx,X/`A@BDP00\A0BDK A C80 (L0A`C BCm4xX2A0BCV A R(2APCBCZ(D4A`C BCx( 5A0BD 47`A BT(X7A0BB`P8D8$88pA0BBV8 x8 p8`A BT 848H8@AN h8A C^ 9A Bi(9A0BD^:::$ :A0BC[ @l:dA BU4d:lAp D E  <\A0DQ>A m>A mP?A m ?A m(@@TAP DCL lAA@Dp dBA0Bx 0CA0Dj8C(ACC E =HA j 4HIA0Bw(XJ`A`E BC(DL@A0BCDXNAP BCCH A l( Q BDCy($Q BDCy PRA0Ha(tTSA@DC|  &>0A CG &?<D CG &?0A CG<'$?AP DBB` A K4@'@A@DBR A J4x'BA@DBR A J@'tC AABI z'PI ((HIAP DB_$4(JA@Ei0\(PKA@BEw((LlA`C BCQ (\MA0Ei((MLAP DBK$ )O4APEBD44)$PPABFCG l)P0ACBG~(l><A0BC_(>xA@EWH>C0CCBH_ HA E HA EH ?A Bf44?E BbK C4l?A0BC[ A D,?A Db A C@?lADC E HIJ JHI@A"!m8@XA i X@lC BU |@,lC BU(@tC Cn A C0@,tC CL B C B C0Al|C CO A C B C(4A\C CL A C`AtA8AC CM B C B C B C(A\C CL A CAD(B4\C CL A C00BdC CP B C B C(dBC C_ D C B<C@Dy BC@D$B(C@DB CdC BS$CT(8CDCP DC|(dC44C0BDC(C<HC0BDH(CXlC0BDQ CpC BVT DhC@CFL A J A j A JLdDC0CEK A I A ^ A DDTD(C@CFK A J A ` A E< Ex C0CEX C W A D0`ED C CR C B E C4E C Cj C F H C$E DC@DILE PC0CEX B Z B M A D0DF A0BDV A D0xF A0BCn A D0FA0BDV A D$FA0BDoG8CH,(GpA BL A K4XGCDE i(G`A BH A K0G`ADD(G\A BG A K(H@dC CL C C@HHxADBF  HA Bf<HPLAC^]F\[ZYXWVUTSH\+,$It+XBN B C(,I+$A0CBB0XI,AC B D 0I@/APABBCd0I/A@BBD|(I0PA&%B$#G"I$ J1XAp E O,HJ2A@Fr xJ3hA BV8J3Ap D K C(J7A0BB[K7K7,K7 @K7A Bd(dKT8A0BBmK8,K8A&%I$#"!C V,KH:hA&%I$#"!C L8L;lAp B C BC(@L=A$#C"!H o,lLt?DC` E CE4L@AP BEZLAAkLpB@@MBAP BF[ A J LMCA D_4pMCAP DEh MEA DpPM<A@DJATBFA@MBHHB8 N|EA` D FeP\N<A@DJATBFA@MBHHBNtAP DEIVGAP dS A MJTBCG B FKCBA$4O,FA0DC^ \OFA D_8OGA` D Fe(OHA0DC OLKA D]\ PAP DENTRgG A GCEH AA BH B A A GplPH<AP DELWRTHAP NBFFGBLA4PJ`AP DEM0QLlA@DDQHLQ,A@DEKKH A BN B MGL QLA D\hQH|AP DJDDQABEAP TCBAFHH(R\A@DEFnG A BE B G B FLtRA@DELJHA@b B G RPLA D\ RLA D_8 S$MA` D Fe(HSNA0DC$tS0A DV A SAFH F GD GAANA NA A AAB QAC FD F(LTpP|A0DCV(xTQA0DCo(TtRA0DC TTA Dw TUA D\ UVA Dv(A Bs@x?<A@BBBQ A u \xAdA BU(xAA0Cc xLBB` G f$xBA0Dn xCBp G n yLDA` F i0@yDA0BBJ A ],typE\AP BEB@yGAB FC B 4ytK,Ap B E B, zhN8A BF A CPzpO dzhOAP En$zPA` E Cq$zPA0BCnDzQTAFBR A x$ {SHA0DDH$H{SB0CCX p{T8A DH{(TXA B {`TCF]({TACFEBDCCBf|lU4|`U A$#D"!B C1 A P|4Z<d|$ZB0In A D A D |ZPB0KF| \\C@S,|\\ACFEBDCCBAk }^\A BS<}8^0P}4^Ap I ,}`A@CFDpP}aADG  A N~0PO1`O1pO1O1O1O11O1O1O1O1O1O1O1O1(.P1P1P1P1@E/ P10P110 /8P1@P1HP1XP1`P1pP10/00xP1P1x0P1P1P1P1P1P1P1P1P1P1P1P1.//P11Q1w/Q1Q1. Q1(Q10Q18Q1B1@Q1HQ1XQ1`Q1pQ1xQ1Q1Q1Q1Q1h1@0Q1Q1Q1t/Q1`0Q1Q1Q1(L1Q1R1R1h/R1(R1x.H00R18R1@R10X0HR1XR1`R1hR1xR1R1R1../R1f0//R1R1R11R1R1R1>0pF1R1R1R1R1R1R1S1S1 S10S1F/8S10HS1p\0XS1hS10Б.pS1S1S1S1S1S1S1S1S1S1@D0S1S1.T1T1Z0 C1/T1 T1(T1//H.8T1HT1PT1XT1`T1/hT1@,/pT1.T1T1T1T1T1T1T1 /T1T1Z1(Z18Z1HZ1XZ101`Z1pZ1xZ1Z1Z1Z1Z1Z1Z1Z1Z1.h000X0H00000000000X0P̈]WTR8BiTlx]TGo~8c|BpCJ\DY,ou\dS|KLQ=G~DYl{`chfhXp@A`vijq|~IXOTAsFP Q8Et4<Tb |XFX?0{,$t$Hd`|PD،d[)Ti'xJ(' ,H,,@,`,81@1H1 ./P1d1d1d1d1d1d1d1d1e1e1e1e19090d190d1d190d1d1d1d1d1//hd1p/pd1xd1 )10)1pB(@)1P)1`)1B(p)1)1B()1)1B()1)1`B()1)1)1B(*1*1 *1B(0*1@*1P*1`*1x*1D(*1 D(*10D(*1@D(*1PD(*1`D(*1pD(*1D(*1D(HB1pB1B1/I//W/Y/W/W/pW/pY/1W/8X/(X//hW/W/W/pY/Y/Y//hW/W/W/pY/Y/Y//W/X/W/W/Y/}.Y/Y/}.Y//Y/}.О/Y/}.О/XW/}.Y/О/X/W/@Y/Y/О/X/W/@Y/Y/Y/W/@Y/Y/W/@Y/X/W/Y/X/W/Y/Y/W/HX/W/W/pX/@Y/20W/pX/@Y/20Y/Y/=/@//=//=/=/}.1W/8X/(X/Y/.0О/}.Y/Y/xY/Y/ Y/hW/W/Y/W/@Y/X/.0 X/X//X//(0}./X//}.}.}.Y/(Y/.0`X/hW/X/}.W/PX/.0}..}.0W/}..W/}.W/0W/ X/W/ X/W/1Y/Y/О/X/X/X/1W/8X/(X/./W/XY/hW/Y/X/X/X/X/1XW/Y/1W/8X/(X/1}.1W/8X/(X//W/1W/8X/(X/W/0Y/(/hX/W/1W/8X/(X/}.}.HY/X/HY/hY/W/HY/X/X//(//HY/1Y/1W/8X/(X//W///?/Lh1x.-x"0 h"080"0P"00/H/8Y1@Y1HY1XY1hY1xY10. Y1/(Y1/0Y1H.#"""##"`"$""l""8"""""x""""d"t""""""H"" "t""T"#X"0"("""""$#H.f1Hb11b1ؐ1f100110-z-l---ԏ-x---0-0------Ly---L---P-h-y-d-̇--ԃ-Ȍ-܅-d-H--d----\--X--4-`1h1p1 x1 1 1 1 11111111111111 1!1"1# 1$(1%0181@1H1P1X1`1h1p1x1111111(1)1*1&1'11+1,1.(10811H1/X1`1h1l....<.....X.X.,.d.x......P.4.`.x. ..h.p..(.....D....X. .,.`..p.00h.`.//"0C1C15/0W/111(181H1 X1@h1x1.X3%0h2,@( /p 2;^g(0 8Js)0g7$[)/W7s)06ٲ) 0@6h*000z6)@06h,-H0P5D)X0P5D)`0 5+)pF14n)F/04G )h0`n4-R+x0Pj4R+/247 )0 08Hě0 08Hě0 08Hě0 08Hě0.8J0.8J0`.8h 0`.8h 00-8m0H0,8OTX0+8x180..0010010100110`010`0001001001(/T/1p 1 11/(//(0/(/.Y/11/(//0/`X/ 1@1P1hk0hk0hk00181]1P0.1"0]1P111"0]1P111hk0hk0hk011hk0111118//1p1hk0hk0hk0hk0hk0hk0hk0/8//1"0]1P11p1H1"0]1H1"0]1000 1T/c0'1'1c0}.c0'1T//T//T////0//0//}.T/0//0////'1'1'1'1'1'1'1c0c0c0/'1//`1'1//'1c0'1'10X/`0c0'1'1c0c0/T//'1'1T/'1(1(1'1(1(1////H/0'1/11'10/'1/'1(1(1 (1((1'1/'1(1 (1@(1P(1(1 (1@(1P(1(1 (1`0`(1p(1T/(1 (1`0`(1p(1/'1hk0hk0hk0(1(1(1%1(1(1(1hk0hk0hk0(1(1(1%1(1(1(1(1(1(1(1(1//'1/'1/(1 (1@(1P(10//)1)1c0)1)1/)1)1'10c0///'10///'1)10/'10hV0hV0=0=0=0=0K1(K1(K10K1G1(0[1hk0[1hk0.1`1`1Є18/1`1`1Z/hk0hk0hk0`1[1~//T/`1@F1`1/P`1x`1`1/hk0`1"0@a1Ha1~/1@//Xa1ha1[1@a1Ha1xa1[1a1P]0"0]18d1Hd1`11`11"0]1/W/f1f1g11///W/f1f1g1H/hW/1/H/hW/1/}.Y/.@s0@//1P]0P]0T/pr01`111(0؄1؄1(0.(0./}.hk0`1.ؐ.@/'1ؐ.@/(0P11P`1/`1`1/./111101E11ȥ1إ11(1111181H1111X1h1p111[1"0]1hk0[18d1`11`11`11Hd1"0]1[1"0]1hk0[18d1`11`11`11Hd1"0]11111111Ȩ1Ш1ب111111111 1(10181@1H1P1X1`1h1p111111ȩ1ة11111(181H1X1h1x1111H*11Ȫ1Ъ1111111(181H1X1h1x11111cO8{OWOwOtOXvOlOjO|O8nOsOxqOyOoO(eOaOXgO, (T(0*)(T:~ T:~ rT(0*)(mT:~ oT:~ P$@*           !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~    }}{{%% .defaults . .generic_base json.decoder .kwdefaultslist index out of range .type_paramsutf-8 CANCELLEDFINISHEDFalseJSONDecodeErrorPENDINGPy_Repr TextIOWrapperTrueWarningMessage_WindowsConsoleIO__IOBase_closed__abc_tpflags____abs____abstractmethods____add__ __aenter__ __aexit__ __aiter____all____and__ __anext____annotations____args____asyncio_running_event_loop__ __await__ __bases____bool__ __buffer____build_class__ __builtins__ __bytes____call__ __cantrace__ __class____class_getitem__ __classcell__ __classdict____classdictcell__ __complex__ __contains____copy____ctypes_from_outparam____del__ __delattr__ __delete__ __delitem____dict____dictoffset____dir__ __divmod____doc__ __enter____eq____exit____file__ __float__ __floordiv__ __format__ __fspath____ge____get__ __getattr____getattribute____getinitargs__ __getitem____getnewargs____getnewargs_ex__ __getstate____gt____hash____iadd____iand__ __ifloordiv__ __ilshift__ __imatmul____imod__ __import____imul__ __index____init____init_subclass____instancecheck____int__ __invert____ior____ipow__ __irshift____isabstractmethod____isub____iter__ __itruediv____ixor____le____len____length_hint__ __lltrace__ __loader__ __lshift____lt____main__ __matmul__ __missing____mod__ __module____mro_entries____mul____name____ne____neg____new__ __newobj__ __newobj_ex____next__ __notes____or____orig_class__ __origin__ __package____parameters____path____pos____pow__ __prepare__ __qualname____radd____rand__ __rdivmod__ __reduce__ __reduce_ex____release_buffer____repr__ __reversed__ __rfloordiv__ __rlshift__ __rmatmul____rmod____rmul____ror__ __round____rpow__ __rrshift__ __rshift____rsub__ __rtruediv____rxor____set__ __set_name__ __setattr__ __setitem__ __setstate__ __sizeof__ __slotnames__ __slots____spec____str____sub____subclasscheck____subclasshook__ __truediv__ __trunc____type_params__#__typing_is_unpacked_typevartuple____typing_prepare_subst____typing_subst____typing_unpacked_tuple_args____warningregistry____weaklistoffset__ __weakref____xor__ _abc_impl _abstract__active _annotation _anonymous_ _argtypes__as_parameter__asyncio_future_blocking_blksize _bootstrap_check_retval_ _dealloc_warn_feature_version_fields_ _finalizing_find_and_load_fix_up_module_flags__get_sourcefile_handle_fromlist _initializing_io_is_text_encoding_length__limbo_lock_unlock_module_loop_needs_com_addref__only_immortal_pack_ _restype_ _showwarnmsg _shutdown _slotnames_strptime_datetime_swappedbytes__type__uninitialized_submodules_warn_unawaited_coroutine _xoptionsabs_tolaccessaddadd_done_callbackafter_in_childafter_in_parentaggregate_classaliasappendargargdefsargs argumentsargvas_integer_ratioast attributeauthorizer_callback autocommitbacktickbasebeforebig binary_formblockboundbufferbuffer_callback buffer_size bufferingbuffersbufsizebuiltins byteorderbytes bytes_per_sepc_call c_exceptionc_returncached_statementscadatacafilecallcall_exception_handler call_sooncancelcapathcategorycb_typecertfilecheck_same_threadclearcloseclosedclosefdclosure co_argcount co_cellvarsco_code co_constsco_exceptiontable co_filenameco_firstlinenoco_flags co_freevarsco_kwonlyargcount co_linetableco_nameco_names co_nlocalsco_posonlyargcount co_qualname co_stacksize co_varnamescodecommandcomment_factory compile_modeconstscontext contravariantcookiecopycopyregcorocount covariantcwddatadatabasedecodedecoderdefault defaultactiondeletedepth detect_types deterministicdevicedictdictcompdifference_updatedigest digest_size digestmoddir_fddiscarddispatch_table displayhookdklendoc dont_inheritdst dst_dir_fdduration eager_start effective_idselement_factoryencodeencodingend end_lineno end_offsetendpos entrypointenverrorsevent eventmaskexc_type exc_value excepthook exceptionexisting_file_nameexpextend extra_tokensfacilityfactoryfalsefamilyfanoutfdfd2fdelfgetfile file_actionsfilenamefilenofilepath fillvaluefiltersfinal find_class fix_importsflagsflushfollow_symlinksformat frequency from_paramfromlist fromtimestampfromutcfsetfuncfuture generationgenexprget get_debugget_event_loopget_loop get_sourcegetattrgetstategidglobals groupindexgroupshandle hash_nameheaderheadershihookididentignoreimag importlibin_fdincoming indexgroupinfinfer_variance inheritableinitial initial_bytes initial_valueinitval inner_sizeinputinsert_comments insert_pis instructionsintern intersection is_runningisatty isinstance isoformatisolation_levelistextitemitemsiteriterable iterationsjoinjumpkeependskeykeyfilekeyskindkwkw1kw2lambdalastlast_exc last_nodelast_traceback last_type last_valuelatin1 leaf_sizelenlengthlevellimitlineline_bufferinglinenolistcomplittlelolocalelocals logoptionloopmappingmatch max_length maxdigits maxeventsmaxmemmaxsplitmaxvaluememLevelmemlimitmessage metaclassmetadatamethodmodmodemodulemodule_globalsmodulesmromsgmycmpn_argn_fieldsn_sequence_fieldsn_unnamed_fieldsname name_fromnamespace_separator namespacesnargndigits new_file_name new_limitnewlinenewlinesnextnlocals node_depth node_offsetnsnstypentnullnumberobjobjectoffset offset_dst offset_src on_type_read onceregistry only_keysopargopcodeopenopener operationoptimizeoptionsorderoriginout_fdoutgoing overlappedownerpagesparentpasswordpathpatternpeek persistent_idpersistent_loadperson pi_factorypidpolicypospos1pos2posixprint_file_and_linepriorityprogressprogress_handlerprogress_routineprotoprotocolps1ps2query quotetabsrawreadread1readablereadallreadinto readinto1readlinereadonlyrealreducer_overrideregistryrel_tolreleasereloadreplreplacereservedresetresetidsreturnreversereversedsaltsched_priority schedulerseekseekable selectorsselfsendsepsequenceserver_hostname server_sidesessionsetcomp setpgroupsetsid setsigdef setsigmasksetstateshapeshow_cmdsignedsizesizehintskip_file_prefixessleepsocksortsoundsourcesource_tracebackspamsrc src_dir_fd stacklevelstart statementstatusstderrstdinstdoutstepsteps store_namestrategystrftimestrict strict_modestringsub_keysymmetric_difference_updatetabsizetagtargettarget_is_directorytasktb_frametb_lasti tb_linenotb_nexttelltemplatetermtext threadingthrowtimeouttimes timetupletoptrace_callback tracebacktrailers translatetruetruncatetwicetxttype type_paramstztznameuidunlinkunraisablehookuriusedforsecurityvaluevaluesversionvolumewarnings warnoptionswbitsweekweekdaywhichwhowithdatawritablewrite write_throughyearzdict      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~U1U1U1 U1(U10U18U1@U1HU1PU1XU1`U1hU1pU1xU1U1U1U1U1U1U1U1U1U1U1U1U1U1U1U1U1V1V1V1V1 V1(V10V18V1@V1HV1PV1XV1`V1hV1pV1xV1V1V1V1V1V1V1V1V1V1V1V1V1V1V1V1V1W1W1W1W1 W1(W10W18W1@W1HW1PW1XW1`W1hW1pW1xW1W1W1W1W1W1W1W1W1W1W1W1W1W1W1W1W1X1X1X1X1 X1(X10X18X1@X1HX1PX1XX1`X1hX1pX1xX1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1Y1jOW 8nOPYʖ 8 \|.CCo(H5 c J"opoJHX! oXoooYPJPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP KT(0*)(T:~ ?/B1B1B1B1B1B1B1B1B1C1X1XC/0 1@ 1F//"1/ 0(00080H0P0X0`0p00&1/8//.(1. (1"1//`1"1/('1/YYXttZ/[/Z/&1/&1/8&0/80/h"1/H"1/0/0/0/H0/H0/p0/p0/%1/%1/#1(1#1 (1"1/x0/81/#1/"1/(/(1(/ (1"1(1"1 (10/8"1/`"1/X0/(#1/@0/P0/%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% %%%%%%%  !"#%%%%%%  !"#%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% e18X`8e100`2PVȃOO8SaP_P_P0O |jS#t$rt|jcYSwxYwRȄOPP (PAVaPPPPOdD]&}t||st||t||(|jj |jyPVHO0x6VaP`^P`^POtt|SOQ7 aP0^P0^PQeZdZy&PVOJhOPaPOOt||||j}||_|SPVOOЇO0TaPXO Ot|||jyiPVpOR0OXTaPVOPO}|]|jr&|jj|jytj |j |jyy!HO؊OFOhOaPOOOeZdZdZfdZfdZefdZxZSJ8OO@ OQaPXOOtj|Gfddtj}||_|jyPV8O`  p{VaPOOg|_t|_i|_yRPVOOe OhVaP(O(OO|jj}|j} |}tj ||#t$rYywxYwKPVБOOo POVaPOO|jr|j |j|}|x}|S|S#t$r|cYSwxYwhPVOO| hOhVaPUOO |j|}|=|jr|j|j |||j|<|S|S#t$rd}YNwxYw(OO> aP]P]PpOeZdZdZdZdZddZddZyPVPOOAVaPOO||_||_yT0OЗOp{VaPxO Otj|jt|_|jj |j y'șOOжOAVaP0OO|jj|jyOxV aP@]P@]P`OeZdZdZdZdZdZyOQ aP]P]PQeZdZyhOHOOO@UaP\P\PO||vry|D]W}|j|x}s||vry|j||Dcgc]}|j}}t||||sWyycc}wPPVO h6U(}VaPhOOtj|_tj|_||_d|_g|_g|_y9HOO p{VaPOO@Ottjt|jgt S+(OO0O0O(}VaPPOOХOtj}t||5 |j5|jgk(s|j |k(r4||_|jj d ddddddy|jrtd||jjdr|jj dddd|jj|jj#1swY>xYw#1swYyxYwOO@OtO(}VaPȩOOtj}|j5|j|k7r t dt |j dkDsJ|j jt |j sSd|_t |jdkDr4|jj|jjdddy#1swYyxYwOxOp{VaPOpOd|jdt|SOO aP\P\P@OeZdZdZdZdZdZdZdZy}VO h6U(}VaPO`O||_d|_yOO p{VaPPOXO O|xjdz c_y18OO p{VaPO`O|jdk(r td|xjdzc_yOxOp{VaP OOd|jdt|SOO aPX\PX\P`OeZdZdZdZdZdZdZyPVO  h6U(}VaPOpO||_d|_y6PVеO !p{VaPxO0Ot|j|_|jjyPVO"жOAVaPxO@O|jjyOX~V #aP\P\P@OeZdZdZdZdZybPVOO$O(}VaP(O@OзOtj tj||urt|=tj y#tj wxYw8OO`O%0OAVaP[P[P`Otj t|}|?t t |}n t |}|fd}tj||t|<tj|S#t$rd}YdwxYw#tjwxYw=OXOO&O(}VaPOt|} |j|jy#t$rYywxYw O'hOAVaP(Q(Q O||i|S^OO(POAVaPQQOtjj|k\r?|jdsd|z}t |j |tj yy-@OO)OXTaPOO0O|tjvrt|d|||SOO*pOTaP[P[P Ofd}t||S0XOO+OXTaPOhOOtj|st|d|||SOO,OTaPX[PX[P`Ofd}t||SxOhO -OVaP-Q-QOd}tj|tt||}|tj vr2tj |}t ||tj |St|S~0OOO.8OVaP [P [PPOt|dd}t|ddx}r t|S |j} |j}d|d|dS#t$rd}Y#wxYw#t$r|d|dcYSd|d|d cYSwxYw>puSOW/XOPVaPOO||_||_||_||_|rgnd|_g|_d|_d|_yPOOd0`}V(}VaPOOd|jd|jg}|j|jd|j|j|jd|j|j j ddj|dSPVHOOl1OAVaPOO|j} |j|jk(xr{|j|jk(xr`|j|jk(xrE||jk(xr4|j|jk(xr|j |j k(S#t $r tcYSwxYwaPV Ox 2p{VaPVOO|jH|j<|jr0tttj |j|_|jS PVPO 3O(}VaPVOO||_y7OhO 4p{VaPOO|j|jjddS|jS PVO 5p{VaP PhOO|jSPVO6yV(}VaP PhO8Ot||_yROO2 7aPqVqVPOeZdZdZdddddZdZdZedZejdZed Z ed Z e jd Z y`OOO8hOPVaP@fV@fVpO| t|dd}|sEt|dr9tttj}| |||S|rgnd}||||S|!t|dr |j |}nd}t||||S#t $rd}YwxYwOOO9(O@UaPZPZPO |j}||S|j}| |j} |j}|| t |dd}|s||} |j } t|j}t|||}|dn||k(|_ ||_ ||_ |S#t$rYwxYw#t$rYwxYw#t$rd}YwxYw#t$rd}Y~wxYw#t$rd}YywxYwOO@O:OVaPZPZPO|s t|dd |j|_|s t|ddn|j}|X|j Lt tt j}|j|}|j |_ ||_d|_ ||_ |s t|dd |j|_ ||_|s t|dd|j  |j |_|j"rP|s t|dd |j$|_ |s t|dd |j& |j&|_|S|S#t$rY=wxYw#t$rYwxYw#t$rYwxYw#t$rYwxYw#t$rYwxYw#t$rYwxYw#t$rY|SwxYw{OO&;O(}VaPfVfVOd}t|jdr|jj|}n!t|jdr td|t |j }t |||SOO7<POAVaP`ZP`ZPPO|jdn |j}|jY|j}|d|dSt6t |tj rd|dt |jdSd|d|dS|jrd|d|jdSd|jd|jdSOXOOM=OhVaP0ZP0ZP@O|j}t|5tjj ||urd|d}t || |j 2|jt d|jt||dnt||dt|j dsNt|j d }tj|t|j j|n|j j|tjj!|j}|tj|j< ddd|S#tjj!|j}|tj|j<wxYw#1swY|SxYw@OO0Ok>O(}VaPYPYPpO |jj|jtjj |j}|tj|j<t |dd |j|_t |ddA |j|_ t|ds#|jjdd|_ t |dd ||_ |S|S#|jtjvrFtjj |j}|tj|j<xYw#t$rYwxYw#t$rYwxYw#t$rY|SwxYwXOO O?OAVaPYPYPpO|jSt|jds=t|jd}tj |t t |St|}d|_ |tj|j< |j#|j2td|j|jj|tjj!|j}|tj|j<t#d|j|jd|_|S# tj|j=#t$rYwxYwxYw#d|_wxYw7hO(OO@PaPYPYPOt|j5t|cdddS#1swYyxYw/POApOhVaPVOOtj|rt|||jSy[PPBPaP ^V0PO|jtjvr$t|jd|jt t j |SPPCPPaP]VPPttj|yP DpP(}VaPЉVPPPyP EpP(}VaP8PPyP FpP(}VaPQ@PPyRHPP GaPxqVxqVPeZdZdZdZed dZedZedZ ee dZ ee dZ ee d Z eeZy XPx P0 P   H P8VaPp P@ P|j}|j}|Xt|jdd}|sJdt |d}t j |j|k(sJ||j||j|\}}ttj|||_|j}|r+|gk(sJ||r&|jjd|n |J|t |drJ|j|r ||_|r|j"|k7r|j"gk(sJ|j"|j"j%|nv|j}|du}t't|ddgk(sJ||j(rm|j|j(|j|\} }|j*| k(sJ|j*| f|r||gk(sHJ||f||rgndk(s6J|d} |j*J|j*||rgndk(sJ|| r0t |dsJ|j| k(s0J|j| ft |drJ|j|r0t |dsJ|j"|k(s0J|j"|ft |drJ|j"|j,rJy#t $rYwxYwPxP0POIP@UaP PpPPP|rttddsy |j}||k7r |j dr |dd}|s|d}nd }|j d |}|r!tj||}||d }||fSd}tj||d }||fS#t$r!tjdk(rdndx}|_YwxYwPhPh  JPVaPVPPttj|}|y|\}}}t|||j|}|j |||\} } t tj| ||_ | r|jjd| |SHPPpPK@PAVaP ^VPpPt|j} |jj}|r||_|S#t $rY|SwxYwJPV(PLPhVaP]VP0P|j}|j}ttj|}t ||j yjP`PMPVaPQPPt||}tj|}|J|\}}}||_t |j dd|rg|_|j||SPPNpP(}VaPЉVPPtj|SP OpP(}VaPPPyPPPpP(}VaPQPPtj|Sc #Pp"P QaP@qV@qV`!PeZdZdZdZedZed dZeddZe dZ e dZ ed Z ee d Zee d Zee d Zy$P$P Rp{VaP0$P%Ptjy&P&PSH&PhVaP%P%Ptjy'P'P TaP@YP@YP@'PeZdZdZdZdZy?)P)PU0)PVaPfVfV(P|jd|dz }t||kr td|d}|r|d|S|S-P8-P,P  VX,P8VaPfVfV +Ptj}| td|stj dt |tj v}|D]q}t5 |j}||||} ddd1|s<|tj vr*tj |} |j} | |cS| cS|cSy#t$r YdddwxYw#1swYgxYw#t$r|cYcSwxYwy0Ph0PW:PAVaPYPYP/Pt|tstdt||dkr t d|dkDr(t|ts td|s t d|s|dk(r t dyy5P05P4P  Xh4P8VaPXXPXXP2Pd}|jdd}d}|r|tjvr t|||tjvrtj|Stj|} |j}|j}|jdd}t||}|tt |||r|jj t|} |r|jj |r#tj|} t|| | S| S#t $rt |d|d}t||dwxYw#|r|jjwwxYw#t $r&d|d}tj!|t"Y| SwxYw8Ph8P(8PEY7PhVaP7Ptjj|t}|tust t |ddddrat |5tjj|t}|turt ||cdddS dddt||d|d}t|||S#1swY+xYw0;P8;P_Z:PAVaPWPWP:Pt||||dkDr t|||}t|tS@PP@P@P n[?P@UaP>P|D]}t|ts8|r|jdz}nd}td|dt |j|dk(r*|rSt |ds`t ||j|dzt ||r|jd |} t|||S#t$r>}|j|k(r)tjj|tYd }~d }~wwxYwEPDP\pDPAVaPWPWPpCP|jd}|jd}|@|<||jk7r-tjd|d|jdtd|S| |jStjdt d|d }d |vr|j d d }|SIPxIP  ]IPVaPHP|dk(r t|}n||ni}t|}t|||}|s|dk(rt|jddS|s|St|t|jddz }tj |j dt|j |z St|drt||tS|S1XKPKP^JP(}VaPhWPhWPpJPtj|}|td|zt|SxPPOP  _HOP8VaP8WP8WP0NP|a|att}tjj D]z\}}t ||s|tj vrt}ntj|rt}nIt||}t|||tusj|j||tjt}dD]@}|tjvr t|} ntj|} t||| Bt!ayTxRP RP`QP(}VaPoQoQQPt||tjjttjjt y.SPSP ahSPaPVPVPSPddl}|a|jtjt yPcPXaPbaP@_PdZdZdZdZdZdadZdZGddeZ GddZ iZ da Gd d Z Gd d eZd ZGddZGddZGddZdZdZdZdddZdZdZdZdZGddZddd d!ZdBd"Zd#d$d%Zd&Z d'Z!d(Z"d)Z#d*Z$d+Z%Gd,d-Z&Gd.d/Z'Gd0d1Z(d2Z)dCd3Z*d4Z+d5Z,e,d6zZ-d7Z.e/Z0d8Z1dDd9Z2d#d:d;Z3d<Z4dEd=Z5d>Z6d?Z7d@Z8dAZ9ySPfPfP#.ceP(}VzQePK|]}t|dk(yw1hPgPC dPzQuQhPpgPtjj xrtjvS iPG ezQuQhPhPyYjPjP<fXjP jPzQHuQHuQiPtjjtr/tjjtrdndfd}|Sd}|S8lPlPOgkPzQtQtQkPt|dzjddS'lPmPThmPzQQQ`mPt|dk(sJtj|dS'(nPmPYimPzQQQ`mPt|dk(sJtj|dSJqPxpP8pP`joPPVzQQQnP|syt|dk(r|dSd}g}ttj|D]\}}|j t s|j t r$|jtxs|}t|zg}T|j dr9|j|jk7r|}|g}|j||xs|}|j||Dcgc]}|s|jt}}t|dk(r|ds |tzS|tj|zScc}w>rP`rP(rP~krP(}VzQQQqPtj|Dcgc]}|r|jtc}Scc}w PVsPsP3lhsPXTzQsPrPK|]}j|yw0 uPtPmtPTzQQQ@tPtfdtD}|dkrdfSd||dzdfSvPXvP nUzQ@Q@QvPtj|S.pxP0xPwPowPAVzQtQtQPwP t|}|jdz|k(S#t$rYywxYw `yP0yPpUzQQTQTxPt|dS#`zP zPqUzQQTQTyP|stj}t|dS`{P{PrH{P(}VzQ`tQ`tQzP|sytj|djdd}t|dkDxr$|j dxs|j dS|P|P sUzQ`tQ`tQp|P|jtSK~PP~Pt~P(}VzQ(tQ(tQ}Pt|s=tD]}|jd|}tt j |S|SP`PPuPPVzQsQsQP|dt|}tj|tjtjztj z|dz} t j|d5}|j|dddtj||y#1swY xYw#t$r' tj|#t$rYwxYwwxYwPPXP  vЉPTzQPeVPeVP|/tjdt| d}t||rdnd}t j |}t |\}}|jd\}}}tjj} | tddj|r|n||| g} |:tjjdk(rd}ntjj}t|}|dk7r+|j!st#|d | dt$|} | t&dz} tj(Qt+|}|dd k(r|dt,vr|d d}t/tj(|j1t,| St/|t2| S(PPP(  wؓP8VzQdVdVPtjj tdt j |}t |\}}d}tjKtjjt}|j|tzr|t|d}d}|s+t |\}}|tk7rttd||jd}|dvrtd||d k(rm|j!dd d }|jt"std t"|tt"d}|j%std |d|j'dd} t)|| t*dzStPXPPPxЗPVzQPt|dk(ry|jd\}}}|r|jdddk7r|S t|}t |r|S|S#tt f$r|dd}Y%wxYw[PVؙPPcyXSzQrQrQP|jttr t|S|jtt r|Sy#t$rYywxYw/PXPPozP(}VzQhrQhrQP t|j}|dz}|S#t$rd}YwxYwJНPP{HPPzQ PP@P| |j}n,|j|k7rtd|jd||||g|i|SRPPP |PAVzQPPPPdD]&}t||st||t||(|jj |jy-hP0P{}PPzQ0rQ0rQ`Pdfd }ttj}nd}|||SPP~@PPVzQQQPP|dd}|tk7r*d|d|}tjd|t|fi|t |dkr&d|}tjd|t |t |dd}|d zrd |d |}t|fi||ScPPPPPVzQqQqQPt|dd|dzk7r'd|}tjd|t|fi||$t|dd|dzk7rtd|fi|yyPЯPPhVzQQQ P|dd|k7rtd|fi|ygP8PPVzQqQqQPPtj|}t|tr0tj d||t j|||Std|||pPPгPhVzQpqQpqQ@Ptt}|jtd|jt||jt||jt j ||SyP8PPVzQ0qQ0qQPPtt}d|dzz}|jt|t |dk(sJ|j||jt j ||SnP@PPVzQeVeV`Pddl}tj|j}|j |}tj dd}|j |j |dSEPHPP"  PVzQdVdVP|!d}t|dr4 |j|}n!tj|} t |}tj|||}d|_ |?tD]1\}}|jt|s!|||}||_ ny|tur(t|dr# |j|}|rg|_n||_|j gk(r+|r)t#|d}|j j%||S#t$rYwxYw#t $rYwxYw#t$rYewxYwPhPhPPVzQpQpQPt|tsyt}|jdd}|jd|}|||ury| t dt |d|}||dfvr6|||urt nt}|dtjdt|}|J|!||k7rtjdt|S|SYPVPPPzQPHPP tjtj|S#t$r'tjtj|cYSwxYwP8PPPPVzQP P`P|jr |j}n |j}|j|dtj ddz} |j |5}tj|d}ddd|S#1swYSxYw#t$rYywxYwPPPPP@UzQVPP|j|}|y t|tD]B\}}|j t |s!t j|||||}|cSy#t$rYywxYw-PXP zQoVoVPeZdZdZdZdZexrdevZe dZ e dZ e d dZ yS PPPVzQQ0PPt|j|d}|jddd}|jdd}|dk(xr|dk7S+Q YV(}VzQ ^VP>Ry]@PPPAVzQ]VHPP|j|j}|td|jdtj t ||j yPPPȧQ(}VzQQPPtj||SPP zQQQ0PeZdZdZdZdZdZdZyPP 0P(}VzQPP8PPtPhP0P(}VzQQPPd|j|iSPPPhVzQQHPP|j||SP  HPAVzQQP>RyNPPpP0PVzQP`P|j|} |j|}t |S#t$r}td||d}~wwxYw PPPPhVzQPP`Ptjt||dd|S$PPPPP&(P'TzQЉVP P|j|}d}d}d}d}d} t|} |j|} t| d} |j |} ||d} t | || } t | dd} | dzdk7}|rj| d zdk7}tjd k7ra|stjd k(rL|j |}tjt|}t| ||| nt| || d || tjd ||t| |||S#t t"f$rYn3wxYw#t$$rYn$wxYw#t$$rYnwxYw#t&$rd}YnwxYw||j |}|j)||}tjd|t*j,sl|j|h|r*|tjt|}t/|||} nt1||t3|} |j5||| |S#t&$rY|SwxYw|ShPP zQpQpQPeZdZdZdZdZdZdZdddZd Z y PQPAVzQPPP||_||_y5PV Q U(}VzQ@P@ Q|j|jk(xr|j|jk(S,PV Qp{VzQP Qt|jt|jz SXPPPXTzQQPPPtt| |S QU ȧQ(}VzQ QPQ|jS0PPPPPAVzQXQPpPt|ttfr8tjt |5}|j cdddStj|d5}|j cdddS#1swYyxYw#1swYyxYwPP`PAVzQpQPPddlm}||S2P0P| XSzQHpQHpQPeZdZdZdZdZdZefdZedZ dZ edZ xZ S%PPHPAVzQQPPt|}|j|jdS `P(PPVzQQxP0Pt|}|j|||SQ8QQ  hQVzQQQPt|\}}g}|r8t|s-t|\}}|j||r t|s-t|D]$}t ||} t j |& t|||tjd|y#t$rYWt$r"}tjd||Yd}~yd}~wwxYw#t$r!}tjd||Yd}~yd}~wwxYwQQ zQnVnV@QeZdZdZdZdZdddZyO8QQQVzQЉV@QQ|j|}|j|}||d}t|||tt |dd||SQ ȧQ(}VzQQHQy8QQ zQnVnVQeZdZdZdZdZyPVQ QAVzQQQ||_||_y5PV Q U(}VzQ Q@ Q|j|jk(xr|j|jk(S,PV Qp{VzQP Q Qt|jt|jz SR( Q Q QAVzQ ^V( Q Qtjtj|}tj d|j |j |SQQ Qx,Q(}VzQ]VQpQtjtj|tj d|j |j yQT3hQXTzQQQK|] }d|zk(yw2QQHQQzQQQpQt|jdtfdtDSQ ȧQ(}VzQЉVhQHQyQ ȧQ(}VzQpQHQy QU# ȧQ(}VzQ Q QQ|jS(@QQ zQPnVPnV0QeZdZdZdZdZdZdZdZdZ dZ d Z e d Z y FPVQ4 )QhVzQPQQ||_||_t|j|_|j |_||_y*QQ;QhVzQ&Q(QQ|jjd\}}}|dk(ry|dfS1PVQEhQAVzQ`&QQQ|j\}}ttj||SPVQIQAVzQ(&QpQQt|j}||jk7s|j|jk7r_|j |j |}|)|j|jr|j|_ ||_|j|_|jSPVQWp{VzQQpQt|jSPV#QZ  S(}VzQX Q Q|j|SPV"Q]0!QAVzQ Q Q||j|<yPV!Q`p{VzQ!Q`!Qt|jS#Q"Qc p{VzQ"QP"Qd|jdSPV#Qfx$Q(}VzQx#Q@#Q||jvSPV$Qix$Q(}VzQ($Q#Q|jj|y+(QX'Q) zQpQpQ&QeZdZdZdZdZdZdZdZdZ dZ d Z d Z d Z d Zd ZyPVh)Qq )QhVzQ(Q(Qt||||_y8Rt ȧQ(}VzQQ)Q)Qy4Rw ȧQ(}VzQ(*Q*Qy0+Q+QzȧQ(}VzQЉV*Qp*QtddddS+Q} YV(}VzQ ^Vx+Q>RyPV x,Q(}VzQ]V ,Q+Qy7.Qp.QȧQ(}VzQQ.Q-Qtjd|jtj||S0QX0Q0QAVzQpQ/Q/Qddlm}||jS1Q01Qp zQnVnV0QeZdZdZdZdZdZdZdZdZ dZ y 4Q(4Q3QAVzQ0Q3Q2QttjjD]A\}}| t |stj|=%t |ds2|j Ctxjdz c_ddl m }|j yj`7Q7Q6Q6Q(}VzQ(EQ@6Q5Qtj*tjstjdttjD] } ||cSy#t $rYwxYwt:QP:Q:Q9QAVzQDQx9Q8Q|dk(r tj} tj|}|S#t$rYywxYw#t $r(|j |}|tj|<Y|SwxYw=Q=Q  =QVzQaQdPd-Z?dQd.Z@dRd/ZAd0ZBeCZDdOdeDd1d2ZEd3ZFGd4d5ZGGd6d7ZHGd8d9eHZIGd:d;ZJGd<d=eJeIZKGd>d?eJeHZLGd@dAeJeHZMGdBdCZNGdDdEZOeOZPGdFdGZQGdHdIZRdOdJZSdKZTdLZUdMZVycc}w(QQ" HQQQQeZdZybЅQQQ@PQVHQQQt|tstdt||s t d|t r|j t t}g} tj|}|jdzdk7r t d| t|}||_||_tj(|ddd|_|j*r|xj*tz c_yy#ttf$r@tj|\}}||k(r t d||}|j|YnwxYw#t $rt#|}|t|<YwxYwHQЈQhpQVHQV QpQt||}|tj|||St||}t ||rK|j t |}tj|dd}|jj||SyQȏQxQVHQЉVQ`Qt||\}}}|S؍Q`Q QQhVHQXQQQtr|jtt}|}|j|jtzr|t |jtzd} |j |}t|j|S#t$rtdd|wxYwQȏQxQVHQ Q QQt||\}}}|S`QQQPQPVHQQ@Qt||}|td||t||}|rtj|d}n|d} |j |}t|j|jS#t $rYywxYw!ȕQQPQAVHQQQQt||}|td|||Sh(Q@QQ  QVHQQ8QИQd}tj|tt||\}}}tj j |}|t|tst|}|tj |<||_ |r4t||}tj|j|}|g|_t|ds t |_tj"|j$||t'||j$ tj |}t-j.d|||S#tj |=xYw#t($rt+d|dwxYwQPQQAVHQpQQQddlm}|||SphQQПQp{VHQ0QQQ t|j|_|jt|j<y#t$r*tj |jdi|_YywxYw#ءQQp{VHQHQQd|jt|jdS*QQ. HQhQhQQeZdZdZdZddZdZdZdZdZ d Z d Z d Z d Z d Zy"8QQ#ȧQ(}VHQQQpQ|j|jddzSPV0Q'QAVHQQQQ|tz}||jvS4PV0Q0ЩQVHQxQxQ`Qt||}tD]\}}}||z}||jvs|cSyQQQ O-QPQHQ@Q@QPQ tj|}|5|j } |j t d|j }|jt }t|t k7rtd|||ddtk7r |j dd|j }t|tz t z d} |j ||j}|jt}|dkrtd|||||t z}t|t k7rtd|||t|z |z}t|d d } t|d d } || krtd |||| krtd |||| z}|| z } | dkrtd||i} d} |j | |jd}t|dkr td|dddk7rnt|dk7r tdt|dd}t|dd }t|d d}t|dd }t|d d }t|d d}t|dd}t|dd}t|dd}t|dd}t|dd}||z|z} || kDrtd|||| z } |j|}t||k7rtd|| t|j| |z | |z k7rtd|| |dzr|j!}n |j!d}|j)dt*}t-j.||}||||||||f}|| |<| d z }  |j | dddt1j2d! | S#t$rtd||wxYw#t$rtd||wxYw#t$rtd||wxYw#t$rtd||wxYw#t$rtd||wxYw#t$rtd||wxYw#t$rtd||wxYw#t"$r(|j!dj%t&}YqwxYw#|j |wxYw#1swY8xYw~QQ`Q8QHQQQQtr tjdtdda ddlm} datjd|S#t $r!tjdtdwxYw#dawxYwmQ8QQ "QQHQXQXQQ|\}}}}}}}} |dkr tdtj|5} | j|| j d} t | dk7r td| dddk7rtd ||t| d d } t| d d} d| z| z}||z } | j|| j |}t ||k7r t d  ddd|dk(rS t}|dS#t$rtd||wxYw#t$rtd||wxYw#1swY^xYw#t$r td wxYwT`Q7(Q(}VHQ Q QQt||z dkS.QQ?XQUHQQQQ||d}tj|||}|dzdk7}|r{|dzdk7}tjdk7r|stjdk(rt ||} | tj tj | } tj|| ||nSt||\} } | rBtt|dd| rt|dd | k7rtjd |ytj|d d} t| t st#d |d | S'QQlQHQ8Q8QPQ|jdd}|jdd}|SpQ8QsQ(}VHQQQQt|}t||ddS=QQ yQ(}VHQQQQtj|dz dz|dz dz|dz|dz |dz dz|dzdzd d d f SVQPQQQPVHQQQQ |dddvsJ|dd}|j|}|d}|d}|d}t|||fS#tttf$rYywxYwDxQ0QQQAVHQHQHQ0Q|dddvsJ|dd} |j|}t|j|S#t$rYywxYwQQQQUHQQQQt||}d}tD]\}}}||z}tjd|jt |d |j |}|d} t|j|} d} |r t|| ||| } n t| | } | |d} | || fcS|rd|} t| ||td||#t$r } | }Yd} ~ Ed} ~ wwxYw#t$rYwxYw0QQHQQdZddlZddlmZmZddlZddlZddlZddl Z ddl Z ddl Z ddl Z ddgZ ejZejddZGddeZiZee ZdZd Zd ZGd dej2Zed zd d fedzdd fddfZdZdZdZdZdZ da!dZ"dZ#dZ$dZ%ee%jLZ'dZ(dZ)dZ*dZ+dZ,d Z-y QxQ HQhRBUBUQd|_|S8RQ+hQXThRQQd|_t| |yQ`Q XShRxRxRQeZdZdZdZfdZxZS8RQ?hQXThRQQd|_t| |yQ`Q0 XShR8R8RQeZdZdZdZfdZxZS Q`QD hRRR QeZdZdZdZy"PVQ iQShRpQ Qt|||||fi|}t||S QQnAU(}VhRUhQ0Qt||S QQuQ(}VhRXQQt||S HQQyAU(}VhRQQt||SRxR} RPVhRRRRtd|jd|j|tdt|t |\}}}}td||td||td||td||y @RR HRhRRRRt|y RxR HRhRRRRt|y$8 RR\ XShRSSPReZdZdZfdZdZdZdZd dZdZ dZ xZ SxRR RVhRRR Rt|ds|St}|jD]@}t|ddD].}t||d}t|dds|j |0B|j j D]$\}}t|dds|j |&t||_|S RȜS hRbUbU@ReZdZdZdZyqRRR hRRdZdZGddeZGddeZGddeZ dd lm Z m Z m Z m Z m Z mZmZmZGd d eZdZGddeZy#e$rdd lmZm Z d e_Y&wxYwWPVR^  R8VhRHRRtj|||||f} || _|| _|| _|| _|| _|| _|| _||| _ | SERRm p{VhR0RRd|jj|jj|jt |fzSHRRS hR`R`RReZdZdZdZ ddddZdZyR@U  `\RAVhR`R0Rt`"R@U `\RAVhR"R!Rt'R8'Rr hR0R0R&ReZdZdZddZddZy)R)R BR(}VhR8)R)R||_d|_y*R@U 9RAVhRh*R 9Rt+R p{VhRH+R>Ry,R p{VhRX,R0,Ry-R FR(}VhR-R>Ry0R/R hRRR@/ReZdZdZddZd dZdZdZdZy4R1RBR(}VhR0Rp0Rtj||d|_yPV@UPCRhVhR05R@1R@Ut<PV1RPDRPVhR1RCR|j|z}|j||j|\}}||d|_|S4R2R p{VhRh2R02Rtj|d|_y}VGR p{VhR83R3R|jxsdS 4RGR FR(}VhR3R3R|xsd|_y@6R5R hRRRp5ReZdZdZd dZdZd dZdZdZdZ y 8RX8R BR(}VhR8R7R||_y9R@U 9RAVhRP9R 9Rt:R p{VhRp:R>Ry=R  p{VhR=R`=Ryh?R' !FR(}VhR?R>RyxARAR "hRhRhR@ReZdZdZddZd dZdZdZdZyRBR5#BR(}VhR BRARtj||d|_yPV@U:$PCRhVhR(HRBR@Ut<PVDR?%PDRPVhRCRCR|j|z}|j||j|\}}||d|_|SRxERG &p{VhRERDRtj|d|_y}VGRK 'p{VhRERER|jdfS }VGRO (FR(}VhRhFR8FR|d|_y0IRHR/ )hR R R`HReZdZdZd dZdZd dZdZdZdZ yNRMR\*[RAVhRxMR@MR||_||_y<PRORu+pORhVhR ORNR|j||j\}}|jj|y"xQR@QR|,R(}VhR؝RPRPR|jdj|ySR -p{VhR0SRSRy:}VsR.RAVhR8TRSR|jj|||dk(r|dk(r|jyyypR@R/RAVhRTRpR||j|SPV 0p{VhR(UR S|SPVR1XRhVhRhURИR|jjy#RR2hR(}VhRURЙRtd|jjz%(WRVRZ 3hRRR0VReZdZd dZdZdZdZd dZefdZ dZ dZ d Z y D[RP[R4[RAVhRZR`ZR||_||_d|_|j|_|j|_d|_yPV@U 5`\RAVhR\R[RteRPeReR  6dRVhR@dRbR|jr1|jj|j|_d|_|dkr|} |dk\rt |j|k\rn|dkr|j j }n|j j |}|j|z}|snC |j||j\}}||d|_|xj|z c_|sn|dkr|j} |j|_| S|jd|} |j|d|_| S#t$rZ}|rM|j|d|j|j\}}|jd} t | dkrYd}~d}~wwxYwplRkR  7kRVhR0kRhR|jrh|jd}|jd=t|jdk(r|jd|_d|_|s|jdd}|S|xsd}|j} |j |d}|rXt |tr|jd s!t |tr'|jd r||j dd z }||z }|jd}|rt|dkDrm|d}|d=t|dkDr&|d xx|jz cc<||_d|_n|d|jz|_|s|jdd} |S|d}|djdd}||k7r<|jj|dd|jz|_|r|} |S|} |S|r||r|s|jdd} |S|d kr|dz}"oRXoRa8oRhVhRRnRnR|j}|j|S!rR@rRp 9p{VhRqRqRd|_|j|_d|_y.8tRsR}:RAVhRsR`sR|jj|||jyRuR ;PuR(}VhRuRtR|j}|r|StPV <p{VhRuR S|SpR@R=RAVhRuRpR||j|SPV >p{VhR8vR S|SPVR?XRhVhRxvRИR|jjy#RR@hR(}VhRvRЙRtd|jjz7xRxR AhRRRwReZdZeZddZddZddZddZddZ dZ ddZ d Z d Z efd Zd Zd ZdZy,@|R{RB{RVhRP{R{R||_||||_||||_||_yPV|RC}R(}VhR|Rp|R|jj|SPV}RD}R(}VhRX}R }R|jj|SPV~RE~R(}VhRRH~R~R|jj|SRR Fp{VhR8RRt|jSPV Gp{VhRR S|SPVȀRHR(}VhR8RR|jj|SPVRIR(}VhR؝R(RR|jj|S6PVȕR Jp{VhRR0R|jj|jjy^}VRKRAVhRR0R|jj|||jj|dk(r!|dk(r|jjyyypR@RLRAVhR0RpR||j|SPV Mp{VhRxR S|SPVRNXRhVhRRИR|jjy#RROhR(}VhRRЙRtd|jjz;R R PhRpRpRReZdZdZdZddZddZddZddZdZ d Z d Z d Z d Z dd ZefdZdZdZdZy:R@RQRVhRR0R||_||_||_||||_||||_||_y=PVhR,R`RhVhRRR|jj|}|j||j\}}|SZPVR2S`RhVhRRR||jj}n|jj|}|j||j\}}|SLXRR;TRhVhRRpRR|jj}|j||j\}}|j dS7RRAUhRAVhRRRt|j}|j||j\}}|SPVH Vp{VhRR S|S;PV8RKWRAVhRRPR|j||j\}}|jj|SLRRPXhRhVhR؝RRRdj|}|j||j\}}|jj |S6PVȕRV Yp{VhRxR0R|jj|jjy:PV@R[ZRAVhRR`R|jj|||jj||ypR@Ra[RAVhRRpR||j|SPVh \p{VhRR S|SPVRk]XRhVhRRИR|jjy#RRn^hR(}VhRRЙRtd|jjz>RR _hR8R8RPReZdZdZdZdZ ddZddZddZddZ dZ d Z d Z d Z d Zdd ZefdZdZdZdZythRRRs`hR@UhRR| d|vr|dz}tj|||}||S t|}t||j|j |}||_|S#|jxYwcRRaPRVhRRRR||}t|}t|}t||j|j|j|j |}||_||_|SHRR bxUhRRR0Rt|jSRxR cxUhRRR0Rt|jS%RxRd@R(}VhRPRPR@Rt|j}| t||S%RشReR(}VhRRR@Rt|j}| t||SR`R fxUhRRRRt|jSRHR gxUhRRRRt|jSPRRPR+hPRVhRhRhRRKt||fi|}|D]}|j|}|s||jdd}|r|yywPȽRRPR+ iRVhR0R0RpRKt||fi|}|D]}|j|}|s||jdd}|r|yywRpR4jHR(}VhRRRR|Dcic]}||c}Scc}w,RpR>k(RhVhRRRRi}|jD]\}}||vr|||<d||<|SDRRRlhR0RdZddlZddlZ ddlgdZdZdxZ Z dxZ Z d Z d Zejd k(re xZZe Zne xZZeZe Ze Ze ZeZGd d eZGddZGddeZGddeZGddeZGddeZGddeZGddeZ GddZ!GddZ"d2d!Z#d3d"Z$d#Z%d$Z&d%Z'd&Z(d'Z)d(Z*d4d)Z+d4d*Z,d+Z-d,Z. e/d Z0e/d-Z1e/d.Z2e/d/Z3e/d0Z4e/d1Z5dZ7e7rddl8Z8yy#e$rZedezdZ[wwxYw#e6$rdZ0dZ1dZ2dZ3dZ4dZ5Y5wxYwPRRH mRRRReZdZejj Zy RRK nRRRReZdZejj ZyRRN oR8R8RPReZdZejj ZyRhRQ pRRR ReZdZejj ZyXRRRqR0RdZdZgdZddlZddlZddlmZmZmZmZm Z m Z m Z m Z m Z mZmZmZmZmZmZde_dZdZdZGd d ej0ej2 ZGd d ej6eZGddej:eZGddej>eZ ejCe e e eeefD]Z"ejCe"e efD]Z"e jCe"[" ddlm#Z#ejCe#y#e$$rYywxYwPV( rSHSHSRyPV#X sS0RKdSPV0SZ tSSSXRKyw PVS` uS S SRKdywL8RRhvRVS(rU(rU R|j}|D]9}|D]+}||jvs|j| tccS2tcSy}Vx wp{VS`RSy8RR|x:S(}VSR@:S|tur t|dStSRpRt ySSSSeZdZdZedZedZy PVR# zp{VSHRRKdywRHR{:S(}VSRR|tur t|dStS R R |SxSxSReZdZdZedZedZeeZ yRS }yV(}VShRpSt#pRS~pShVS(RS| |||}||j|}|7 RSHSp{VSRS |jttd#ttf$rYywxYw0RR:S(}VSRPR|turt|ddddStS$`RR S@S@SpReZdZdZedZeddZdZedZ y PV8R p{VSRRtS8RR:S(}VSR`R|tur t|dStS HRR SSS`ReZdZdZedZedZeeZ y xRSS p{VS(RRKtwPV p{VSR S|SRxR:S(}VS RR|tur t|ddStSRXR SдSдSReZdZdZedZdZedZy SxS8S p{VSSSK|jdd{S7w HSSS yV(}VSP SSpSKtw'SSSpShVS SpSSK| |||}||j|}|wES@SSp{VSSS0SK |jtd{td7#ttf$rYywxYwwShS :S(}VSSS|turt|dddddStS' S S SSS SeZdZdZdZedZeddZdZe dZ yPV0S# p{VS SSKyw Sx S :S(}VS S@:S|tur t|dStS SP S S`S`S SeZdZdZedZedZeeZ ySS- p{VS S StPV2 p{VSHS S|ShS(S5:S(}VSSS|tur t|ddStSxSS) S(S(SSeZdZdZedZdZedZyPV0S#P p{VSSSKyw8SSU:S(}VSS`S|tur t|ddStS8SSL SSSpSeZdZdZedZedZySS` p{VS8SS|jdSSSf yV(}VSSpSt#SSmpShVS(SS| |||}||j|}|7SSHSzp{VSSS |jttd#ttf$rYywxYwSS:S(}VSPSS|turt|dddddStS'0SS\ SSS0SeZdZdZdZedZeddZdZe dZ y}V p{VSSSySS:S(}VS0SS|tur t|dStSSPS SSSSeZdZdZedZedZypuS HS(}VSS9SyH S S:S(}VSSpS|tur t|dStS X!S S SPSPSp SeZdZdZedZedZeeZ y"S@"S:S(}VS!S!S|turt|dddStSh#S#S SSS"SeZdZdZedZyPV@U  $S(}VS#S#St %S$S:S(}VS$SP$S|tur t|dStS8&S%SSSSP%SeZdZdZededefdZedZ yx()S(Sh(S.SS(S`'St|trt|dk(s td|\}}t|ttfrg||}nt |std|t ||||S+SP+S+S *SXTS*S)St|jdk(r&t|jdrt|Sddj |jddDcgc] }t |c}dt |jddScc}wJ8-S,S`}V(}VS,S,S|j}t|dk(rt|dst|dd|df}tt |ffSn/S/S(/S.SS.S.St|ts|f}t| |j}t|dtt fs|d}|dd}||f}t tt|S 2S1S XSSSS@1SeZdZdZdZfdZfdZdZfdZxZ SPV3S3S3 3SXTS03S2SK|]}j|k(ywNp6S6S5STSpSpS`5Sturyttrytd}jdk(xrt fd|DSwX9S8S 8SS8S8S 8St|tr6|jdk(r |jS|jd|jS|turyt|t r |j St|SpuS! :SAVS9S9SyP;S;S%:S(}VS:S@:S|tur t|dStS h8?SAVS@=SSMU(}VS>S=St|tstSt|t|kDxr|j |S=?Sx?SR8?SAVS>S>St|tstSt|t|kry|D]}||vsyyAPV@S\U(}VSH@S?St|tstSt|t|k(xr|j |S 8BSapsS(}VS(sSASAS||SPVBS3mISXTSBS`BSK|] }|vs| yw2CS@GSjUTSpCS CSt|tstSjfd|DSESqDSAVS0TSDS@DS|D]}||vsyyPVFS3{ESAVSES@ESK|] }|D]}|yw3GS@GSxGSAVSFS`FSt|tstSd||fD}|j|SPV(JS3HHSXTSGSGSK|] }|vr| ywS8ISKSUSSHSHStts'ttstS|j |j fd|DSPV(JS3ISXTSIS`ISK|] }|vr| ywSKSKSUTSJSPJSt|ts't|tstSj |}j fd|DSCPVKSU(}VSKS0KSt|ts't|tstS|j |}||z ||z zSQSQSPQSVSTSQS PStj}d|zdz}t|}d|dzz}||z}|D]#}t|}|||dzz dz dzz}||z}%||dz |dz z z}|d zd z}||z}||kDr||dzz}|d k(rd }|S<USUS1 SбSбSpTSeZdZdZdZdZdZdZdZdZ e dZ d Z e Z d Zd ZeZd Zd ZdZeZdZyWS@U yV(}VSVS@UtWS@U yV(}VSWS@Ut"@YSYSyV(}VSVXSpXS||vr t||j|y?0[SZSZS_SAVS8ThZSZSt|} t|}|j ||S#t$rtdwxYw#\S`\SSp{VS\S[S |j#t$rYywxYwPVP]S_SAVS]S\S|D]}|j||SPV^S_SAVS]Sp]S||z D]}|j||ShPV_S_SAVS^S0^S||ur|j|St|ts|j|}|D])}||vr|j ||j |+|S1PV8`S_SAVS_SP_S||ur|j|S|D]}|j||S/8cSbS S`S`SbSeZdZdZdZedZedZdZdZ dZ dZ d Z d Z d Zy PVS  zS(}VScSXzSt eSSdS$HSAVSdS`dS ||S#t$r|cYSwxYwSSeS+zS(}VSeS@eS ||y#t$rYywxYw gSfS3 p{VSfS`fSt|S 8hShS7 p{VSgSgSt|S `iS0iS; p{VShShSt|SJPV jS?U(}VSiSiSt|tstSt|j t|j k(S)plSkS SHhUHhUPkSeZdZdZdZdZedZd dZdZ dZ d Z d Z d Z dZy PVySM pmS(}VS mSlS||_yPV(nSP p{VSmSmSt|jSXoS(oSS p{VSnSnSdj|SPpSoSI S(S(SoSeZdZdZdZdZdZeeZ y PVsS]psS(}VS(sSpSrSt|SPVySa zS(}VSqSpS||jvSPVySqS#d p{VSqS`qSK|jEd{y7whrSvSY SSSrSeZdZdZedZdZdZy PVsSopsS(}VS(sSrSrSt|S0puS8uStSstSVShtStS|\}} |j|}||uxs||k(S#t$rYywxYw*PVyS0vS#|zS(}VSuSuSK|jD]}||j|fyw wSvSk SSS`vSeZdZdZedZdZdZy-SySxShVSwSpwS|jD]}|j|}||us||k(syy(PVySxS#zS(}VSxSPxSK|jD]}|j|ywySxyS SSS0ySeZdZdZdZdZyPVS TAVSzSXzStPVS zS(}VSzSXzSt,H}S}S|S|ShVS8TH|S{S ||}||=|S#t$r||jur|cYSwxYw6XSS~STAVSPS~S ~S tt|}||}||=||fS#t$rtdwxYw#SSSp{VS0SS |j#t$rYywxYwxSS XSVSVS`St|tr|D] }||||< n9t|dr|jD] }||||< n|D] \}}|||< |j D] \}}|||< ySSxSHSAVSUSS ||S#t$r |||<Y|SwxYw4SPS SxhUxhUSeZdZdZdZedZedZeZ e fdZ dZ dZ d dZ d d Zy PVhS  S(}VSpSSt'ShSS#hSAVSSSKd} ||}||dz }#t$rYywxYwwSSAVShS S|D] }||us||k(s yy/PVSU#ȌS(}VSxS0SKttt|D] }|| yww`SSЏSSPVS!T@SpS||dkrtt||zd}||dkr|t|z }|}|||kr ||}||us||k(r|S|dz }|||krt#t$rYtwxYwS`S3+0SXTSАSSK|]}|us|k(s dywHSS)yVSSSpStfd|DS$hSؔS SHSHS`SeZdZdZdZdZedZdZdZ dZ d d Z d Z y1SS 3@SSSSPS|dk7rddl}|jddt| ||||fi|S(КSS=@S0TSؙSSddl}|jddt| |SSS2 XSSȯSȯSSeZdZfdZfdZxZS SȜSF SSSSeZdZdZdZyPVhS[ (SAVSPSStPVhS_  S(}VSȝSStShSc (SAVS V؞SStSShyV(}VSXS S|jt||y#hS0SSlp{VSS`S |j#t$rYywxYw=SStSAVSPSSt|}t|dzD]}|||z dz ||c||<|||z dz <!y)SSzhSAVSSФS||ur t|}|D]}|j|y S`SAVS8TSЦS||}||=|SSSyV(}VSVS`S||j|=yPVSЩS(}VSxS@S|j||S8xSЫSR SXSXS0SeZdZdZdZedZedZedZdZ dZ dZ d Z dd Z d Zd Zy -0S`SSSdZddlmZmZddlZeeeZedZ dZ ee Z [ gdZ dZ eedZeeeZeeij%Zeeij)Zeeij-ZeegZeeegZeeedZeeed d zZeeeZeed Z eed Z!eee"Z#eij%Z$eij)Z%eij-Z&eejNZ(ed Z)dZ*e*Z*ee*Z+e*jY[*dZ-e-Z-ee-Z.[-dZ/GddeZ0GddeZ1Gdde1Z2e2jge+GddeZ4Gdde4Z5Gdde5Z6e6jge.GddeZ7Gd d!e7Z8e8jgee8jgee8jgee8jgee8jgee8jgee8jgee8jgee8jgee8jgee8jge e8jge!e8jge#Gd"d#e7Z9Gd$d%e8Z:e:jge)Gd&d'eZ;Gd(d)eZ<Gd*d+e;e7e<Z=Gd,d-eZ>Gd.d/eZ?d0Z@d1ZAGd2d3eZBGd4d5e=ZCeCjgeDGd6d7eCZEeEjgeGd8d9e=ZFeFjge(Gd:d;e;ZGGd<d=eGeCZHeHjge$Gd>d?eGeCZIeIjge&Gd@dAeGe=ZJeJjge%GdBdCeFZKeKjgeLGdDdEe9e=ZMeMjgeNeMjgeOeMjgeeMjgePGdFdGeZQGdHdIeMeQZReRjgeSeRjgeGdJdKeMZTeTjgeeTjgeyPVS8SAVSSS||_||_ySS p{VS8SSd|jd|jdS<PV@SS S(}VSS0S tjjt|#Yt|xYw SS SUUSeZdZdZdZddZyY}VSS # @S@USSpSddl}||_||_d|_|Dcgc]%}|D]}|jj || 'c}}|_ycc}}wHSSS, @ShVSSSS|jryd}|jD]*} t|d5}|j}dddn|s |j }|j d|_t|j|_y#1swYKxYw#t$rYwxYwa(SS< p{VSSS|jt|j|jkrdj |jSd|j fdzzSSxS0SCSVSSS|jd}d} t|||jzD]}t|j| ||jz }d}|t |}|dvrd}||dk(ryf#t $rYywxYw(SS SpUpU`SeZdZdZdZddZdZdZdZyxSb p{VS(SSy}VSeShVS@SSddl}|j|i|SSSX SUU`SeZdZdZdZdZy)SXSSSdZddlZGddeZGddeZGddeZy-0SSqTUSUUS tj|y#ttf$rYywxYwKS(SST(}VS U US tj|}tj|j S#ttf$rYywxYwKHSSS'S(}VSUUS tj|}tj|j S#ttf$rYywxYwPSpS0S3T(}VSTTS tj|}t j |jS#tttf$rYywxYw SS< XSS]T]TStj|jS 0SSA XSS]T]TStj|jS @SSF XSSx]Tx]TStj|jS SSK XSS@]T@]TStj|jSzSXSQSVSЎTЎT`S|syt|dttfs#tttj |}t |}t|}t|D]\}}|||k7s|d|cS|S50SSc S(}VS`T`T`S|j|jk(xr|j|jk(S7SXSjShVS]T]TStj|}tj|}t||S7SXSw ShVS\T\TStj|}tj|}t||SxSS!HS@USTTpS|j|}|r|j|}t||}|j|}||kDr*|dz}||kr |||dz|k7r |d|||dfS|dz }||kr ||ddfShSS"8SVS0T0TSdx}}|D]L}t|trd}t|trd})t|d|jj d|r|r tddyy:SHS #SpSdZddlZddlZgdZdZdZdZdZdZd Z d Z d Z d Z d Z dZdZdZdZySh^T#$UWTUTUTSt|tryyS0S3%S(}VWTUU0Stj|}|s|St|tr]t j }|j |djdd}ttt|}|j|dSttt|jddSS(SF&x_TWTUUStj|}t|trFtjtj |j ddjS|j ddjSmT8TW'ThVWTTTPTtj|}t|trd}d}d}nd}d}d}|ddj ||}|j |s|j |d ry y TTTk  (0TTWTTtj|}t|trd}d}d}nd}d}d} |s|dd|zt |\}}}t tj|D]b}t |\} } } | r | s|s| }| }| }| r/| |k7r*| j |j k7r| }| }| }N| }|r |d|vr||z}|| z}d|r|s|r|dd||zvr||z|zS||z|zS#tttf$rtjd |g|wxYw T T)H ThVWTpTpT Tt|\}}}|||zfS0TT  *XT8VWT8T8T Ttj|}t|tr d}d}d}d}d}n d}d}d}d }d }|j ||}|d d |k(r||d d |k(ri|d dj |k(rdnd }|j ||}|dk(r|||fS|j ||d z} | dk(r|||fS|d | || | d z|| d zd fS||d d |d d fS|d d |k(r!|d d|k(r|d d |d d|dd fS|d d ||d d fS|||fS|TT+HTVWTTTTtj|}t|}t|\}}}t |}|r||dz |vr|dz}|r ||dz |vr|d|||d}}||z|j |z|fSVTfT,8hTWTTT0Ttj|}t|trt j |dddSt j |dddSTxT  -8hTWTTT0Tt|dSTxT .8hTWTUU0Tt|dSWT TT/T(}VWTȡTȡTpT tj|}t |j tjk(S#tttf$rYywxYwTHpT# 0UWTȡTȡTTtj|y-qTHqTqT+1T(}VWTTT`T tj|}y#ttf$rYywxYwTTA2TVWThThTTtj|}t|}t|}t |\}}}|r |d|vr| S|r|syt rL|j |}t |j |}|j|jk(SyxTTT^30T@UWTUUTtj|}t|trd}nd}|j |s|Sdt |}}||kr+||t |vr|dz }||kr||t |vrdtjvrtjd}nEdtjvr|S tjd}t|tjd}|dk7rs|d|}t|trtj|}tjjd}||k7r%|t|k7r|Stt||}t|trtj|}|||d zS#t$rd}YwxYwv)T)T`(T4'T'TWTTT #Ttj|}t|trPd|vrd|vr|Sddl}t|j |j zdzd}d}d}d}d }d}ttd d}nDd |vrd |vr|Sddl}|j |j zdz}d }d }d}d}d }tj}|dd} d} t|} | | kr|| | dz} | |k(r5|| dzd}t|} |j| } | | |d| dzzz } n| |k(r|| dz| dz|k(r | | z } | dz } n|| dzd}t|} |j|} |d| } |:tjtjtj| }n|| }| |z } n%| |k(r|| dz| dz|k(r | | z } | dz } n|| dz| dz|k(rr|| dzd}t|} |j|} |d| } |:tjtjtj| }n|| }| |z } n|dd} | dz } || | dz} | r| |vr| | z } | dz } || | dz} | r| |vr |:tjtjtj| }n|| }| |z } | r | dz} n| | z } | dz } | | kr| S#t$r| | |zz } | dz } Y&wxYw#t$r || z|z}YjwxYw#t$r| ||zz } | dz } YZwxYw#t$r||z| z|z}YwxYw#t$r| ||z|zz } | dz } YwxYw#t$r|| z}YwxYw,T0,T  5+T8VWTPTPTP*Ttj|}t|tr d}d}d}d}nd}d}d}d}|j ||}t |\}}}||z}|j |}d } | t|kr_|| r|| |k(r|| =n?|| |k(r2| d kDr|| d z |k7r|| d z | d z=| d z} n| d k(r|r|| =n | d z } n| d z } | t|kr_|s|s|j|||j|zSqp.T8T46T(}VWTPSTPST-Ttj|}t|sEt|trtj }ntj }t||}t|S6/Tx/T8/TL7UWTVV.T tt|S#ttf$rt |cYSwxYw83T2TP2TY82TVWT`RT`RT1Td}t}t||vro|jt| |}t|}t |s.t |s|} |St tt||}t||vro|S#t$r}|j|vrYd}~|Sd}~wt$rY|SwxYw6T`6T5T95TPVWTRTRT4Td}|dd}|r t|}|r t||S|S|S#t$r{}|j|vr t |}||k7r|r t||n|cYd}~Sn#t$rYnwxYwt |\}}|r |s ||zcYd}~S|r t||n|}Yd}~nd}~wwxYw|r=TUWTPTPTKTyO[TXT XT ?WTUTdZdZdZdZdZdZdZdZdZdd l Z dd l Z dd l Z dd l Z dd l gd Z d Z dd lmZmZmZdZdZdZdZdZdZdZe j<je_dZdZ e!e jDdrdZ#ndZ#dZ$ ddl%m&Z&dZ'dZ(dZ) dd l%m*Z+d"Z, dd#l%m-Z-d$Z. dd%l%m/Z/m0Z1d&Z2d'Z3d(d)d*Z4d+Z5d5d,Z6d-Z7 dd.l%m8Z9dd/l%m:Z;dd0l%mZ? dd2l%m@Z@d3ZAy #e$rdZYwxYw#e$rd Z&YvwxYw#e$rd!Z+YtwxYw#e$re,Z.YtwxYw#e$re.Z4YlwxYw#e$rYUwxYw#e$rd4ZAYy wxYw^Th^T)@UTHTHT ^Tt|tryy_THpT4 Ax_TTUU0_Ttj|S2`T`T<Bh`T(}VTTT`Ttj|}t|}|j|SdTcTHcTGCcTVT bTtj|}t|}|} |s|dd|zttj|D]7}|j |r|}|r|j |r||z }0|||zz }9 |S#t ttf$rtjd|g|wxYwgeTnTdDeTVTTTdTtj|}t|}|j|dz}|d|||d}}|r"||t |zk7r|j |}||fSG gTfTuEfTAVTTTfTtj|}t|trd}d}nd}d}t j ||d|ShhTHpT F8hTTpTpTgTtj|}|dd|fS_kTpkTG0kTAVT8T8TpjTtj|}t|trd}d}nd}d}|dd|k7r|||fS|dd|k7s|dd|k(r|||ddfS||dd|ddfS:mTHmTHmTAVTTTlTtj|}t|}|j|dz}||dS`PoTnTInThVTUU nTtj|}t|}|j|dz}|d|}|r"||t |zk7r|j |}|SpTHpT JUTȡTȡTpTtj|y-qTHqTqTKUTTTpT tj|y#ttf$rYywxYwuTtTtTLHtT@UThThT0sT tj|}tj|jrytj|}t|tr t|d}n t|d}t|} tj|}|j}|j}||k7ry|j}|j}||k(ryy#t t f$rYywxYw#t t f$rYywxYw{T{TzT  M zTVTUU@xTtj|}t|trd}nd}|j |s|St |}|j |d}|dkr t|}|dk(rZdtjvr4 ddl } |jtjj}natjd}nM ddl }|d|}t|trtj|} |j!|}|j}|t"j$dk(r|St|trtj&|}d}nd }|j)|}|||dzxs|S#t$r|cYSwxYw#t$r|cYSwxYw#t$r|cYSwxYw#t$r|cYSwxYwTTpT@  NTTTTT~Ttj|}t|trRd|vr|Sts ddl}|j d|jatj}d}d}ttdd}nPd|vr|Sts ddl}|j d |ja tj}d }d }tj}d} |||}|s |S|jd\}}|jd } | j|r| j|r| d d } |:tj tjtj"| } n|| } ||d} |d|| z}t%|}|| z }#t&$r|}YwxYwȅTXTy  OT8VTPTPTЃTtj|}t|tr d}d}d}d}nd}d}d}d}||k(r|St |\}}}|j |}g}|D]A} | ||fvr | |k7s|s|r |r|d |k(r|j | /|s2|jC|}||j|z}|xs|SqT8TPT(}VTVVTtj|}t|sEt|trtj }ntj }t||}t|S5XTTQȈThVTTT`Ttj|}t|dd||i\}}t|SMpT،TT  RTVTTTPTt|trd}d}d}nd}d}d}t|r|dd}|}|r|j|\}}}|r||k(r ||k(r&|r!t |\}}||k(rt |||}n|}Kt ||} t j| } tj| j} | s| }| |vr.|| }||rt j| nt | |dfSd|| <t|t j| ||\}} | st ||dfS||| <|r|d fS#t$r|rd} YwxYw(hTTPT  ST8VThThTT|s tdtj|}t|trd}d}d}nd}d}d}||}ntj|} t |j |Dcgc]}|s| }}t |j |Dcgc]}|s| }}tt||g}|gt||z z||dz} | s|St| Scc}wcc}w#ttttf$rtjd ||wxYwTT3,TTXTTTВTK|] }|ddk(ywVPTTT   UxT8TT0T0TT |s tdtttj|}t |dt rd d}nd d} |Dcgc]}|j }} t fd|D\}|Dcgc]}|Dcgc] }|s||k7s |c}}}}t|}t|}|} t|D]\} }||| k7s|d | } n|r n d d} | j| zScc}w#t$r tdd wxYwcc}wcc}}w#ttf$rtj d g|wxYwTxT0T VTTdZdZdZdZdZdZdZdZdZddl Z ddl Z ddl Z ddl Z dd l gd Z d Zd Zd ZdZdZdZe j(je_dZdZdZdZdZdZdZdZdadadZ ddl m!Z"dZ$dddZ%d Z&e jNd!k(Z(d$d"Z)d#Z*y#e#$rdZ"Y-wxYw PVT) Wx6VxUpUpU@T|tvSNTTPT,X T(}VxUpUpUT t|jS#t$r+t|Dcgc] }|ddk7s |ncc}wc}cYSwxYw0PVThYT(}VxUXnUXnUPT|tvr&|tvrtjt|yyyThTTZTPVxUPlUPlUЭTtj|\}}|stj|\}}|rQ|rOtj|s: t||t }t |trtt d}||k(ry t||y#t$rYEwxYw#t$r|rtj|sYywxYw~pT(TT[TAVxUlUlUTt|tj|\}}|stj|\}}|r.|r+ t|tj|\}}|r|r)yyyy#t$rYywxYwTT@T\ThVxUkUkU`Ttj|\}}|r"|r tj|s t|t ||tj|\}}|r|r t |yyy#t $rYywxYwSTTT##]TTxUxkUxkU@TKtjd||||t|g}tjtj }}|r|j }t|tr|'g}g}g} t|} d} | 5 t| } |tur&| jdxr| j }n| j}|r|j!| j"n|j!| j"|s8|r6|rd}n | j%}| }|r| j!| jyy#t$r} ||| Yd} ~ d} ~ wwxYw#t$rYnHwxYw#t$r} ||| d} Yd} ~ n*d} ~ wwxYw#t$rd}YwxYw#t$rd}YwxYwdddn #1swYnxYw| r|r=|||ft'|D]'}|||}|s ||r|j!|)n5|j!|||ft'| D]}|j!||r wTPTT#  ^xTVxUkUkUTKtjd|||||t|}td|||dffg}t |t } |rt |||||Ed{|r|r+|j\}}|tk(r t||r*yy75#|r+|j\}}|tk(r t||r*wwxYww@TTT32_`TVVxUTTK|]}td|z|dffyw"@TTT36`T`TxUTTK|]\}}td|z||ffywbXTpTT# 'aTTxU@jU@jU@TK|j\}}|tk(r t|y|tk(r|y|tk(sJ|\}}} } |s#| t | d|} n| j d} t | ttz||jtf|sB|r tj jsytj t syt!} g}g}|s|rdng}| D]b} | j"}|r t%|} | j'r%|j||#|j| n|j|d|r ||fn|jt||fftj*dd|"|j-fd|dddDy|j-fdt/|ddd|dddDy#t$r} |r||| Yd} ~ yd} ~ wwxYw#t$r6 | j)r|j|n#t$rYnwxYwY[wxYwwTT<bT(}VxUjUjUXTt||y0TTCc8TAVxUiUiUT|d}t||dd|yT`TKdT(}VxUiUiU Tt||y TTRe8TAVxUiUiUT|d}t||dd|yTxT[fT(}VxUPiUPiU@Tt||yTxTcg8TAVxU iU iUTt|||yTTTn  h8TVxUhUhU T| t}||f}nt}|f}t}tj|r ||g|yd}t |}t dk7rt|}tt|}|D]"}tj||} ||g|$|| #ttf$r } | } Yd} ~ Ad} ~ wt$r} | } || }Yd} ~ Xd} ~ wwxYw`TT0TiThVxUhUhUTddl}|t}|j5|jdt |j d}tr2 |d}| td|}|t|tr t|}dddt}|jtS#t $rd}YjwxYw#tt f$rYdwxYw#1swYLxYw%PVTjHTPVxUTT||_||_||_||_||_yJPVTTkTAVxUPTT |j|j|}|j|S#t$r t|dwxYw?PVTlTAVxUTpT|j|}|j|}t||||j|<yEPVTTmxTAVxU(TT|j|}t| |j|=y#t$r t|dwxYw5PV(TT#nTAVxUpT TKt|j}|D]}|j|ywPVT op{VxUT`Tt|jS7TTT3phT0TxUTTK|],\}}j|dj|.yw:`T TqTTxUpTTdjfdjjD}d|dS PVT rp{VxUTTt|SPVsTAVxUUT@T||vr|||<||SPVUtU(}VxU8UU|j||S5PVUupUAVxUU@Ut|tstSt|}|j ||S5PVUvpUAVxU UUt|tstSt|}|j ||S*@UU wxUhUhU0UeZdZdZdZdZdZdZdZdZ dZ d Z d Z d Z d Zy 4UU xUxU` U UUt|ts!tdt|jz|SPVUyU` UxU( UhU0U|jSEpUUz U` UxUU`Ut|ts!tdt|jz|j dS U U{ U` UxU UU|jdS{P U U| UH UxUgUgU Utdk(r:d}|t}fd}i}tjD]\}}||||<n&t j fdfd}}t}t ||||S U U(}U(}VxUgUgUp Utj||S40UU2~UxU0gU0gUPUt|ts!tdt|jz|SUU=U(}VxUfUfU@Utj||S1PUUIUHUxU(fUU`Ut|}t|tr|jS|S1UUUUHUxUPVUUt|}t|tr|jS|S;UUE@UUxU`fU`fUUtjtjfd}fd}||fSU@UUrU@UxUPeUPeUUt|ttfs td|r|ds t dt }|s | |||n ||||yy|tk(r|S t|d\}}t|rt|S#t dYyxYwUU)UAVxU eU eU@Ut|||dtSUUh,UhVxUdUdUPUt||||tS!U!U)UAVxUdUdU`!Ut|||dtS$U#Uh,UhVxUdUdU#Ut||||tS%U%U)UAVxUXdUXdUp%Ut|||S'U'Uh,UhVxU(dU(dUp'U|d}t|||dd|Sh*U8*U)UAVxUcUcU)Ut|||S,U,Uh,UhVxUcUcU,U|d}t|||dd|S1U1U0UVxUcUcU/Ut|tstdt|z|dvrt d|z|dk(s| t dddl}|dk(r6|j |dd|j|}t|j|S|j |dd|j| }t|j|SPV3U 2UAVxU2UP2U||_||_yK 5U4U 4U(}VxUH4U3U|jj|jj}|dk(rytdk(r|S|dzSPV p{VxUX5UxFU|SPVpGU `}V(}VxU5UFU|jyPV6Uh6U(}VxU6U5Ut|j|SPV7U p{VxU87U7Ut|jSx8U8U  xUXcUXcU7UeZdZdZdZdZdZdZdZyZ:UP:U$9UVxU(cU(cU`9Ut|tstdt|zddl}d|vr|j |}|j ||||g|i|Sx?U?U>U/>UAVxUbUbU=Ut|ttfr|St|} |j |}t|ttfr|Stdj|jt|j#t $r&t |drtd|jzwxYw@U@UW p{VxUH@U@Ut0BUAU\AU(}VxU`AU AU|tur t|dStS*CUpCUS xU`bU`bUCUeZdZdZej dZedZee Z yPVPEUgEUhVxUDUpDU||_||_||_y$PVHFUk p{VxUEUEU|j|jd|_yPVn p{VxUFUxFU|SPVpGUp `}V(}VxUGUFU|jy)HUHUr p{VxUhHU HU|jrdj|jSyIUIUf xU bU bU0IUeZdZdZdZdZdZdZy. MULUwLUAVxUaUaU0LUddl}|j|}t|||jSH}UyU0yUxUrUdZddlZddlZddlZddlmZeee Z ejZ gdZ dZdZde vrIdZdZdd l dd lmZe j)d ddlZ dd lmZddlZe j3ee[nUd e vrId ZdZdd l dd lmZe j)d ddlZddlZe j3ee[ dd lmZnedeej8d<ddlmZmZm Z m!Z!m"Z"m#Z#m$Z$m%Z%[ edre&Z'dZ(e)Z*e(dde(dde(dde(dde(dde(dde(d d!e(d"d#e(d$d%e(d&d'e(d(d)e(d*d+e(d,d-e(d.d/e(d.d0e(d1de*Z+e)Z*e(dde*Z,e)Z*e(d2d3e(d4de(d5de(d6d7e(d6d8e(d9d:e*j[ee(d;d<e(d=de(d>de(d?d@edAredBr e(dCdAe*Z.e)Z*e(dde(dde(dde(dDdEe(dFdedGr e(dHde(dde(dIde(dJde(dde(d1de(dKde*Z/[*[['[(dZ0dLZ1dMZ2ddOZ3dPZ4dQZ5e j3gdRe6Z7ddSZ8e j)dTe9ehe+kr)e:ehe.kr"ddNddUdVZ;dZdWZ?e j)dXdYZ@dZZAd[ZBd\ZCd]ZDd^ZEe j3gd_dd`ZFddaZGddblmHZHmIZIGdcddeHZJdeZKeKZL[KddfZMed k7ZNe j3dgeNr/dhZOeJeLjeOeQeOeQZR[OddiZSe j3djdkZTeT\ZUZV[TedlrKedmsCednr;dZWdLxZXZYe j3gdodpZZdqZ[drZ\dsZ]dtZ^e j3gduedmrdvZ_dwZ`e j3dxdygedzrd{Zad|Zbe j3d}d~gejdk7rddZdGddZee j)dddZfdZgeds egZhdeh_iGddejZked k(rGddZldZmyy#e$rYwxYw#e$rYwxYw#e$rYWwxYw#e$rY3wxYw8ȂUxU\HU@V@U@UUtjjrt|tjyymPVhU UaU(}V@VUU`Utjj|} tjj|}|tjj |fS#t$rY,wxYwUUpUjHU(}V@VUU UttjjD]~}d} |jj }|dvr! tjj|j|_ tjj|j|_y#t $r4 |jjj }n#t $rYnwxYwYwxYw#t ttf$rYwxYw#t ttf$rYwxYwlU0UUhV@VUUPUg}t}tjD]7}t|\}}||vs|j ||j |9|tjdd|SpUxU0UUhV@V`U`U`Ut}tjD]A} tjj |rt |\}}|j |C|S#t$rYQwxYw8UU`U "ȖUU@V(U(UU| t}d}nd}tjj||} tj|}t |ddtjzst |ddtjzrtd|ytd| tj|5}|j}ddd jd }t%|j'd D]\} } | j)d r| j+dk(r, | j)dr t-| J| j/} t1|| \} } | |vrOtjj3| r0t4jj7| |j9| |rd}|S#t $rYywxYw#1swY xYw#t $rYywxYw#t$rFddl}j|j#}td |d |j#YWwxYw#t:$r} t=d| dd|dt4j>ddl }|jC| D]5}|j'D] } t=d| zt4j>"7t=dt4j>Yd} ~ d} ~ wwxYwUU0UUPV@VUUUtd|| t}d}nd}t|\}}||vr0tjj ||j | tj|}|Dcgc]&}|jdr|jds|(}}t|D]}t||||rd}|S#t$rYywxYwcc}wСU`U @VUUUtjjryttdr:ttdr*t j t j k7ryttdr:ttdr*t jt jk7ryy:PVU&`U@V0UUUtjjtjj|S0UȦU UAV@VxUxUUtjjdd}|r|Stjdvryd}tj dk(r,tjjdxsd}||dStjdk(r=tj r-|dd tj d tjdd zS|dd SЪUhU5(UAV@V@U@UpUtj}tjdk(r(tjj dd}|d|dStj dk(rtjr|dS|d|d d|d d SUUB @VUU@Ut tatS,ЮUUO XU@VUUUt}t|datSt|atSIUU`XU(}V@VUUUtdt}tr+tjj |r t |||SU U oUV@VPUPUUg}t}|t}|D]}|r||vr |j|tjdk(rt j g}t j dk7r|jd|D]I}tjj||dt jddzd}|j|K|j||jtjj|dd|SJUU`UAV@VUUUtdt|D].}tjj |s#t ||0|SXUUU@VUUUtjdk(rd}nd}tjd|t_tjd|t_y&8UUHUAV@VUU@Utjdtjt_tjddt_gg}}t tdd}|s=ttdr-tjjtj}|ra|jddg|jtjj|tj|tjgtjd d ||t_yPV(U @VxUxUUtjt_y$PVUUU`U@VUUU jy#t$rYywxYwUUU`U(U@VUUUddl} ddlddl}t dd}|d|vrj dnj d j jdk(rgtjjtjjdd jfd }|j|yy#t$rYywxYw#t$rYwxYw#t$rYBwxYwUU U@V8U8U@Ud}|t_y/PVUU3 `U(}V@VUUK|]%}tjj|r|'yw!U UUHUU@VUU0Utj}tjdk(r#d|vrtjdx}t_ntj }tj jtj j|}tj j|}dt_ d}tdtj j||tj j||fDd}|r|}d}t|d5} | D]q} d| vs| jd\} } } | jj} | j} | d k(r| j}a| d k(sg| t_ s ddd|xt_t_t%|tj g|dk(r&t&j)d tj |Stj gad a|S#1swYzxYwPUU0U3UAV@VUU0U ddl}y#t$r}|jdk(rnYd}~yd}~wwxYw#t$r}tj j r%t jt jn?tjjd|jjd|dYd}~yYd}~yd}~wwxYw UU0UGUAV@VUU0U ddl}y#t$r}|jdk(rnYd}~yd}~wwxYw#t$r}tj j r%t jt jn?tjjd|jjd|dYd}~yYd}~yd}~wwxYwUU[U(}V@VVVUtjdd}t}|tjk7r tt |}t t at|}t|}ttttjjs ttt r t!yy$PUU U@VUUPU| tjj|ryyUU}U@U@V(U(UUd}tjdd}|st}t}t dtj D]}t d|dt dd}t d|d ||d t d |d ||d t d t tjd g}d|vr|jtd|vr|jt|rt tjj|t rtjd yt durtjdyt tjdytjdyd dl}t |j|tjd tjfztjdyVV @V0VdZddlZddlZddlZddlZddlZddlZejejga da da da dZ dZdZdZdZdZdd Zd Zd Zd Zd ZdZdZddZddZdZdZdZdZdZ dZ!dZ"dZ#ejHjJse#dZ&e'dk(re&yyV ` V'V"V"VV|dzSV ` V'VX"VX"VV|dzSVXV2 ` V'V0 V0 V0 Vt|tk(S`V(V6 ` V'V V V0 Vt|tk(S0VV: ` V'VVV0 Vt|tk(SVV> ` V'VVV0 Vt|tk(S V VB ` V'VhVhV0 Vt|tk(S Vx VF ` V'V8V8V0 Vt|tk(S Vh VJ ` V'VVV Vt|tk(S VN ` V'VVV( Vy VR ` V'VVV( Vy VV ` V'V`V`V( VyUVVpVV'VVVVg}tD]8}|D] \}}||z|k(s|j|'|jd:dj|S*V((V'V 'V$VdZdZdZdZdZdZdZdZdZd Z d Z d Z d Z d Z dZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZdZ dZ!dZ"e"Z#d Z$d!Z%d"Z&d#Z'd$Z(d!Z)d"Z*d#Z+d%Z,d&Z-d'Z.d Z/dZ0dZ1dZ2dZ3dZ4dZ5dZ6d Z7d'Z8d&Z9dZ:d(Z;d)Zd,Z?ed-fed.fed/fed0fe d1fed2fed3ffe)d4ffe*d5ffe+e!zd.fe!d6fe+d7ffe-d4ffe.d5ffe/e"zd.fe"d6fe/d7ffe1d4ffe2d5ffe3e$zd8fe$d9fe3d7fff Z@d:ZAd&ZBdZCd#ZDd'ZEd ZFdZGdZHd"ZIdZJd)ZKdZLdZMdZNd ZOdZPd!ZQd(ZR dd;lSy<#eT$rYyV>Vt||_y'PV0@V p{VgV?V?Vtj|j|_|S%PVBVAVAVgV0AV@V|j}|`tj|yHCVCV p{VgVIVBVpBV|jrdSdSPJVIVw gV0cV0cVIVeZdZdZdZdZdZedZyOV@OVNV  NVVgV(NVLVtj|d}|j}|d5tj|dtur#|drtj||cdddSd|d<tj|d}|j}|d}|}i}|j D]2\} } | |vr| || <t || t || k7s.| || <4|jj||tjvr7t |t tj|k7rtd|d |j|tj|_dddt!||S#1swYxYwRVQVQV(}VgVPQVQV|j|t||yPSVRV gVbVbVRVeZdZdZdZdZy UVTVTVgVhTV TVSVt|ds tdyPV@VVVVgVUVUV|i|S0XVXVWVWVgVPWVWVjfdSPV YVXV(}VgVXV`XV|j|||_yPVZVYV(}VgV ^VYVPYV|jj|S]V\VX\VhVgV]V\V`[Vddl}|j|j_|j|_i}|jj |d<|j |d<|j|d<d|d<||j_t|_y!`V_V gVbVbV_VeZdZdZedZedZdZdZ dZ y@iVHhVgV`gVdZddlmZddlmZddlmZddlmZddlmZddlm Z ddlm Z dd lm Z dd lm Z dd lm Z dd lmZd dlZd dlZd dlZdZdZddZddZGddZGddej.ZGddeZy(kVjV PrVmVmVjVttztzSQhsVrV PrVqVdZddlmZddlmZddlmZddlmZmZmZm Z m Z ddlm Z ddlm Z ddlm Z dd lmZdd lmZdd lmZdd lmZd Zy PVtVuV(}VV@tVtV||_t||_g|_yhPVHvVvV!uV(}VVuVuV|j} |jjtj||j tj|<|S#t $rY*wxYwb}VwV*`}V(}VV@wVvV|jr2|jdtj|j<g|_ytj|j=g|_yxVxV VVV@xVeZdZdZdZdZdZyPVyV2yV(}VVpyV0yV||_tx|_|_yZ{V{V6 p{VV{VzV|j|jur tdtjd|_|j tjd<y0}V}V<`}V(}VV|V|V|j|_|jtjd<y~VX~V1 VVV~VeZdZdZdZdZyuHVV A  xV8VVVVV||j||d}|}d} n2|j}|j}|j} | |j}|j||| d|||t |||SVV0V [  ȃVVVhVhVV||n |j}t|5}t|5|jj}t |||||||ddddddj S#1swY!xYw#1swYj SxYwL0V8VV i   VVVVV0V|jdr|d|jd\}}}|rc t|t j j|}|6t|ds*ddl m }dj||}|t| tjj|}| |d|z|j,0|dk(s|j'dr|d |dz} t/| |S|j0} | |d|z | j3|} | |d|z||| fS#t$rE}|j-|j|k7r|j|jdzsYd}~Fd}~wwxYw#tt t"t$f$rT} d}|j'd r|d |dd d |d z }||j|t)| j*| | d} ~ wwxYw#|$r&}|t j vr||d|dd}~wwxYw#t$r}|t||d}~wwxYwVPV VVVhVeZdZdZyVhV VЗVVVHVHVЖV |s|dk7rt|t\}}}ntt\}}}tj dj}|rjtjd<t|ddS#t$r4}tjd|}tj |Yd}~d}~wwxYw3 VVVPVVVVVt|\}}}||}|rt||||St|i|||SV8VVVhVVȸVȸVVd}tj|}tj|= t||tj|<S#t$r3}|t |vr |d|dtj d|d}~wwxYw#|tj|<wxYwHVاVVHVVVVVpVddlm}tjj |}t j |5}||}ddd;t j |5}t|j|d}ddd|S|S#1swYHxYw#1swY|SxYwV0VpV   VVVPVPV V|d}|jdd}ddlm}||}tj|}t |t drt|}t|||||Stjjd| t\}}}t|5} t|5| jj } t#|| ||||j%cdddcddd tjj'|S#t($rYSwxYw#1swYnxYw dddn #1swYnxYw tjj'|y#t($rYywxYw# tjj'|w#t($rYwwxYwxYwVVVVdZddlZddlZddlZddlZddlZddgZeeZ Gdde Z Gdde Z dd Z dd Zefd ZGd d eZddZ ddZefdZdZddZedk(rMeej4dkredej8yej4d=eej4dyyVPV VHVHVpVeZdZdZyVPV VVVpVeZdZdZyVPV VVVVeZdZdZy VV VVVpVtdy2VHV VVdZGddZGddZGddZdZedk(rey y VV VVVpVtdyXVV V@VdZdZedk(reyyPV VVyPV VVy VV VVVpVtdy VV V@VdZdZedk(reyy VV 8VVdZedyXb1 +>XX\>D@hb1-0=XXXT1(X`e1 PG(@$eb"XCؕ/Cx'1g18p,.^XXA`<T,DX8XpX@A10 /x./`1111M/11` 1@D0H111h1`<000x0X0B1. B1(B1@.Б./8B1/\1 l@q[1@r[1()8X X@Pt@+@X1P1@PY1  X/̕(X@ t8;.0̕(X@ t8;X/̕(X@ t8;10\@Sȉ1 w#W@Q.b!Y[1 @LrC/Ch'1Cx'1CȻ/Ch'1C8&0C/C8&0Ch'1C8&0Cx'11@pQ.$T.<@4Y2& &Cy%%%& //V/Simple substitute for functools.update_wrapper.BH 3 C'#w"7 8ILL %OP 49T?`V0^P%wtR= 7_WeakValueDictionary.__init__..KeyedRef.__new__OSVob T[[18_WeakValueDictionary.__init__..KeyedRef.__init__OSVN$~#..55bff= 55diiH $6_WeakValueDictionary.__init__..KeyedRef.removePOOhO@O^PpO(I   2 I I/_WeakValueDictionary.__init__..KeyedRef@O ^VVOP%K&K'K self_weakrefKeyedRef5||D)  Ix|| I." _WeakValueDictionary.__init__OO^POO@)KO _iterating!#% _WeakValueDictionary.clear@OUhO_remove_dead_weakrefV$$(( II e  ) )!S 1   %_WeakValueDictionary._commit_removals8TA AA@O8TS^PpOwrW  ! !  ! ! # 3BT "  N _WeakValueDictionary.getPO: AA@O(OtV _KeyedRef_pending_removalsm  # A 9%%%%'!^^GS9DIIcNNH A _WeakValueDictionary.setdefaultA A%$A%tV@O(OO_commit_removals@ 2  (OU]PP*K+K,K .K/KPV" _BlockingOnManager.__init__OxZVOxZVCMark the running thread as waiting for self.lock. via _blocking_on. thread_id4'11$..%'J tyy)_BlockingOnManager.__enter__]PUO0^POxZVxO6Remove self.lock from this thread's _blocking_on list. blocked_on tyy)_BlockingOnManager.__exit__OVxZVXO;A context manager responsible to updating ``_blocking_on``.E **@]PO2K2KP4K]POPOOCheck if 'target_id' is holding the same lock as another thread(s). The search within 'blocking_on' starts with the threads listed in 'candidate_ids'. 'seen_ids' contains any threads that are considered already traversed in the search. Keyword arguments: target_id -- The thread id to try to reach. seen_ids -- A set of threads that have already been visited. candidate_ids -- The thread ids from which to begin. blocking_on -- A dict representing the thread/blocking-on graph. This may be the same object as the global '_blocking_on' but it is a parameter to reduce the impact that global mutable state has on the result of this function. edgescandidate_blocking_on M!)4)==%=  H_  S)>>(=(=> 9xu' )!$  ?OOPOOOOxZVOA#\PhO8O allocate_lockE*MMO ++-     _ModuleLock.__init__ ^PZVxZVȠOhOO blocking_on candidate_idsseen_ids target_idOOPOO0 '')U ::,$  _ModuleLock.has_deadlock\P^PȨOU]POdeadlock detected by Acquire the module lock. If a potential deadlock is detected, a _DeadlockError is raised. Otherwise, the lock is always acquired and True is returned. tid ! T *YYzzR'4::+<&)  ))$/# + *D((*,/DTH-MNN{{**51 ++D1Yb ##%  ##%uY + *_ModuleLock.acquire0DAD1DAD=DD DD( ^PȨO@]PxZVO]PhOPOOOpOwakeupwaiters get_ident! YYzzS "#DEEtzz?Q& && JJNN tzz?! t||$q(LL$$&KK'')YY_ModuleLock.releaseO B7C!!C* ^PȨOxZVxzV8TOhOO _ModuleLock(dii]%4z::_ModuleLock.__repr__0OpOA recursive lock implementation which is able to detect deadlocks (e.g. thread 1 trying to take locks A then B, and thread 2 trying to take locks B then A). has_deadlock# 6p B&H *; OPO\P0O8K:KP;Kp>KAK  _DummyModuleLock.__init__ a _DummyModuleLock.acquirecannot release un-acquired lock& ::?@A A a _DummyModuleLock.releasexzVO) at _DummyModuleLock("499-uRXJ??_DummyModuleLock.__repr__OpOVA simple _ModuleLock equivalent for Python builds without multi-threading support.  @POX\POCKCKDKFK  _ModuleLockManager.__init__QO"%djj1  _ModuleLockManager.__enter__[PQOPO_lock _ModuleLockManager.__exit__PUVO\PGKHKJKI!!#(%((.#5)$/%%'D%%'_get_module_lock..cbO A AhdV#P]PP%PGet or create the module lock for a given module name. Acquire/release internally the global import lock to protect _module_locks.refcb    &(D <'-"4(! (#+,,tR"8M$   K1 D , xZV(O) A;AB ; B B B  B B" hdV#P]PtV^PX\P\P^POP%P@OKKAcquires then releases the module lock for a given module name. This is used to ensure a module is completely initialized, in the event it is being imported by another thread. acquire= D !D      xZV . ::[PPO]PhO.remove_importlib_frames in import.c will always remove sequences of importlib frames that end with a call to this function Use it instead of a normal call in places where including the importlib frames introduces unwanted noise into the traceback (e.g. when executing module code)  d d SȾO# 0U=Print the message to stderr if -v/PYTHONVERBOSE is turned on. verbosityJ yyI%!!"23WnG ngnnd##**5&O`VUȋVV0OOOXV8 333 3 ,EF#+- -4""4_requires_builtin.._requires_builtin_wrapper`VPqU0VOx6V1Decorator to verify the named module is built-in._requires_builtin_wrapper#  #S) $$(OOpO SK is not a frozen module6~~h' ,CD#+- -4""2_requires_frozen.._requires_frozen_wrapper:V(OhdVMP0VOx6V/Decorator to verify the named module is frozen._requires_frozen_wrapperfxn#  "C( ##(OOPO0UKgthe load_module() method is deprecated and slated for removal in Python 3.12; use exec_module() insteadLoad the specified module into sys.modules and return it. This method is deprecated. Use loader.exec_module() instead. a  3C NN3*+ Hd +D3;;X& dF{{8$$T{:VVQȌVT@fV`V0ZPYPO@O,The implementation of ModuleType.__repr__(). V\4 0Fvz400t0%d++6??$|155  5 >dXQ' 'dXRz4 4 5VV( A A AAA;/ A;:A;`ZPV OO OhUPOD   (0:"')+&# ModuleSpec.__init__V [VQV [VVpPhOsubmodule_search_locations=origin=loader=name= }%'@A ;; " KK'$++1 2  * * 6 KK5d6U6U5VW X..))*!DIIdO+>ModuleSpec.__repr__VVOOPOOT.. "II+<KK5<</<KK5<</<E<<<<KK5<</ < %%););;  =  "! ! "ModuleSpec.__eq__ULQBB$$B65B6VVV PV@UJ << {{&4+=+=&.--2>>t{{K ||hOpPqVRrQ_cached  ModuleSpec.cachedVhO The name of the module's parent.4  * * 299'',Q/ /99 ModuleSpec.parentVVpO!!!pP!%[ModuleSpec.has_locationP>VpP [VQThe specification for a module, used for loading. A module's spec is the source for information about the module. For data associated with the module, including source, use the spec's loader. `name` is the absolute name of the module. `loader` is the loader to use when loading the module. `parent` is the name of the package the module is in. The parent is derived from the name. `is_package` determines if the module is considered a package or not. On modules this is reflected by the `__path__` attribute. `origin` is the specific location used by the loader from which to load the module, if that information is available. When filename is set, origin will match. `has_location` indicates that a spec's "origin" reflects a location. When this is True, `__file__` attribute of the module is set. `cached` is the location of the cached bytecode file, if any. It corresponds to the `__cached__` attribute. `submodule_search_locations` is the sequence of path entries to search when importing submodules. If set, is_package should be True--and False otherwise. Packages are simply modules that (may) have submodules. If a spec has a non-None value in `submodule_search_locations`, the import system will consider modules loaded from the spec as packages. Only finders (see importlib.abc.MetaPathFinder and importlib.abc.PathEntryFinder) should modify ModuleSpec instances. setter"H04$  ? " ]]"")) @IVV O P qV OOZK[K]K0`KaKbKcKdK5Return a module spec based on various loader methods. ~D1 gfn5  &% %"5"M"M  *4? ?!t&tFBHJ J 6< ( "#..t4 J dF6j II  "!  "VQdV}T&B BBVqVRdVQ0VqV O(!P QTVkQQHUP5  K ??D ~ &&F??~  VY5F(.F""*%)&//%:" dF6 2D"*"289KDDK&@D# KG          *%)"*VVPVVW B B/ B> CC B,+B,/ B;:B;> C  C  CC C.-C. V~VqUqVpPVV(!PP GFJ5= "iiFO76<6> >..:&.--"5"E"E(00A#>> $ #'  &F 76=$7? !%F  76:t4<  * * 6 "&"A"A  wvz48@ "&++ wv|T:B{{&(, F% M6M   8           "  "  & MVIVVnV}EE#/E2F$FF>F. E E # E/.E/2 E>=E> F  F  FF F+*F+. F;:F;VVVqVRnV/Q PV~V~VBloaders that define exec_module() must also define create_module()+Create a module based on the provided spec.oFt{{O,**40 m ,=> > ~TYY'tV$ MVV ^V0V`^PZPO ^V]VO from )> (namespace) from dXQ' '  +6#6#F#FGdX%7V\\8J7K1M MdXRz4 4   dXVDKK?!< <dii]"T[[M< <VV VqVnVqU/Q POOOhUPO O not in sys.modulesmodule FExecute the spec's specified module in an existing module's namespace.S 99D D ! ;;??4  .D8#67Cc- - ,{{"22:%&6TYYGG"4$?"4$?t{{M:*4;;789;;CNN3 6KK++D1KK++F3[[__TYY/F%+CKK "/ "0 M[[__TYY/F%+CKK "/ "0 MV&5F5C E*AF5*AF22F55F?\P`V0VVVZPV_PQȌV5QQ]V8T OOXOx6VOUP]VOY  *[[__TYY 'F#CKK v|T*2  $ F v}d+3 "(F 6:.%)YY%9%9#%>q%A"vz4(0 "FO M6M; 99 #[[__TYY/F%+CKK "           M VC%C3;EAE*(E93A%E E'&E'* E65E69 FFVQ`V8TVVVimport {!r} # {!r}missing loader7.exec_module() not found; falling back to load_module()H {{t{{M2"4;;/0144C NN3 .,T2 2 d #F D#!' DII {{"22:%&6TYYGG ''/+!' DII-tyy$++F" M!  KK *    #VJ3E<A E A'E< E9E*)E9* E63E95E66E99E<< FVV_PQȌV5QYPfV`VV0V]VtV8TQ]VOOx6VOReturn a new module object, loaded by the spec's loader. The module is not added to its parent. If a module is already in sys.modules, that existing module gets clobbered. $ DII &d# ' & & +4\PYPO is_builtin$ ??8 $#Hc#++F FBuiltinImporter.find_specVV:VhdVO@fV(!P is not a built-in moduleCreate a built-in modulecreate_builtinK 99C44 4 -FG#'99. .()<)>499eL6~~1MENNH3MM1#x/C(F1CC/#e>HH>~~-=u~~=-%BT:DHD:vz222(2OV__h4OO2"6:6GG6vz222(2OV__h4OO2"6:6GG6$$$$$K&FrozenImporter._fix_up_module VVVp-RPPPK99 LL [VP8TVhdVP P`VPV VVUP P 0PPpPP .__init___SEPrelfilewsM4@ F((C u ""3'#AB<"*95H""3, (gY7F #k2HF//*3%y>#uqy )D 4y5NOO 7D#dV1TF --;Vx(PP0V/V(Psys.meta_path is empty5sys.meta_path is None, Python is likely shutting downFind a module's spec. is_reload I*+ + /?  #I  ! 5",, !tV4 "  !4T* (%H '# ' 36/"  " ! " !&  K  hQ*P;QVVBC C) C' C& C CCCC# & C65C6 `VhQ0VQȌV5Q@YPVV*P@*P*PEmpty module name6attempted relative import with no known parent package__package__ not set to a stringlevel must be >= 0module name must be str, not Verify arguments are "sane". dC 7T |DEE qy-.. qy'3'=> >() ) EQJ,--4VVV0V`/P/P.P.P0.P-P for child module Cannot set an attribute on  is not a packagechild parent_module parent_spec D __S !! $FK  $ %gv 6 3;; ;;t$ $ F+  @ ))D$,, $Q' dD !D |!_$5dX">TJJ   1 1 8 8 ? <#D)F5599;  F+  / M5& 1 M6M5 @$%dXRz9JKC%c54 ? @ 5599; //z9KE9UC NN3 . M / H>PH2P2P1PV*2 D. E E9.&EE69+F('F(V`V(QVXP0:VfVYP8TLPQȌV5Q V1Px6VX1P1P halted; None in sys.modules import of Find and load the module. [[__T> 2F.  D1?EJ  %[[__T>:F'.tW=& %'& D! ~tf$@A!'55 M& %H>P 8B==C `V XP\PXXP0:V6P6PH6Px6V2Import and return the module based on its name, the package the call is being made from, and the level adjustment. This function represents the greatest common denominator of functionality between import_module and __import__. This includes setting __package__ if the loader did not. 2$' qyT7E2 $ ,,;VYPfVWP09P must be str, not Item in ``from list''.__all__Figure out what __import__ should return. The import_ parameter is a callable which takes the name of module to import. It is required to decouple the function from assuming importlib's import implementation is desired. from_namewhere recursiveimport_!S!*4'hug.##'7#3#3"467 7 #X!; +/1#!??+1QC0I )'9=0 M' HH )KKOOI~>J H>P>P=P=PV B,, C353C.-C..C3VVV(Q0:V`V XP ``). The 'level' argument represents the package location to import from in a relative import (e.g. ``from ..pkg import mod`` would have a 'level' of 2). cut_offglobals_ zT"%17r#H-T7E2  A:t~~c2156 6M$i#dnnS&9!&<"==G;;v/LFOO0DW0LMN N  $+>> GP;VGP WPWPU`VVEPno built-in module named 3  $ $T *D |5<== $ VxqVV0VYP(JP^PQ^PSetup importlib by importing needed built-in modules and injecting them into the global namespace. As sys is needed for sys.modules access and _imp is needed to load built-in modules, those two modules must be explicitly passed in. setattr is_frozenbuiltin_module builtin_name self_module module_type D Cs)K ))+ f fk *s///(%'$VV4D tV ,'%%f-,++h'K< s{{ */ =N [[6N \>: =()L @QPQPMPVVMPMPPMPhdV`VPqUxqVMP@qVZPZPhWPLP]P]PKPKP0Install importers for builtin and frozen modules _imp_module sys_module0 :{#MM)MM(@QPQP8WP`VhQxqV@qVPP9Install importers that require external filesystem access$&4'' H(=>UUqVoQ`VRP>P{!r}No module named IVQSCore implementation of import. This module is NOT meant to be directly imported! It has been designed such that it can be bootstrapped into Python as the implementation of import. As such it requires the injection of specific modules and attributes in order to work. One should use importlib as the public-facing version of this module. _install_external_importers_setup_builtin_from_name_calc___package__ _gcd_import_NEEDS_LOADING_find_and_load_unlocked_ERR_MSG_ERR_MSG_PREFIX _sanity_check_ImportLockContext_load_load_unlocked_load_backward_compatible_exec_module_repr_from_spec_init_module_attrs_spec_from_module _module_repr_requires_frozen_requires_builtin_get_module_lock_ModuleLockManager_DummyModuleLock _ModuleLock_has_deadlocked_DeadlockError_BlockingOnManager _blocking_on _module_locks_WeakValueDictionary_List _new_module_weakref_thread _object_name,&   & D II\  **, \ (V`;`;F@@*   "J"016%$&6*a)a)H.2dJ:'T27FR"=,<"H)Z $1111h~0~0F  .*Z . % V #'T4 ->C"J6"J %*P)?:_P^PQ^PqVP`^PqU0^P]P]P]P@]PxzV]P\P\PX\P\P[P(QQ[PX[P-Q [PqV@fVZPZPfV`ZP0ZPYPYPYPxqV@qV@YPfVfVYPXPXPXXP XPWPWPhWP8WPoQVPFpUP0!K`"K#K$K0^P1K]P`5K@]PH6K]P 7KBK\PGKX\PKK\PpMKOKPK8QQK@TKPVK@WKXKeKqVHUPgKiKUPkKpKqKtKPxK0|KK KxqVK@qV0K@YPKPKKTPTPФKKPKxTPpK K@KKKзK@K`VPV}V0TP 4OS3s8q=OUcygwin^True if filenames must be checked case-insensitively and ignore environment flags are not set.ignore_environment$yy333Js{{8J J`V(gPHwQUfP5True if filenames must be checked case-insensitively.%_make_relax_case.._relax_case8hP PYTHONCASEOK PYTHONCASEOKN ||:; << " "#F G C!C K    @uQ`VxUȋVuQ vQxiPHiP0KXK*Convert a 32-bit integer to little-endian. FZ  ) )!X 66qUsQ kPP/Convert 4 bytes in little-endian to an integer.plP/Convert 2 bytes in little-endian to an integer.# t9>> >>$ ))qUsQmPnew_root( z?a a= !#"5"5zBNHd"">2h6G6G6W7?4 4(""3'==?h&7&7&99$D 6DKK%'4 D!C48=4a1)4= t9>$q'(? "hmmD))) >PHwTXnPT 0E8E PTHwQzPȋVvQPVUxQQTHqPReplacement for os.path.join().>}}*4>*4$#kk/:*4>? ?>PPP9QUxQHqP 3?aDJJqM?_path_split..UplT Replacement for os.path.split().> 3? 33A1u4x 8T!a%&\ !!pTxQsP`K~Stat the path. Made a separate function to make it easier to override in experiments (e.g. cache stat results).  88D>HwQUhuP1Test whether the path is the specified mode type. stat_info=t$     (T 11 wP  ++@QUTvPVReplacement for os.path.isfile. dH --tQxPVReplacement for os.path.isdir. zz| dH --HwQ8TtQyP@V_path_splitrootT""4(+33C>4y1}Q$//&"9"PT]]4=PQHwTHwQzPȋVPV(|P7TReplacement for os.path.isabs.//ȋVxQ(|P Replacement for os.path.abspath. removeprefixB t "C$$qY/D##**,-- `tQxQ`}PQHwQ8T}PwbBest-effort function to write data to a path atomically. Be prepared to handle a FileExistsError if concurrent writing of the temporary file is attempted.O_WRONLYO_CREATO_EXCLpath_tmp qD #H (**s{{*S\\94%< IB ZZD !T JJt " Hd#" !   JJx      hPHB/2B#B/#B,(B// C9CC CCCC HwQ8PPPRUP@kQ~P is not alphanumeric2debug_override or optimization must be set to NoneFthe debug_override parameter is deprecated; use 'optimization' insteadGiven the path to a .py file, return the path to its .pyc file. The .py file does not need to exist; this simply returns the path to the .pyc file calculated as if the .py file were imported. The 'optimization' parameter controls the presumed optimization level of the bytecode file. If 'optimization' is not None, the string representation of the argument is taken and verified to be alphanumeric (else ValueError is raised). The debug_override parameter is deprecated. If debug_override is not None, a True value is the same as setting 'optimization' to the empty string while a False value is equivalent to setting 'optimization' to '1'. If sys.implementation.cache_tag is None then NotImplementedError is raised. lstripalmost_filenamedebug_override$!01C E  #JGG$ $+r ::d DT"JD$ooc*OD#t   & &C {!"HIIgg$cBCO 99   "L99--L|$Lr##% //CDE E,-Qtf\NC!21!55H %T" 7c>d1g_<8D    KK (   dHh // ȇPP0TTTPQȌVTVHwQbUQV`VPȏPRV`PVsQpVP(tQxQQ`PHsQ 8PȃPhPxP(P is not an alphanumeric valueoptimization level 5optimization portion of filename does not start with expected only 2 or 3 dots in  not bottom-level directory in $sys.implementation.cache_tag is NonenGiven the path to a .pyc. file, return the path to its .py file. The .pyc file does not need to exist; this simply returns the path to the .py file calculated to correspond to the .pyc file. If path does not conform to PEP 3147/488 format, ValueError will be raised. If sys.implementation.cache_tag is None then NotImplementedError is raised. isalnumpycache_prefix cache_tagimplementation base_filename opt_level optimization dot_countpycache stripped_pathfound_in_pycache_prefixpycache_filename ##+!"HII ::d D(.D # %**11/B ??=83 4M*+,D&* # "#D) g h z)H $x)* * &&s+I89I8LMNN a'..sA6r: &&t,%%)H./ / T,   "2<2BC223 3$..s3A6M dMOA,>> ?? 0TPPHPPPPpP8P`VPȏPRHwQbUQPUxQȋVQHsQVPsQ`PUQpVȍPxP0PPPPPPȋPpyConvert a bytecode file path to a source path (if possible). This function exists purely for backwards-compatibility for PyImport_ExecCodeModuleWithFilenames() in the C API. extension =Q&11#6D!Y 9??$R+t3)' 6 '{3;FF  ,)#CR( )HQTؖPP AA10A1V@UdVRVQTPPW/0 $X. .   5!23 4 #    A AAPV8UpVPeVRpV3Calculate the mode permissions for a bytecode file.=$''  EMD K   ,,@QTU P@kQ cannot handle loader for R <99D YY$ !%D28<> >dD242622(_check_name.._check_name_wrapper PUV0VPțPx6VBP3(C'#w*?@Q LL   -_check_name.._wrapU@VVLPVPDecorator to verify that the module being requested matches the one the loader can handle. The first argument (self) must define _name which the second argument is compared against. If the comparison fails then ImportError is raised. _wrap_check_name_wrapper33   .  v& `  PPPȟP KKPV in invalid flags (reached EOF while reading pyc header of bad magic number in TPerform basic validity checking of a pyc header and return the flags field, which determines how the pyc should be further validated against the source. *data* is the contents of the pyc file. (Only the first 16 bytes are required, though.) *name* is the name of the module being imported. It is used for logging. *exc_details* is a dictionary passed to ImportError if it raised for improved debugging. ImportError is raised when the magic number is incorrect or when the flags field is invalid. EOFError is raised when the data is found to be truncated. magic !HE (5)<##D'2'1[11 4y2~>''(=>H33D$?O  ! !,"5"5hqk"B CCh-V PPP PRpPxRȶP=Return a module spec based on a file location. To indicate that the module is a package, set submodule_search_locations to a list of directory paths. An empty list is sufficient, though its not otherwise useful to the import system. The loader must take a spec as its only __init__() arg. _set_fileattrlocationi 6> * !..t4::h' $X.H  vh ?DD~&A&C "L(  x1%dH5$  'D "Y. 6< ( 9#..t4 68D3*D' &&", !(+A.G  + + 2 27 ; K]      8   PVVVOQHQQU4D D':D6 D$#D$' D32D36 EEV Q0VHwQbU(tQUqVpPoQPV8UVpQQVQP QPQ-Module globals; __loader__ != __spec__.loader+Module globals is missing a __spec__.loaderCHelper function for _warnings.c See GH#97850 for details. spec_loadermissing nd +hG    d 3F   j' 2D ~ 7? \JK K$'2Kwo% >$/7$:. CCD D 9    "" " f 3 ;   PVVPV VVQȌVTPPV`PHKEY_LOCAL_MACHINEHKEY_CURRENT_USEROpenKeyG B>>&":":C@ @ B>>&";";SA A B$WindowsRegistryFinder._open_registry#&-AAwQPpPU0P sys_version:VPP QueryValuehkey registry_key ??11L++L!!8.58H8H!8L.L"N ##C(D!,,T26) )  &WindowsRegistryFinder._search_registryVV:V(PP0B B6B B B B BB PHPP`V0UPwQPUUP''1    x !< = FH  x1!22839(H3M:B3D !>  WindowsRegistryFinder.find_specVV:VVHQV A11 A=<A=P@QUoQPV8U@fVP_d.pydASoftware\Python\PythonCore\{sys_version}\Modules\{fullname}\Debug;Software\Python\PythonCore\{sys_version}\Modules\{fullname}>Meta path finder for modules declared in the Windows registry._search_registry_open_registry DEBUG_BUILDREGISTRY_KEY_DEBUG REGISTRY_KEYgH  'A8/A#AKBB     PHPxwQoVP^VPX^VPV oV0PPXP(PKpKpK`VConcrete implementation of InspectLoader.is_package by checking if the path returned by get_filename has a filename of '__init__.py'.rsplit tail_name filename_base]t00:;A> Q/2 '',Q/  *FyJ/FF_LoaderBasics.is_package:VxP@PQ QPVXP*Use default semantics for module creation._LoaderBasics.create_module when get_code() returns Nonecannot load module Execute the module.S}}V__- < 3FOO3FG889 9,,T4I_LoaderBasics.exec_moduleЉV0V(QФVPPPPThis method is deprecated.++D(;;_LoaderBasics.load_module-QxPSBase class of common code needed by both SourceLoader and SourcelessFileLoader.G9J<Q ^V]VQQPPKKKLOptional method that returns the modification time (an int) for the specified path (a str). Raises OSError when the path cannot be handled.  SourceLoader.path_mtimeU8POptional method returning a metadata dict for the specified path (a str). Possible keys: - 'mtime' (mandatory) is the numeric timestamp of last source code modification; - 'size' (optional) is the size in bytes of the source code. Implementing this method allows the loader to read bytecode files. Raises OSError when the path cannot be handled. .//SourceLoader.path_statsPPPPQOptional method which writes data (bytes) to a file path (a str). Implementing this method allows for the writing of bytecode files. The source path is needed in order to correctly transfer permissions cache_path}}Z..SourceLoader._cache_bytecodePPQPOptional method which writes data (bytes) to a file path (a str). Implementing this method allows for the writing of bytecode files. SourceLoader.set_data8P'source not available through get_data()4Concrete implementation of InspectLoader.get_source.Z  * 6==.L\** 6G#+-25 6 6SourceLoader.get_source:Vh-VV/ A AA  QXQU0VeVPPx6VReturn the code object compiled from source. The 'data' argument can be any object type that compile() supports. _optimize+ 33GT459I4O OSourceLoader.source_to_code(P(Q0VxPФVPPcode object from {}HQP {} matches {}Concrete implementation of InspectLoader.get_code. Reading of bytecode requires path_stats to be implemented. To write bytecode, set_data must also be implemented. dont_write_bytecode code_object bytes_data''1      3 J-k:M. J__[1 #2g;/ (J==7D !) -#KJ -dHk J%/%5bc%: %*S[A%5 %+04<1+.>$5$0/" !34h3>!@4 $ , "6 ( + #33O]4?A0(?L=H JJ (2?    # ! M !d  ==5L)), D ##$9;G''M,E(&"&"2"23D3?#AK(k<P-k<.1,.?A $$[-F'  SourceLoader.get_code:VPQh-VdVhQ0QHQUQPPY EE D< B!D''D98D9< EE EE E('E(=H HH QPeVQqUXQQShdVHQdVeVQqQQqQ0VPQURP`VhP0qQpqQQPPQQpQ@QHPPP(Psource_to_code path_mtime, 0/ +79OS PPQQQPЉV pQLLLLPLPLLKCache the module name and the path to the file found by the finder.  FileLoader.__init__:VPFileLoader.__eq__FileLoader.__hash__dLoad a module from a file. This method is deprecated. Use exec_module() instead. Z28<<FileLoader.load_module:VSHpQQP:Return the path to the source file as found by the finder.FileLoader.get_filename'Return the data from path as raw bytes.j d\+>? @s4y)Tyy{*)D#&$yy{'&*)'&FileLoader.get_dataA?%B ?B BpQPnV`VVR PP FileReader0$FileLoader.get_resource_readerPQPpPgBase file loader class which implements the loader protocol methods that require file system usage.X" 11 = =#  0rQQ QXQpQ HpQPLLLLLLLPQ!Return the metadata for the path.  bjj99SourceFileLoader.path_statsU@QS`SXP0P source_path!+&}}]D}== SourceFileLoader._cache_bytecodePHQhrQQQ created {!r}could not create {!r}: {!r}Write bytes data to a file.part path_parts_mode&t, [0&v.LFD   d #[0Z(D-F  &!) - $e ,  ' ' =#  ++,I,2C9   -  ' '(Et(+ - - -SourceFileLoader.set_data PPPPV6&B">#C" C-C5CC D#C??D QQTQHwQXU0TUQsQPPPP>Concrete implementation of SourceLoader using the file system.set_data_cache_bytecode path_statsH: > -2-QQQnV(QLL@kQQL bytecode_pathHQ_  *}}T"  dHk2 t RS !  SourcelessFileLoader.get_code:VQ QXQQqQSQQ'Return None as there is no source code.SourcelessFileLoader.get_sourcepQ-Loader which handles sourceless file imports.7 ЉVnV@QLL  ExtensionFileLoader.__init__,%//10 / 1ExtensionFileLoader.__eq__DIIdii00ExtensionFileLoader.__hash__0OS&extension module {!r} loaded from {!r}(Create an uninitialized extension modulecreate_dynamic@55   '##$LDII / !ExtensionFileLoader.create_moduleV(QhdV QQ( Q Q(extension module {!r} executed from {!r}Initialize an extension module exec_dynamic_call_with_frames_removed6,,T->->G##$NDII /ExtensionFileLoader.exec_module(QhdV QQ QP Q#5!3v V 33!31ExtensionFileLoader.is_package..U@Q0Q1Return True if the extension module is a package. file_name0 *1- 5!355 5ExtensionFileLoader.is_package @:V0QQ(5SoVQ&L?Return None as an extension module cannot create a code object.ExtensionFileLoader.get_codeQ5Return None as extension modules have no source code.ExtensionFileLoader.get_sourceQyy ExtensionFileLoader.get_filenamexP]Loader for extension modules. The constructor is designed to work with FileFinder. C 11/ 5  ^V]VQЉV0rQ Q PnVQ L!L"L#L@%L'L(L)L`*L path_finder:  !&t'<'<'>!?;;'_NamespacePath.__init__Q/Q8U`&QQ2QHQQ`V>Returns a tuple of (parent-module-name, parent-path-attr-name)me3**//4R "9 z!!&_NamespacePath._find_parent_path_nameshTQQV0QQpath_attr_nameparent_module_name--1-I-I-K*Ns{{#56GG_NamespacePath._get_parent_pathQHQ&Q`V_name _path_finder _last_epoch_last_parent_pathD1134 $00 0DKK4CSCS4S$$TZZ=DDKK$722!%!@!@DJ%0D "#{{D zz_NamespacePath._recalculatep:VV 8U`&QQ2QHQQQVV/QD%%'((_NamespacePath.__iter__(&Q  "5))_NamespacePath.__getitem__  5_NamespacePath.__setitem__!T4$$&''_NamespacePath.__len__(&Q_NamespacePath( a00_NamespacePath.__repr__/Q"Qt((***_NamespacePath.__contains__(&Q $_NamespacePath.append/Q&Represents a namespace package's path. It uses the module name to find its parent module, and from there it looks up the parent's __path__. When this changes, the module's own path is recomputed, using path_finder. For top-level modules, the parent module's path is sys.path. _recalculate_get_parent_path_find_parent_path_namesFF("H )*!(1+ 2Q&Q`&Q(&QpQ$QP,L-L.L/L2L3L4L4L5L6L7L#D$ < NamespaceLoader.__init__QpQ/QNamespaceLoader.is_packageNamespaceLoader.get_sourcer:vDAANamespaceLoader.get_code0VФVPQNamespaceLoader.create_modulehP NamespaceLoader.exec_module&namespace module loaded with path {!r}bLoad a namespace module. This method is deprecated. Use exec_module() instead. _load_module_shim1 ##$L$(JJ 0++D(;;NamespaceLoader.load_moduleQ/Q-Q,Q,Q@/Q_pathNamespaceReader5tzz**#NamespaceLoader.get_resource_reader@/QQ@/Q/Q.Q+=B9  <+ QЉV ^V]VQpQ nV9L:L;LpL>L@L}Call the invalidate_caches() method on all path entry finders stored in sys.path_importer_caches (where implemented)._epoch|!!8!8!>!>!@ALD&~[%6++D1!45((* B "9,,.PathFinder.invalidate_caches;QBQ qU`V8Q`tQV0QpQ2QhBQBQ2Q0Q@Qsys.path_hooks is empty.Search sys.path_hooks for a finder for 'path'. ImportWarningY >> %cnn NN4m DNND Dz!#   PathFinder._path_hooksA A'&A'`V0iQQȌV5Q0V05Q4QGet the finder for the path entry from sys.path_importer_cache. If the path entry is not in the cache, find the appropriate finder and cache it. If no finder is available, store None. path_importer_cache 2: zz|  3,,T2F %    3__T*F,2C # #D )  3PathFinder._path_importer_cacheVV;Q1A ==-A10A1HwQ8TT`V8QtV(EQ7Qspec missing loader?Find the loader or namespace_path for this module/package name.portionsfinder EeS)--e4F!''&9<;;*K::#%&;<< %%h/#&((48D.QT;QV;Q VDQVVV0VqV ;Q:QTry to find a spec for 'fullname' on sys.path or 'path'. The search is based on sys.path_hooks and sys.path_importer_cache. namespace_pathr <88D}}XtV4 < [[ !<[^[h[h2i/ KPathFinder.find_specVV:VV>Q`VaQVVpQ(>QBQ  Find distributions. Return an iterable of all Distribution instances capable of loading the metadata for packages matching ``context.name`` (or all names if ``None`` indicated) along the paths in the list of directories ``context.path``. importlib.metadataMetadataPathFinder  :4!44dEfEEPathFinder.find_distributionsPUVBQhBQBQDQAQ@Q>Meta path finder for sys.path and package __path__ attributes.find_distributions_path_importer_cache _path_hooks}H//"  *8. F F ^V0Q(EQX^VDQaQVDQ HoV@DQBLDLEL`GL`ILKLPV`VC(FF+(&FileFinder.__init__..U@QVInitialize with the path to search on and a variable number of 2-tuples containing the loader and the file suffixes the loader recognizes.suffixesloadersp . FH NNC(C C!/ ts{ DI%d+DI5#&5 FileFinder.__init__ @`^QIQHQV NQHwQ8T(tQ OQUVQ`VQHQ@MLInvalidate the directory mtime. FileFinder.invalidate_caches OQPKQsmsl&h-&xfBFH HFileFinder._get_specOQ:VLQVkQpossible namespace for {} trying {}oTry to find a spec for the specified module. Returns the matching spec, or None if not found. _loaders _path_mtime full_path init_filename loader_class base_path cache_modulecachemtime tail_module is_namespace  ))#.q1  tyy8CJJL9BBE D$$ $    $D  =,,E&,,.L$$E&L 5 "499k:I(, $ *V 3 &y-@  *>>,)i[Z`aa )6 +95 $(MM FL &tyy+2FG   ' ' Y! ' Lf$- *>>,)*.88%2   ' '(CY O((48D/8kD +KQ E 8  FileFinder.find_spec:VQQPQPQpPQ8PQPQ@QOQOQXOQV#5F>(G> G  G  GGV@QHwQ8TSU OQaQuQ`VQ@UVQQNQQTaQQTVQqVV PNQNQ8QMQwinDFill the cache of potential modules and packages for this directory._relaxed_path_cache _path_cachePermissionErrornew_namelower_suffix_contentscontentsyy {{4#73::<8H||&&u-"8}D %(E ! $(NN3$7!c6"&q(89H#H%))(3 ! 5D  << " "#> ?=E'FXr X'FD $ @/"?4FG H 0(GFileFinder._fill_cache WQHWQhT@QWQT+D (D% D"!D"HwQ(U8TTVQT`VxUȋVUVQU@UuQ`VQUQUQonly directories are supported-Path hook for importlib.machinery.FileFinder.)t$!"BNNt-n- -6FileFinder.path_hook..path_hook_for_FileFinderVV`^QQT0V[QZQUA class method which returns a closure to use on sys.path_hook which will return an instance using the specified loaders and the path called on the closure. If the path called on the closure is not a directory, ImportError is raised. path_hook_for_FileFinderloader_details . ('FileFinder.path_hook`` VV`^Q^Q\QYL FileFinder(TYYM++FileFinder.__repr___QFile-based finder. Interactions with the file system are cached for performance, being refreshed when the directory the finder is handling has been modified. _fill_cache _get_spec<)"H 1fG>((", 0QaQVaQX^VhQ oV`Q0NLPLPLQL`VLZLp[LPV cpathname VVL !F 66* D  [[F  ")$9F%dH5F &tXfE ' 2DK :!<!:$<    pQXcQVV5B BBVnVnVdV(tQVVTV~V_Returns a list of file-based module loaders. Each item is a tuple (loader, suffixes). bytecode extensions9 %d&=&=&??J  .F#%66H  ))xfQ@fQPnVhdVrQnVpVnVpVeQ"JiQ)Install the path-based import components. meta_path path_hook path_hookssupported_loaders_bootstrap_moduleG+,35NN://1BCDEMM$iQhiQ HoQoQ`V0iQoVhQhQHoVhhQ@kQVVP.pywopt- __pycache__ pfPUUQwin32^Core implementation of path-based import. This module is NOT meant to be directly imported! It has been designed such that it can be bootstrapped into Python as the implementation of import. As such it requires the injection of specific modules and attributes in order to work. One should use importlib as the public-facing version of this module. _install_set_bootstrap_module_get_supported_file_loaders_NamespaceLoader_NamespacePath FileLoader SourceLoader_bless_my_loader _POPULATE_code_to_hash_pyc_code_to_timestamp_pyc_compile_bytecode_validate_timestamp_pyc _check_name _calc_mode _get_cachedextension_suffixes_OPT_PYCACHE from_bytesto_bytes _write_atomic _path_abspath _path_isabs_path_is_mode_type _pack_uint32 _relax_case_make_relax_case_CASE_INSENSITIVE_PLATFORMS%_CASE_INSENSITIVE_PLATFORMS_BYTES_KEY#_CASE_INSENSITIVE_PLATFORMS_STR_KEY_pathseps_with_colonpath_sep_tupleallwinreg_os _MS_WINDOWS,  ||w& SkOeO 4O 4444 1 '''/*)89A!A39'-#(:% E"E!F  7 * * *<? "2. .R0 ,-(( ) pq(+g5 NN<:  '6",T,,.H8II5C0C0L%@PG&  >BL8 0 9 D H C47@CL-d00f<<4 G7WhdV`VQPQxUxwQHwQwQxQvQQ8UvQpvQ vQuQuQHuQuQtQQQQQ@QtQQTQT`tQ(tQsQQxQsQeVqUsQeVHsQsQpVrQoVpVpV@pVPeVdVrQhrQ0rQQqQQqQpqQ0qQeVpQdVpQoVQpQHpQnVnVPnVpQnVoQHoVoVoQHoQoQSmQXmQ0K8mQmQ KKKKK K`KKpKKpKKKKPKlQ(QlQhlQV8lQ8QlQKKKKKKKKKK KKKkQPKK0KoVLQ LpQLHpQLnVLnV@+LPnV8LpQALnVLLHoV`\LoVp]Lp_L`LpaLkQPVpkQxQصVQnot a Zip filearchive path is emptyexpected str, not _path_split _path_statY$$0d?@ @ !8tD D << h7D (33D9JJ)h6()9EE /(.E  )44fTrTlC ;; KK8 #K 1Z( (%8$C$CD$I!d?()9EE h' (( /#D)E).  & /zipimporter.__init__UUUTU%C, D?,A D;:D;?EEVVQ@QQqV@QTUVQQtV@QQQQUȁQQUVVPQVQQkCreate a ModuleSpec for the specified module. Returns None if the module cannot be found. module_info 'tX6  "..x+V V'tX6GtW%,,z';!,,(48<>//66t< zipimporter.find_spec:V0Q0QV xQ@fVQQQQqVVQxQ8Qget_code(fullname) -> code object. Return the code object for the specified module. Raise ZipImportError if the module couldn't be imported.  $4D(#C i zipimporter.get_codeQget_data(pathname) -> string with file data. Return the data associated with 'pathname'. Raise OSError if the file wasn't found. '' h?H   t||h6 73t||h6789C & C(Iy11 &!R% % &zipimporter.get_datapQ`Q %B B! @QQȋVQQtVUXQQget_filename(fullname) -> filename string. Return the filename for the specified module or raise ZipImportError if it couldn't be imported. $4D(#C izipimporter.get_filename:VQ0QQQget_source(fullname) -> source string. Return the source code for the specified module. Raise ZipImportError if the module couldn't be found, return None if the archive does contain the module, but has no source for it. dH - : #5h\!BR Rh/ *55dMJHs|H  H-Iy188::  zipimporter.get_source:VQQ`Q A== B B  xQQQqVQQtVXQQQQx6VQVis_package(fullname) -> bool. Return True if the module specified by fullname is a package. Raise ZipImportError if the module couldn't be found. mi/ dH - : #5h\!BR R zipimporter.is_package:VQxQQQQx6Vimport {} # loaded from Zip {} not found in sys.modulesLoaded module rzipimport.zipimporter.load_module() is deprecated and slated for removal in Python 3.12; use exec_module() instead@load_module(fullname) -> module. Load the module specified by 'fullname'. 'fullname' must be the fully qualified (dotted) module name. It returns the imported module, or raises ZipImportError if it could not be imported. Deprecated since Python 3.10. Use exec_module() instead. BCs./#3D(#C ikkooh' ;jl;x(C$'CKK ! (h7.99$,,M (z 3/#/  . .s||Xw O s|| $  V++h'C ##$DhPWX   H%  Vxl:STU U Vzipimporter.load_module :VQ0QQBD5 E 5E  E%QȌVTQ`VQQqVQQVФVtV0VQ`QQQ@QQ@Q5Return the ResourceReader for a module in a zip file.importlib.readers ZipReader/x((zipimporter.get_resource_reader:V@QQ@QQQ)Reload the file data of the archive path.T )$,,7DK15  .  $ $T\\4 8DK zipimporter.invalidate_caches7:0A-,A-@QQQQQ8TQ"> zipimporter object Create a new zipimporter instance. 'archivepath' must be a path to a zipfile, or to a specific path inside a zipfile. For example, it can be '/tmp/myimport.zip', or '/tmp/myimport.zip/mydirectory', if mydirectory is a valid directory inside the archive. 'ZipImportError is raised if 'archivepath' doesn't point to a valid Zip archive. The 'archive' attribute of zipimporter objects contains the name of the zipfile targeted. invalidate_cachesget_resource_reader load_module is_package get_filenameget_dataA "%$P62* ;4 (V)OVЉVXQ QQQpQ0QhQQhL0lLnLoLqLrLsLtLxL`yL{LPV.pyc! ;;,,S1!4 44:VUVdirpathXoG dkk !!hQQQ? D( +D)9% I&= t{{ " *: :V@QQQQQ(QQ!zipimport: found {} names in {!r}bad local header offset: PK&bad central directory size or offset: bad central directory offset: bad central directory size: corrupt Zip file: not a Zip file: can't open Zip file: _path_join comment_size arc_offset header_offsetmax_comment_startheader_position start_offsetP ]]7 # wwy n " X--q1"$'')!566{22$'?%A!7GG-.779Djj!347(+;G;)G.577c#&:":;v;"66(+=g[)I.577"+c$i"7#"=(27K*6"R=9M,$'CG;%OV]^^.$'Eg[%QX_`` { *O(=8JA~$'Mg[%Y`ghhEE X(v;?"#@AA"1:.v;"$"#@AA&va|4)&B-8%fRm4%fRm4$VBr]3*6"R=9 *6"R=9 *6"R=9 +F2bM: -fRm< ,VBr]; '*4|C .(+DWK)PW^__z) \779-Dt9 )(+@ )LSZ[[\277;#:;< i@WW,/DWK-PW^__X 5=;;=DL#{{73||C2*55gtD8Y ;dTWXd  m d GGL !g h CUGT Lq P4WK@wOOP X$'>{KL GGL !g  QSQQQQQhQ0QUxQ QQQ@QhQ0QQоQO&S; *$ 9 " k nT!BZ8,G"42;/;>++,XL9; ==bc #D dJ '*8,6KLMM KpQQ:VQhQ0Qh-VdVQQqVQhdVHQHQdVeVQQ QQQPQQxQV QpQ@QQQQ ' ^^GU +F ^^E5 )F M(Qpathname $V ,F 68V$ ??pQ8Q0VФVPQmktimeY ;; a4 a3 D R a4 TQ B  QQ Quncompressed_sizedate~ BCyJ&&&CRyKK% ||%aLdD)+<<< j) ,`Q QQQ9<AAQQtVSVQxQ[ 9 "" " 9D2KK% y11 `Q5 AAQXQQtVQcan't find module module load failed: O trying {}{}{}_filesarchive_verbose_messagemodpath toc_entryfullpath ispackage isbytecodesuffix import_error" D( +DL)9% I&=##OT\\8Xabc , H-I lGT\\95DD'*4(HdSD'w5|lGG+ +/*:2 (7C 84, F #5h\!BR R#'#&L'   :VpQ@QQQQ`Q0QV* C"9C  CCC" C.-C. Q(QQQQQXQQ0VQtVQXQ8QQx6VQa8  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %V8Q __init__.py __init__.pycPKQQPzipimport provides support for importing Python modules from Zip archives. This module exports three objects: - zipimporter: a class; its constructor takes a path to a Zip archive. - ZipImportError: exception raised by zipimporter objects. It's a subclass of ImportError, so it can be caught as ImportError, too. - _zip_directory_cache: a dict, mapping archive paths to zip directory info dicts, as used in zipimporter._files. It is usually not needed to use the zipimport module explicitly; it is used by the builtin import mechanism for sys.path items that are paths to Zip archives. _get_module_code_get_pyc_source_get_mtime_and_size_of_source_parse_dostime_compile_source_normalize_line_endings _code_type__code___unmarshal_code _eq_mtime _get_data_get_decompress_func_importing_zlib cp437_table_read_directory_get_module_info_is_dir_get_module_path_zip_searchorder zipimporter _LoaderBasicsMAX_COMMENT_LENSTRING_END_ARCHIVEEND_CENTRAL_DIR_SIZE _module_type_zip_directory_cacheZipImportError alt_path_seppath_separatorspath_sep _warningstimemarshal_unpack_uint32_unpack_uint163  9E&   ] +  ' '"22126  [ Cy "dO%33dOZd+ ud+ 5">{J/ : *(%\&P/** + @  & 2 S.UqVQQUhdVPQ`V QQQxQ@Q0VQQQPQQQQhQ(QQQxQ@QQQQXQ QQQxQ8QQQQHQQ!Q`QQhQgL(QQ|LQQhQ(Q0}L@~L0L`LQ0LLLLLLLL`LLIA decorator indicating abstract methods. Requires that the metaclass is ABCMeta or derived from it. A class that has a metaclass derived from ABCMeta cannot be instantiated unless all of its abstract methods are overridden. The abstract methods can be called using any of the normal 'super' call mechanisms. abstractmethod() may be used to declare abstract methods for properties and descriptors. Usage: class C(metaclass=ABCMeta): @abstractmethod def my_abstract_method(self, arg1, arg2, argN): ... funcobj"$(G NQPQcallableabstractclassmethod.__init__A decorator indicating abstract classmethods. Deprecated, use 'classmethod' with 'abstractmethod' instead: class C(ABC): @classmethod @abstractmethod def my_abstract_classmethod(cls, ...): ... xRPQL(,% "abstractstaticmethod.__init__QSA decorator indicating abstract staticmethods. Deprecated, use 'staticmethod' with 'abstractmethod' instead: class C(ABC): @staticmethod @abstractmethod def my_abstract_staticmethod(...): ...   ##8RQLA decorator indicating abstract properties. Deprecated, use 'property' with 'abstractmethod' instead: class C(ABC): @property @abstractmethod def my_abstract_property(self): ...   RQmcls('/$eYI&IC cNJABCMeta.__new__QSSPUVVVSR{Register a virtual subclass of an ABC. Returns the subclass, to allow usage as a class decorator. subclass !h/ /ABCMeta.registerPRHQ'Override for isinstance(instance, cls).ABCMeta.__instancecheck__VVHSRQ'Override for issubclass(subclass, cls).%c84 4ABCMeta.__subclasscheck__R8Q_abc_negative_cache_version: _abc_negative_cache: _abc_cache: _abc_registry: Inv. counter: Class: 'Debug helper to print the ABC registry._abc_negative_cache_version_abc_negative_cache _abc_cache _abc_registry GCNN+1S-=-=,>?d K N?#4"56T B,5cN *]J(; ( OM#45D A L/d ; )*=)@A M 12M1PQ ABCMeta._dump_registryVVQQ`QQVRR QQXV`Q(QQQhQ.Clear the registry (for debugging or testing). C ABCMeta._abc_registry_clear`R0R,Clear the caches (for debugging or testing). # ABCMeta._abc_caches_clearVV(RhRMetaclass for defining Abstract Base Classes (ABCs). Use this metaclass to create an ABC. An ABC can be subclassed directly, and then acts as a mix-in class. You can also register unrelated concrete classes (even built-in classes) and unrelated ABCs as 'virtual subclasses' -- these and their descendants will be considered subclasses of the registering ABC by the built-in issubclass() function, but the registering ABC won't show up in their MRO (Method Resolution Order) nor will method implementations defined by the registering ABC be callable (not even via super()). _abc_caches_clear_abc_registry_clear_dump_registry+    0 5 5  !  URRR SR`LpLPL0LLLLPVRecalculate the set of abstract methods of an abstract class. If a class has had one of its abstract methods implemented after the class was created, the method will not be considered implemented until this function is called. Alternatively, if a new abstract method has been added to the class, it will only be considered an abstract method of the class after this function is called. This function should be called before any use is made of the class, usually in class decorators that add methods to the subject class. Returns cls, to allow usage as a class decorator. If cls is not an instance of ABCMeta, does nothing. scls abstracts 3- . I D"7AA.-A.BUX^VxR^V8R@IVR(gVRRPRRRR`R(RS0VRRbUXRLLxRL8RLRRLSRrUЭLLbUSregister_errore}}S66<"NO   "4"4((  (%6D " CodecInfo.__new__ VVRRRR 8URRRR%<%s.%s object for encoding %s at %#x>:6**DNN,G,GBtH&& &CodecInfo.__repr__xR0Codec details when looking up the codec registry%:EI?C ! &`R(RRLLV# Encodes the object input and returns a tuple (output object, length consumed). errors defines the error handling to apply. It defaults to 'strict' handling. The method may not store state in the Codec instance. Use StreamWriter for codecs which have to keep state in order to make encoding efficient. The encoder must be able to handle zero length input and return an empty object of the output object type in this situation. NotImplementedError ""! Codec.encodeR Decodes the object input and returns a tuple (output object, length consumed). input must be an object which provides the bf_getreadbuf buffer slot. Python strings, buffer objects and memory mapped files are examples of objects providing this slot. errors defines the error handling to apply. It defaults to 'strict' handling. The method may not store state in the Codec instance. Use StreamReader for codecs which have to keep state in order to make decoding efficient. The decoder must be able to handle zero length input and return an empty object of the output object type in this situation. *"! Codec.decodeR9 Defines the interface for stateless encoders/decoders. The .encode()/.decode() methods may use different error handling schemes by providing the errors argument. These string values are predefined: 'strict' - raise a ValueError error (or a subclass) 'ignore' - ignore the character and continue with the next 'replace' - replace with a suitable replacement character; Python will use the official U+FFFD REPLACEMENT CHARACTER for the builtin Unicode codecs on decoding and '?' on encoding. 'surrogateescape' - replace with private code points U+DCnn. 'xmlcharrefreplace' - Replace with the appropriate XML character reference (only for encoding). 'backslashreplace' - Replace with backslashed escape sequences. 'namereplace' - Replace with \N{...} escape sequences (only for encoding). The set of allowed values can be extended via register_error. ,"&"0R"RPL LКT Creates an IncrementalEncoder instance. The IncrementalEncoder may use different error handling schemes by providing the errors keyword argument. See the module docstring for a list of possible values.   IncrementalEncoder.__init__'RA Encodes input and returns the resulting object. IncrementalEncoder.encode)R: Resets the encoder to the initial state. IncrementalEncoder.reset*R: Return the current state of the encoder. IncrementalEncoder.getstate+Rl Set the current state of the encoder. state must have been returned by getstate(). stateIncrementalEncoder.setstate,R An IncrementalEncoder encodes an input in multiple steps. The input can be passed piece by piece to the encode() method. The IncrementalEncoder remembers the state of the encoding process between calls to encode().  "    R .RиLLLHLLКT0GR##D&1 #BufferedIncrementalEncoder.__init__R)BufferedIncrementalEncoder._buffer_encode!BufferedIncrementalEncoder.encode05R  & BufferedIncrementalEncoder.resetR{{a#BufferedIncrementalEncoder.getstate kr #BufferedIncrementalEncoder.setstate This subclass of IncrementalEncoder can be used as the baseclass for an incremental encoder if the encoder must keep some of the output in a buffer between calls to encode(). _buffer_encode%  "  " 05R R@4RLLLLLLКT0GR Create an IncrementalDecoder instance. The IncrementalDecoder may use different error handling schemes by providing the errors keyword argument. See the module docstring for a list of possible values.  IncrementalDecoder.__init__6R@ Decode input and returns the resulting object. "!IncrementalDecoder.decode8R9 Reset the decoder to the initial state. IncrementalDecoder.reset:R  Return the current state of the decoder. This must be a (buffered_input, additional_state_info) tuple. buffered_input must be a bytes object containing bytes that were passed to decode() that have not yet been converted. additional_state_info must be a non-negative integer representing the state of the decoder WITHOUT yet having processed the contents of buffered_input. In the initial state and after reset(), getstate() must return (b"", 0). IncrementalDecoder.getstate(;R;R Set the current state of the decoder. state must have been returned by getstate(). The effect of setstate((b"", 0)) must be equivalent to reset(). IncrementalDecoder.setstate>R An IncrementalDecoder decodes an input in multiple steps. The input can be passed piece by piece to the decode() method. The IncrementalDecoder remembers the state of the decoding process between calls to decode().  "   hR?RLLhL0LLКT0GR##D&1 #BufferedIncrementalDecoder.__init__hR)BufferedIncrementalDecoder._buffer_decode?{{U"!00t{{EJ89o  !BufferedIncrementalDecoder.decodeaRNR(HR  & BufferedIncrementalDecoder.resethR Q#BufferedIncrementalDecoder.getstate Ah #BufferedIncrementalDecoder.setstatep-R This subclass of IncrementalDecoder can be used as the baseclass for an incremental decoder if the decoder must be able to handle incomplete byte sequences. _buffer_decode%  "   (HR RPGRLLLLLLКT0GRw Creates a StreamWriter instance. stream must be a file-like object open for writing. The StreamWriter may use different error handling schemes by providing the errors keyword argument. These parameters are predefined: 'strict' - raise a ValueError (or a subclass) 'ignore' - ignore the character and continue with the next 'replace'- replace with a suitable replacement character 'xmlcharrefreplace' - Replace with the appropriate XML character reference. 'backslashreplace' - Replace with backslashed escape sequences. 'namereplace' - Replace with \N{...} escape sequences. The set of allowed parameter values can be extended via register_error. ,  StreamWriter.__init__2UIR> Writes the object's contents encoded to self.stream. consumed.VT[[9h $StreamWriter.writeNR2U(NR[ Writes the concatenated list of strings to the stream using .write().  2774=!StreamWriter.writelines(PR2 Resets the codec buffers used for keeping internal state. Calling this method should ensure that the data on the output is put into a clean state, that allows appending of new fresh data without having to rescan the whole stream to recover state.  StreamWriter.resetQRwhence3 ( Q;6Q; JJL';StreamWriter.seek? Inherit all other methods from the underlying stream. StreamWriter.__getattr__StreamWriter.__enter__StreamWriter.__exit__can't serialize %sStreamWriter.__reduce_ex__52 "   $*H ؝R RLpLLLLLLpLpLКTR Creates a StreamReader instance. stream must be a file-like object open for reading. The StreamReader may use different error handling schemes by providing the errors keyword argument. These parameters are predefined: 'strict' - raise a ValueError (or a subclass) 'ignore' - ignore the character and continue with the next 'replace'- replace with a suitable replacement character 'backslashreplace' - Replace with backslashed escape sequences; The set of allowed parameter values can be extended via register_error. >$  !%!4!4!600StreamReader.__init__2U2UxqR@wR8qRqRpRWR!!StreamReader.decode Decodes data from the stream self.stream and returns the resulting object. chars indicates the number of decoded code points or bytes to return. read() will never return more data than requested, but it might return less, if there is not enough available. size indicates the approximate maximum number of decoded bytes or code points to read for decoding. The decoder can modify this setting as appropriate. The default value -1 indicates to read and decode as much as possible. size is intended to prevent having to decode huge files in one step. If firstline is true, and a UnicodeDecodeError happens after the first line terminator in the input only the first line will be returned, the rest of the input will be kept until the next call to read(). The method should use a greedy read strategy, meaning that it should read as much data as is allowed within the definition of the encoding and the given size, e.g. if optional encoding endings or state markers are available on the stream, these should be read too. result decodedbytesnewcharsnewdata8 ??"4499$//JDO"DO 19Ezt'50ax++**,++**40??W,D )-T4;;)G&,#<=1DO OOx 'O?@ 19__F"44DO  __Ve,F"ooef5DO 1&  D#))$4dkkB+Hl$///>E5z1}%  StreamReader.read `fR(fRHbRbRaRVhhRaR2D== F AFF  pR8qRqR2UxqRUU\RR firstlinechars@`fR(fR Read one line from the input stream and return the decoded data. size, if given, is passed as size argument to the read() method. line0withoutend line0withendlinesreadsize; ????1%D"4??#q(#'//!"4"&6q9K:2%%99X96DtS)dmmD.AtU+ e0DDII1AI66D DLDOOTO2Eu:>!8Da5zA~b T__4 */*.+0(T__*D##>qA& % %Qx "'("5"5u"5"Ea"H?2&*&<&<&A&A%)&L&*oo'6DO+  / 4+??E?:1=D $A ]StreamReader.readline hRhhR0hRgR pRqRU8qRVPVgRRfRfRfRS Read all lines available on the input stream and return them as a list. Line breaks are implemented using the codec's decoder method and are included in the list entries. sizehint, if given, is ignored since there is no efficient way to finding the true end-of-line. yy{x((StreamReader.readlinesUmR Resets the codec buffers used for keeping internal state. Note that no stream repositioning should take place. This method is primarily intended to be able to recover from decoding errors. linebuffer charbuffer_empty_charbuffer bytebuffer00StreamReader.resetxqR8qRqRpRoRp Set the input stream's current position. Resets the codec buffers used for keeping state. ! ( StreamReader.seek2UrR4 Return the next decoded line from the input stream.}} KStreamReader.__next__TStreamReader.__iter__StreamReader.__getattr__StreamReader.__enter__StreamReader.__exit__StreamReader.__reduce_ex__charbuffertypeRN2"N`IV ) $*HV@wRRRLLLLLLLLLLL`L`LКTwR8RRR Creates a StreamReaderWriter instance. stream must be a Stream-like object. Reader, Writer must be factory functions or classes providing the StreamReader, StreamWriter interface resp. Error handling is done in the same way as defined for the StreamWriter/Readers. . VV, VV,  StreamReaderWriter.__init__2URȊR2U(RRxyR{{%%StreamReaderWriter.read(R{{##D))StreamReaderWriter.readline(R{{$$X..StreamReaderWriter.readlines(RRDKK  StreamReaderWriter.__next__(RStreamReaderWriter.__iter__{{  &&StreamReaderWriter.writeR{{%%d++StreamReaderWriter.writelinesqUR؝RStreamReaderWriter.resetJ (  Q;6Q; KK   ';StreamReaderWriter.seek2U(RRStreamReaderWriter.__getattr__StreamReaderWriter.__enter__StreamReaderWriter.__exit__ StreamReaderWriter.__reduce_ex__ StreamReaderWriter instances allow wrapping streams which work in both read and write modes. The design is such that one can use the factory functions returned by the codec.lookup() function to construct the instance. ZH$&*/! ',  $*HR؝RpRXR8RLLLLLLLLLL0LLLLКT8SPVR Creates a StreamRecoder instance which implements a two-way conversion: encode and decode work on the frontend (the data visible to .read() and .write()) while Reader and Writer work on the backend (the data in stream). You can use these objects to do transparent transcodings from e.g. latin-1 to utf-8 and back. stream must be a file-like object. encode and decode must adhere to the Codec interface; Reader and Writer must be factory functions or classes providing the StreamReader and StreamWriter interfaces resp. Error handling is done in the same way as defined for the StreamWriter/Readers. WriterReader<*   VV, VV,  StreamRecoder.__init__2URȊR2U(RRR4{{%![[t{{;l StreamRecoder.read(RK <;;'')D;;''-D![[t{{;l StreamRecoder.readlineR(R>{{!![[t{{;l--StreamRecoder.readlinesR(RUR bytesencoded0DKK ![[t{{;l StreamRecoder.__next__R(R`tRStreamRecoder.__iter__0![[t{{;l{{  &&StreamRecoder.writepRR bytesdecoded=xx~![[t{{;l{{  &&StreamRecoder.writelinesqUpRR"  StreamRecoder.reset(RRwriterreader, ( (StreamRecoder.seekSR(RR t{{D))StreamRecoder.__getattr__2UxTRStreamRecoder.__enter__ StreamRecoder.__exit__R2U,t~~/F/FFGGStreamRecoder.__reduce_ex__VURunknownB StreamRecoder instances translate data from one encoding to another. They use the complete set of APIs returned by the codecs.lookup() function to implement their task. Data written to the StreamRecoder is first decoded into an intermediate format (depending on the "decode" codec) and then written to the underlying stream using an instance of the provided Writer class. In the other direction, data is read from the underlying stream using a Reader instance and then encoded and returned to the caller. writelines readlinesd MM!8 . ' '  )$*HpR8RR؝R8RhR8R0LpMM0MMMMM0 M` M M MP MPMКT8SPVR Open an encoded file using the given mode and return a wrapped version providing transparent encoding/decoding. Note: The wrapped version will only accept the object format defined by the codecs, i.e. Unicode objects for most builtin codecs. Output is also codec dependent and will usually be Unicode as well. If encoding is not None, then the underlying encoded files are always opened in binary mode. The default file mode is 'r', meaning to open the file in read mode. encoding specifies the encoding which is to be used for the file. errors may be given to define the error handling. It defaults to 'strict' which causes ValueErrors to be raised in case an encoding error occurs. buffering has the same meaning as for the builtin open() API. It defaults to -1 which means that the default buffer size will be used. The returned wrapped file object provides an extra attribute .encoding which allows querying the used encoding. This attribute is only available if an encoding was specified as parameter. srwinfo> $cz ==4 3D h t'8'8$:K:KVT    xRHR 5AA1зRpRRRR Return a wrapped version of file which provides transparent encoding translation. Data written to the wrapped file is decoded according to the given data_encoding and then encoded to the underlying file using file_encoding. The intermediate data type will usually be Unicode but depends on the specified codecs. Bytes read from the file are decoded using file_encoding and then passed back to the caller encoded using data_encoding. If file_encoding is not given, it defaults to data_encoding. errors may be given to define the error handling. It defaults to 'strict' which causes ValueErrors to be raised in case an encoding error occurs. The returned wrapped file object provides two extra attributes .data_encoding and .file_encoding which reflect the given parameters of the same name. The attributes can be used for introspection by Python programs. sr file_info data_info file_encoding data_encodingj2% }%I}%I tY--y/?/? --y/E/Ev OB%B$B IpR8RRȫRRзR8RRRpR8RR Lookup up the codec for the given encoding and return its encoder function. Raises a LookupError in case the encoding cannot be found. зR8R Lookup up the codec for the given encoding and return its decoder function. Raises a LookupError in case the encoding cannot be found.  (  " ""зRhR Lookup up the codec for the given encoding and return its IncrementalEncoder class or factory function. Raises a LookupError in case the encoding cannot be found or the codecs doesn't provide an incremental encoder. incrementalencoderRзRRRаR Lookup up the codec for the given encoding and return its IncrementalDecoder class or factory function. Raises a LookupError in case the encoding cannot be found or the codecs doesn't provide an incremental decoder. incrementaldecoder)X11G(## NзRRRزR Lookup up the codec for the given encoding and return its StreamReader class or factory function. Raises a LookupError in case the encoding cannot be found. streamreaderзRR8R Lookup up the codec for the given encoding and return its StreamWriter class or factory function. Raises a LookupError in case the encoding cannot be found. streamwriterlookup (  ( ((зRRR Encoding iterator. Encodes the input strings from the iterator using an IncrementalEncoder. errors and kwargs are passed through to the IncrementalEncoder constructor. encoder^.#H-f??G& L^^B %F  8RPUVRRPRR Decoding iterator. Decodes the input strings from the iterator using an IncrementalDecoder. errors and kwargs are passed through to the IncrementalDecoder constructor. outputiterator^.#H-f??G& L^^C &F  8RPUVR +A AR R make_identity_dict(rng) -> dict Return a dictionary where elements of the rng sequence are mapped to themselves. rng  AAaC  R R Creates an encoding map from a decoding map. If a target mapping in the decoding map occurs multiple times, then that target is mapped to None (undefined mapping), causing an exception when encountered by the charmap codec during translation. One example where this happens is cp875.py which decodes multiple character to \u001a. decoding_map@ A!!#!AvAaDAaD $ HxRȿR namereplacebackslashreplacexmlcharrefreplace,UзRRRR(RR@RRRXRRRRxRPRR`R0RRhRRRpR8RRRPRRRRhR0R@RRRRHRRRxR%Failed to load the builtin codecs: %s codecs -- Python Codec Registry, API and helpers. Written by Marc-Andre Lemburg (mal@lemburg.com). (c) Copyright CNRI, All Rights Reserved. NO WARRANTY. encodings_false LookupErrornamereplace_errorsbackslashreplace_errorsxmlcharrefreplace_errorsreplace_errors ignore_errors strict_errors lookup_errormake_encoding_mapmake_identity_dict iterdecode iterencode getwriter getreadergetincrementaldecodergetincrementalencoder getdecoder getencoder EncodedFile StreamRecoderStreamReaderWriter StreamReader StreamWriterBufferedIncrementalDecoderIncrementalDecoderBufferedIncrementalEncoderIncrementalEncoderCodec CodecInfoBOM64_BEBOM64_LEBOM32_BEBOM32_LE BOM_UTF32 BOM_UTF16BOM BOM_UTF32_BE BOM_UTF32_LE BOM_UTF16_BEBOM_BE BOM_UTF16_LEBOM_LEBOM_UTF8 SystemErrorwhy_codecs E -0 $#$## # ==H#"C)I #"C)I     &&>@"@"D& & P "!3 "D/ / b"!3"VHH5HHXxH5xHxVHVHtsHsHn/b"L##  ))$( . *M *M!),N+,?@*+=>%m4   o"E =C DDEV"MMN#")D0D-D* D%%D*-EE9`VR0VRRXR(RRRRPRRRRxR@RRRR8U`R0RRRhR RRRpR8RRRRPRRRRhR0RRRxR@RRRRHRRRRhR5R@VPRRRxRPR(RR`L`RL0RLRLRLhRL RLRpLRLpR`M8RMPMMMMMMMM MMpMRRHRRRКTkk!!GHRRnn$$GRR!!))GpR8Roo%%GRRRxR8R`VRRRhR0RRRxR 9UxR`VRRRRR8RhR0RRRR8RlUlUlUR 9UxRGuido van Rossum , Mike Verdone , Mark Russell , Antoine Pitrou , Amaury Forgeot d'Arc , Benjamin Peterson The io module provides the Python interfaces to stream handling. The builtin open function is defined in this module. At the top of the I/O hierarchy is the abstract base class IOBase. It defines the basic interface to a stream. Note, however, that there is no separation between reading and writing to streams; implementations are allowed to raise an OSError if they do not support a given operation. Extending IOBase is RawIOBase which deals simply with the reading and writing of raw bytes to a stream. FileIO subclasses RawIOBase to provide an interface to OS files. BufferedIOBase deals with buffering on a raw byte stream (RawIOBase). Its subclasses, BufferedWriter, BufferedReader, and BufferedRWPair buffer streams that are readable, writable, and both respectively. BufferedRandom provides a buffered interface to random access streams. BytesIO is a simple stream of in-memory bytes. Another IOBase subclass, TextIOBase, deals with the encoding and decoding of streams into text. TextIOWrapper, which extends it, is a buffered text interface to a buffered raw stream (`BufferedIOBase`). Finally, StringIO is an in-memory stream for text. Argument names are not part of the specification, and only the arguments of open() are intended to be used as keyword arguments. data: DEFAULT_BUFFER_SIZE An int containing the default buffer size used by the module's buffered I/O classes. open() uses the file's blksize (as obtained by os.stat) if possible. klass TextIOBase _TextIOBaseBufferedIOBase_BufferedIOBase RawIOBase _RawIOBaseIOBase_IOBaseIncrementalNewlineDecoderBufferedRandomBufferedRWPairBufferedWriterBufferedReaderStringIOBytesIOFileIOUnsupportedOperationBlockingIOErrorDEFAULT_BUFFER_SIZE __author__/!H8  P JJJJJ#'    "S[[CKK"%%*S((&*&&& 6~~~EE" &E' *%()  -DD  D %RrURxR8R`VRRRhR0RRRxR 9UlUlUlUHRSRRRpR8RRRUR0VRRR(RV!MRS"MR#M8R$MRR$54__mro__methodsP ))CA#::f%-))  " ! RR@UHashable.__hash__Hashable.__subclasshook__S(rU@UBUX^VSh-M0.M  Awaitable.__await__ ) !![1 1Awaitable.__subclasshook__xS(rU@U:I $L1 BUX^VqUxS 0M1McSend a value into the coroutine. Return next yielded value or raise StopIteration. Coroutine.sendRgRaise an exception in the coroutine. Return next yielded value or raise StopIteration. with_tracebacktbvaltypCoroutine.throwRcoroutine ignored GeneratorExitCoroutine.close`SR# ) !![&'7K KCoroutine.__subclasshook__@S(rU@UGI   B BUX^V@S3M3M4M6M`V AsyncIterable.__aiter__дS - !![1 1AsyncIterable.__subclasshook__S(rU@U:I $L1 BUX^VqUS 8M9M@Return the next item or raise StopAsyncIteration when exhausted.! AsyncIterator.__anext__RAsyncIterator.__aiter__ - !![+> >AsyncIterator.__subclasshook__дS(rU@U2I!! BUX^VдS;M;M$$R(C AsyncGenerator.athrow#%hS,asynchronous generator ignored GeneratorExit.Raise GeneratorExit inside coroutine. StopAsyncIteration GeneratorExitH O++m, , ,MN N -12   AsyncGenerator.aclose/A.,. A.AAAA SSxzVS`SS* . !![+")8X? ?AsyncGenerator.__subclasshook__S(rU@UP S SSacloseathrowasendNI& !!   O BUP S SSX^V S>M?M@MAMBM`VIterable.__iter__Iterable.__subclasshook__`S(rU@U:I $L1 BUX^VqU`SDMEMKReturn the next item from the iterator. When exhausted, raise StopIteration Iterator.__next__ S Iterator.__iter__ (?!!Z< <Iterator.__subclasshook__(S(rU@U2I BUX^V(SGMHM`IM Reversible.__reversed__ * !!^Z@ @Reversible.__subclasshook__S(rU@U-IBUX^VSXKM0LM^Return the next item from the generator. When exhausted, raise StopIteration. yyGenerator.__next__xScSend a value into the generator. Return next yielded value or raise StopIteration. Generator.sendTSgRaise an exception in the generator. Return next yielded value or raise StopIteration. 4 ;z %C >$$R(C Generator.throwRRR`R8Sgenerator ignored GeneratorExit.Raise GeneratorExit inside generator. ; B JJ} %@A A}-   Generator.close "44SxzVTPSS* ) !!Z"('7< <Generator.__subclasshook__S(rU@UNI    B BUX^V S NMOMOMPM RM`V Sized.__len__ %<!!Y/ /Sized.__subclasshook__S(rU@U-IBUX^VS0TMUMContainer.__contains__ ) !!^4 4Container.__subclasshook__PS(rU@U:I $L1 BUX^VqUPSVMWM! * !!i^L LCollection.__subclasshook__S(rU@UIX^VSYM!!Buffer.__buffer__ &=!!\2 2Buffer.__subclasshook__S(rU@U;I"":"" BUqUSX^VS[Mp\MFExpected a list of types, an ellipsis, ParamSpec, or Concatenate. Got 6Callable must be used as Callable[[arg, ...], result].4'CINHJ J fudm ,&V&X&D'>>DXGH HwsFD11_CallableGenericAlias.__new__VVp-S-S8UVqUpSS&S&S], collections.abc.Callable[[ t}}  "~dmmA6F'G7#% %YYt}}Sb7IJ7I! 1 7IJKLCdmmB/014 5J_CallableGenericAlias.__repr__B pSS8S)ST`)SI}}D Q>$q'#:Sb ?DH,D$x&666 _CallableGenericAlias.__reduce__pSqUSSt_argst_resultnew_argsn $&7D7&t,55(1+t}5|Hcr]F)H$XuX??!_CallableGenericAlias.__getitem__ -S-Sp-S8USqUSS Represent `Callable[argtypes, resulttype]`. This sets ``__args__`` to a tuple containing the flattened ``argtypes`` followed by ``resulttype``. Example: ``Callable[[int, str], float]`` sets ``__args__`` to ``(int, str, float)``. *I 257 @@ S0Sp^M `MbMpcM_ConcatenateGenericAlias ParamSpec-Uutclld.Bu!_is_param_expr..Utyping2Sh2S|Checks if obj matches either a list of types, ``...``, ``ParamSpec`` or ``_ConcatenateGenericAlias`` from typing.py anyI h#t s)C 5E >>X % U#-Uu-U*UUXU7SqU(5S4SX4S4SfM...Return the repr() of an object, special-casing types (internal helper). Copied from :mod:`typing` since collections.abc shouldn't depend on that module. (Keep this roughly in sync with the typing version.) Ellipsisk#t >>Z '## #..!3#3#3"455 h#|$|| 97SSp/V6S6SCallable.__call__S (?!!Z0 0Callable.__subclasshook__VVS(rU@U;I $$9: BUX^VSS jMjMelem?%%! ! t9s5z !D5  Set.__le__ Set.__lt__3%%! !4y3u:%<$++e*<< Set.__gt__бS@U?%%! ! t9s5z !D4 Set.__ge__U. *%*! !"""Me"MMM Set.__and__@tM1Return True if two sets have a null intersection.E}Set.isdisjointUCS5Mq1a1MSet.__or__..Uchain1%*! !5T5M5""5)) Set.__or__U0FS`S@U(sS@wM#:dU&+5&8$)dSet.__sub__..UUL%%eX.%%''.E""#:d#:: : Set.__sub__`yM#9eU&+4&7$)eSet.__rsub__..UL%%eX.%%''.E""#9e#99 9 Set.__rsub__{M?%%eX.%%''.Eu .. Set.__xor__бS`S@U(sS8#6 4?M[M2+Compute the hash value of a set. Note that we don't define __hash__: not all sets are hashable. But if you define a hashable set type, its __hash__ should call this function. This must be compatible __eq__. All sets ought to compare equal if they contain the same elements, regardless of how they are implemented, and regardless of the order of the elements; so there's not much freedom for __eq__ or __hash__. We match the algorithm used by the built-in frozenset type. hashmaxsizehxMASKMAXkk3w{ I !a%  T AaB "b/H,; ;A IA a2g!r' "" I ! T  s7 MA 7A Set._hashOSOSOS`V`OS0OS LSLSLSxLSXLS8LSLSZA set is a finite, iterable container. This class provides concrete generic implementations of all methods except for __contains__, __iter__ and __len__. To override the comparisons (presumably for speed, as the semantics are fixed), redefine __le__ and __ge__, then the other operations will automatically follow suit. _hash isdisjointtI= = > N H* G:9/HX^V(sS0TSTSбSxRSlM0nMoMpMrM`sM0uM`vM0xMPzM|M ~MpMAdd an element.MutableSet.addVS8Remove an element. Do not raise an exception if absent.MutableSet.discard0WS5Remove an element. If not a member, raise a KeyError.  5/ ! UMutableSet.removetVXS2Return the popped value. Raise KeyError if empty.itE $Z %HE U  % $ %MutableSet.pop +<TtVhYS6This is slow (creates N new iterators!) but effective.*     MutableSet.clear8TtVX[SE HHUO MutableSet.__ior__!RiE LL   MutableSet.__iand__d : JJL b#&((,D=LL'HHUO   MutableSet.__ixor__бS(sS6 : JJL  U# MutableSet.__isub__YSA mutable set is a finite, iterable container. This class provides concrete generic implementations of all methods except for __contains__, __iter__, __len__, add(), and discard(). To override the comparisons (presumably for speed, as the semantics are fixed), all you have to do is redefine __le__ and then the other operations will automatically follow suit. W I""""   BUV8T `S``SMXM0M@MMMMM MMapping.__getitem__<D.get(k[,d]) -> D[k] if k in D, else d. d defaults to None.% 9  N  Mapping.get  cS'  I  Mapping.__contains__  :D.keys() -> a set-like object providing a view on D's keys ~ Mapping.keysSeS<D.items() -> a set-like object providing a view on D's items  Mapping.itemsS(gS6D.values() -> an object providing a view on D's values $Mapping.valuesSXhS3%)! !DJJL!T%++-%888Mapping.__eq__HhU@UA Mapping is a generic container for associating key/value pairs. This class provides concrete generic implementations of all methods except for __getitem__, __iter__, and __len__. LIO 9 LBU HhU`jSpM@M0M MMMMPV  MappingView.__init__4==!!MappingView.__len__sS&{0.__class__.__name__}({0._mapping!r})7>>tDDMappingView.__repr__PnS$I "E$L1 X^VqU(SyS@M MMKeysView._from_iterabledmm##KeysView.__contains__==  KeysView.__iter__ #I$!SMMM 2wItemsView._from_iterable_from_iterableVVYSU_mappingG U , c"A:+e +  ItemsView.__contains__ ! --sStV(==C c*+ +!ItemsView.__iter__&(#I,,X^V(sSSMMM3==C c"AEzQ%Z!ValuesView.__contains__#==C--$ $!ValuesView.__iter__$&sSI%SMMMutableMapping.__setitem__MutableMapping.__delitem__D.pop(k[,d]) -> v, remove specified key and return the corresponding value. If key is not found, d is returned if given, otherwise KeyError is raised. C IE S L  $--'N MutableMapping.pop  ))tVS{SD.popitem() -> (k, v), remove and return some (key, value) pair as a 2-tuple; but raise KeyError if D is empty. J %tDz"CS  IEz  % $ %MutableMapping.popitem"3TtVh}S,D.clear() -> None. Remove all items from D.*     MutableMapping.clearPStVSK D.update([E, ]**F) -> None. Update D from mapping/iterable E and F. If E present and has a .keys() method, does: for k in E: D[k] = E[k] If E present and lacks .keys() method, does: for (k, v) in E: D[k] = v In either case, this is followed by: for k, v in F.items(): D[k] = v eW %!#JS  UF #zz|!#JS $$ U!S $**,JCDI'MutableMapping.updateUSHhUVS@D.setdefault(k[,d]) -> D.get(k,d), also set D[k]=d if k not in D. 9  DI MutableMapping.setdefault tV(SA MutableMapping is a generic container for associating key/value pairs. This class provides concrete generic implementations of all methods except for __getitem__, __setitem__, __delitem__, __iter__, and __len__. popitem_MutableMapping__markerYIxH'  $BUS8TPSVU xhU8SУMMpMMMШMMSPVSequence.__getitem__B  GQ   Sequence.__iter__% "%"%!AEzQ%ZSequence.__contains__'%D *+Aq'M,Sequence.__reversed__hSS.index(value, [start, [stop]]) -> integer -- return first index of value. Raises ValueError if the value is not present. Supporting start and stop arguments is optional, but recommended. stop  D E)1-E  q CI D la$h GEzQ%Z FAla$h    Sequence.index@SA## A43A4pTSV0S?da5jAJ1d!Sequence.count..UBS.count(value) -> integer -- return number of occurrences of valuesum?d???Sequence.count `8SȑSPMAll the operations on a read-only sequence. Concrete subclasses must override __new__ or __init__, __getitem__, and __len__. A IO .@ BU!T HSSMMMMMPMS namespacebasesC <    , ! wsD%EfEE _DeprecateByteStringMeta.__new__ VVSSPUVSSSSpS@SVcollections.abc.ByteStringsuper _deprecatedinstance1 (  w(22*_DeprecateByteStringMeta.__instancecheck__VVHSSSSpS@SF33ȯSPMMMThis unifies bytes and bytearray. XXX Should add all their methods.  ISSMutableSequence.__setitem__MutableSequence.__delitem__!T3S.insert(index, value) -- insert value before index MutableSequence.insert!TSHS:S.append(value) -- append value to the end of the sequence CIu%MutableSequence.append VS,S.clear() -> None -- remove all items from S*     MutableSequence.clear   8TSS!S.reverse() -- reverse *IN PLACE*I Iq!tA#'!A;Q DGT!A#a%[MutableSequence.reversehSSMS.extend(iterable) -- extend sequence by appending elements from the iterable' T>&\FA KKNMutableSequence.extendqUPSS.pop([index]) -> item -- remove and return item at index (default last). Raise IndexError if list is empty or index is out of range.  K KMutableSequence.pop!TSvS.remove(value) -- remove first occurrence of value. Raise ValueError if the value is not present.  E" #MutableSequence.remove!TS F MutableSequence.__iadd__All the operations on a read-write sequence. Concrete subclasses must provide __new__ or __init__, __getitem__, __setitem__, __delitem__, __len__, and insert(). k I&8 $ BU V8TVXSXSXM(MMлMмMM M@M MM8Scollections.abcxS@SSдSSS`S(SSSSPSSSбS`SHhUxhU(SSSSHSXSSSSBUjAbstract Base Classes (ABCs) for collections, according to PEP 3119. Unit tests are in test_collections. MutableSequence ByteString_DeprecateByteStringMeta memoryviewSequence ValuesView ItemsViewKeysView MappingView MutableSet frozensetSetCallable _type_repr_is_param_expr_CallableGenericAliasBuffer Collection ContainerSized Generator ReversibleIteratorIterableAsyncGenerator AsyncIterator AsyncIterable Coroutine AwaitableHashableasync_generator_ag coroutine_coro generator mappingproxy dict_items dict_values dict_keys zip_iteratortuple_iterator str_iterator set_iteratorlongrange_iteratorrange_iteratorlist_reverseiterator list_iteratordict_itemiteratordict_valueiteratordict_keyiteratorbytearray_iterator bytearraybytes_iterator FunctionType_f EllipsisTypeABCMeta>( DI Cy Bx   d3i$y{+,RWWY($ryy{+,bhhj)*T"X D"./d58n%$uQ$Y/01DK DH~ d2hDK O 299; "((*  DMM" /$ %   K    es)   2'2"& &R 92g2"M&-]-`(22$x& .!$%"#$%#$- &'.!$%,,.!,   --` 9 g 2'2") w 4@L4@l V$;;(G*GT YMM` C 1j1f 2% 2 !{C ! ), S,, : %j %  K OWOd =@z:=@~ %#%*3w3(%= E I?h?D#UrUSBU`VqUqUqUxSHSSغSS`S SSShS(ShSSSUxS@SSTзSS`S(SSSSPS SS(rUSxS@SUSдSS`S(SSSSPSSSSpS8SSбSS`SHhU(SSSSxhUHS8UVSȯSSXSLSS(MSXS8S)MX*M0+M,M0/MSS2MxS7M@S:MS=MдSCMSFM`S`JM(S0MMS SMSVMSXMPSZMSp]MSeMSgMphMkMSPMбSPM`S MHhUM(SMSПMSMSMxhU@MHSMȯSMSMXS Quitter.__init__غU to exit() or Use +/99dhh??Quitter.__repr__غUSShS SystemExit7  IIOO   Quitter.__call__+9`VS@UPM0M0MPV[   '+3'+,1GGLLh7,18'+33_Printer.__init__UؿUVU*AVS`S0SS_Printer__linecnt_Printer__data_Printer__filenamesfp << ((H (W5779D6 );;Dzz$' T\\*65  _Printer.__setup__setupS' BBBB B B B  0SSU`ST SxU!Type %s() to see the full %s text_Printer__nameI  t||  -99T\\* *64;;.:JK K_Printer.__repr__S0S SSS0Hit Return for more, or q (and Return) to quit: IndexError_Printer__linesrangeprompt C vv '=>A$,,q/*? $--'k-C)+"k#:  _Printer.__call__S6A<< BBShS SV0SSSpSninteractive prompt objects for printing the license text, a list of contributors and the copyright notice._Printer__setupMAXLINES#.H3+ L SS pUPSPMMMpM(SHType help() for interactive help, or help(object) for help about object.8_Helper.__repr__Spydockwdsuzz4(4((_Helper.__call__SSSU3Define the builtin 'help'. This is a wrapper around pydoc.help that provides a helpful message when 'help' is typed at the Python interactive prompt. Calling help() at the Python prompt starts an interactive help session. Calling help(thing) prints help for the python object 'thing'. 8)US@MM= The objects used by the site module to add custom builtins. 4  f  8v8v)f)`VUpUU @SpMUPMpUMUDTest whether a path exists. Returns False for broken symbolic links0    Z VUUVS%Test whether a path is a regular fileB WWT] << ## Z VUUVVT`S<Return true if the pathname refers to an existing directory.B WWQZ << ## Z U6AAVUUV0 VTS&Test whether a path is a symbolic linkD XXd^ << ## Z 06A  A VȒUUVVU8VTpS1Return the size of a file, reported by os.stat().st_size 778  $ $$VU`SSCReturn the last modification time of a file, reported by os.stat().st_mtimeVUS8S=Return the last access time of a file, reported by os.stat().st_atimeVUSPSAReturn the metadata change time of a file, reported by os.stat().st_ctime 778  % %%VUS`SGGiven a list of pathnames, returns the longest common leading componentq R adT5M * #bii# $ QB QB" 1 1:bq6M I0TT qU8UPTVbUTpTUS5Test whether two stat buffers reference the same file, II " # II "$0TTrT@rTSTest whether two pathnames reference the same actual file or directory This is determined by the device number and i-node number and raises an exception if an os.stat() call on either pathname fails. f2f1+ B B B SPS0TTVU`TPS:Test whether two open file objects reference the same filefstatfp2fp1) #B #B B SPS0TTV S`TSSplit the extension from a pathname. Extension is everything from the last dot to the end, ignoring leading dots. Returns "(root, ext)"; ext may be empty. filenameIndexdotIndex altsepIndexsepIndexwws|H ggfo x-wwvH( 1 h&}Q/69(|Qxy\11 Q Mh& ae8OnU oU0SSSSplTpTS.Can't mix strings and bytes in path components;() argument must be str, bytes, or os.PathLike object, not hasbyteshasstrfuncnameFX  a F 5 !Hxj)778{{7K7K6NPQVZ [ (HItSvHSSSVVxS S ЎTUx]T@]T]T]TU UT]T\T`T Path operations common to more than one OS Do not use directly. The OS specific modules import the appropriate functions from this module themselves. `   $$$% & & & $$. TVUU UUT]T]Tx]T@]TЎT`T]T\TT0TS0SM MMM@M@M@M@M@MM0M`MM@M$8TT IIaLH a 002H#45==c4HA5/4A88H&78 8!"8"2"#))C"68 8 VbU`VpUUTTTTTSUnNormalize case of pathname. Makes all characters lowercase and all slashes into backslashes. b IIaL a ;;r{{1~55c4@FFHI Iyyd#))++VbU(fUPV@US:\:\ colon_sepn ! A!U   "1 fc"A ||CALLA6 nUTVbUȋV _TSS\/\/p_pathp_rootp_drive result_path result_root result_drive_ 99T?D$! !HsN1:4. k;RYY&A&/l #GVV,#*L$ $ W 4==?l&8&8&::#*L"(K"(K& {2d:)C/ %.K+'.  \"#.edlB#% 3 3k)K77 ~| 4$$VT:E:  (UTh T`T(TTTT`TB/C,$C,,-D VbU8TPT@UVVTT0T 8TTSplit a pathname into drive/UNC sharepoint and relative path specifiers. Returns a 2-tuple (drive_or_unc, path); either part may be empty. If you assign result = splitdrive(p) It is always true that: result[0] + result[1] == p If the path contained a drive letter, drive_or_unc will contain everything up to and including the colon. e.g. splitdrive("c:/dir") returns ("c:", "/dir") If the path contained a UNC path, the drive_or_unc will contain the host name and share up to but not including the fourth directory separator character. e.g. splitdrive("//host/computer/dir") returns ("//host/computer", "/dir") Paths cannot contain both a drive letter and a UNC path. #&"! E4 $+ DTHwTT8TTSplit a pathname into drive, root and tail. The drive is defined exactly as in splitdrive(). On Windows, the root may be a single path separator or an empty string. The tail contains anything after the root. For example: splitroot('//server/share/') == ('//server/share', '/', '') splitroot('C:/Users/Barney') == ('C:', '/', 'Users/Barney') splitroot('C:///spam///ham') == ('C:', '/', '//spam///ham') splitroot('Windows/notepad') == ('', '', 'Windows/notepad') index2normpcolon ! A!U$ #  IIfc "E RayC 1: r*j8AaEJJsE*E{%&ZZUQY/F|%&Wf:q 3Qvz{^C C!BQ%12& & qu  1: Ra5!Aa&!AB%' 'Ra5%12& &eQ nUh T9TT8 T!T TVbUUwT T8TH7T~Split a pathname. Return tuple (head, tail) where tail is everything after the final slash. Either part may be empty. ! A  DlGAq! AA !A#d" Q !A#d"2A!"$D q54;;t$ $d **T0TTVbUUT8TUTG ! A!U$$QtT::$$Qc377lT 8A;TmT!Test whether a path is a junctionIO_REPARSE_TAG_MOUNT_POINTM $BB%%)H)HHII^4  =AA VȒUUVVP>VMTU T $TCTest whether a path exists. Returns True for broken symbolic links2 XXd^  Z UaTest whether a path is a mount point (a drive root, the root of a share, or a mounted volume)casefoldseps 99T?D  D 4=D!$E4 qT!x D KK  d # * *4 0zz|qzz|++TDTHwTTVbUUTV8TSTUTTUSERNAME HOMEDRIVEHOMEPATH USERPROFILELExpand ~ and ~user constructs. If user or $HOME is unknown, do nothing. current_user target_user{ 99T?D$ ??5 ! c$iqA a%DG=#66 Q a%DG=#66 "::m, 2:: %  JJ{+Erzz*56Av1Qi k5 )++k2Kzz~~j1 , & x11 GH-{;H$;;x( d12h / E xTwTDTHTT6F FFVbUȋVUTUtVPVTU(fU T`T(TTTascii_-fExpand shell variables of the forms $var, ${var} and %var%. Unknown variables are left unchanged.digits ascii_lettersvarpathlenindexresdollarrbracebracepercentquotevarcharsH 99T?D$ t D 0K-- =DgN"j$/ d?s$K''&--7$>** r(C E$iG '/ uQw  : #D$iG $ 1 q4 +++'\EAIeai(G3q E!GH~d)! JJw/E v,C8"?$&KK 2;;s;K0L$ME$+CLE5LC &[EAIeai(F2q eai *e3E!GH~d)! JJv.E v,C>"?$&KK 2;;s;K0L$ME$+CLE5LC2Ah uqy)AM1HCQJEU519-AAM) " BJJr{{37G,H I ' u QJE 1HC  W '/X JI $q4x!  $,$8 '#  78"(7T>)C#aKE(@$> & 4v =>"(6E>D00C#aKE(4 )"SLE) "T"T"TX"T("T!TU!T!Th!T8!To3KL AK5(M?AL)8AM"K21K25L  L  L&%L&)M?MMM"M32M3VbU!T TU!TV(fUPVtV@ T TTfU3yy dE "CFFFCFFF||FC(%dOtT 3 #e*n8uQx61!HqV#q5U1Q3Z61ac!A#gFA!VaFAQ#e*ne LL '' nUUؾUDTHwTUЂT VbU8TT T؍TTReturn the absolute version of a path as a fallback function in case `nt._getfullpathname` is not available or raises OSError. See bpo-31047 for more. M 99T?D ; dE "**,C))+CC D>-T&Return the absolute version of a path.5 +#HTN3 3$ +$T* * + 33STPTUVPST.T)(& (0T0T/Told_pathLutnD( HHXd^ $ #D)T{"(+' $D):D$ABDtnD(,  ;;"22     @4T0U0ThV)%B B B9B)(B)) B98B9 UURTTTPTUUX8TVX0T3T`3Tallowed_winerror$XBQx :(.+/tD$'9T9* ) :;;&66  .d3H4'7;tHd3I(#4[ d$;&+/tD$'T' : @4TThVTN(( B,B'A' B,&B'' A30B'2A33B' B,B''B,RTUX8T`RTT3T\\.\NUL\\\\?\UNC\\\?\\\.\NUL\\\\?\UNC\\\?\winerrorgetcwdgetcwdbspathinitial_winerror had_prefixnew_unc_prefix unc_prefix~ dE "F(J$N**,C~"++g*>!??$F'J#N))+C~'!22#__V, %+T?D 5$T*D "doof5z*&c*o.>)??S[\* !$U+t3 D t I " c"g&D0D>D 5!{{ .t4D  5&    !;;"22 D  ! U9T9T`9T 9ThV8TB D,F, F 5"E F (FF  G G*GGPTV8TU(fUnU8TȋVTRTVUVX8TRT 08T8T7T7T7TH7T7T6T, start on mount path is on mount e2e1 path_rest path_drive start_rest start_drivepath_abs start_abs 99T?D$ } ,-- IIe EHUO, 8D>*%.y%9" Q #,X#6 Ay K HZ$8 8K)* *",!1!1#!6T@TT>T>TT>BE,E"#E"'E,<E'E'AE,E," E,,7F#VbUVVPT8TUTTVVTTT0T@T؍TTT@>T>ThTPaths don't have the same drivedrive drivesplits- @AA #bii' (E%(E"JOP%Qy63!7!=!=!?@% P3>?;1aqwws|; ? -gaA- .! 3DE E -gaA- .! 3>? ?%eAh&6&6vs&CDtTC#9VqQ&[!V9DOPKq1:1aa6k1:K P    bMDAqBqEz" HSW%Ft|chhv...5Q?- . ::P ~ &$$\:E:  (UnUUET`TDTHwTЕT0TTH0GHG!*H9 G( "H( G/ 5AHG6 G6G6H H%G; -G; 3G; 7H<2H/,HH;HH'H-V8UPTVbU8T@UTTpTUVVT0TTpT TDT0T@Determines whether the specified path is on a Windows Dev Drive.( #GDM2 2    ""PTVUJTPT8QTpQTQTQTRTPWUSTSTst_reparse_tag8UTTTHTT(UTpT8TTTTUЎT]T]Tx]T@]TTUTU UhTUTPTVUؾUHUPoUnU oUnUTThT]T\T`T0TȡTnul.;C:\binCommon pathname manipulations, WindowsNT/95 version. Instead of importing this module directly, import os and refer to this module as os.path. isdevdrive_path_isdevdrive _path_exists _path_islink _path_isfile _path_isdir_getfinalpathname_nonstrict_readlink_deep _nt_readlink_getfinalpathname_getfullpathname_abspath_fallback_getvolumepathname stat_result_LCMAP_LOWERCASELCMAP_LOWERCASE_LOCALE_NAME_INVARIANTLOCALE_NAME_INVARIANT_LCMapStringEx LCMapStringEx_winapi _get_bothseps          O!,-- 8H(+b.1r +*8 ((00  2>>+,J$%:-zj`&(-P" +# +]> (T/b"'<@"+p.b  ())) #_ ,, ,t^#("(#(t G Hd  } C3DD(D2D)D6)E3C>=C>D  D DDD&%D&)D32D36D>=D>E  E BUؾU oUHUnUPoUnUV`VUTUTpUT8UTUTTTTTHTTTTU0VTpT8TTTTTUVSTȡTTSThTUTTPTPSTSTVRTPWURT`RTRTTThT0TQTUQT UpQTT8QTUPTPT6PTTOTOT@V@NTMNTM MMMMMPMNN`NMT@NNNMTN N NTpN@NhMTN0MT N`NКTN#N(NMTLTLTpLT@LT -N0.NPV sameopenfilesamefilegetctimegetatimegetmtimegetsize$6Normalize case of pathname. Has no effect under Posix 99Q<^TTest whether a path is absolute' ! A 1+C << VbUHTȋV_TJoin two or more pathname components, inserting '/' as needed. If any component is an absolute path, all previous path components will be discarded. An empty last part will result in a path that ends with a separator. ! A 1+C D  !HsNRYY"A||C T]]3/ a # K ~| 4$$VQ33  AB-B2 VbUHTPTȋVPVVVTT0TaTSplit a pathname. Returns tuple "(head, tail)" where "tail" is everything after the final slash. Either part may be empty.k ! A 1+C  qA2A!"$D CI %{{3 :0TT@dTD ! A!U  Cv 66 oUVbUTTJSplit a pathname into drive and path. On Posix, drive is always empty.  ! A Ra5!8O`gTSplit a pathname into drive, root and tail. On Posix, drive is always empty; the root may be empty, a single slash, or two slashes. The tail contains anything after the root. For example: splitroot('foo/bar') == ('', '', 'foo/bar') splitroot('/foo/bar') == ('', '/', 'foo/bar') splitroot('//foo/bar') == ('', '//', 'foo/bar') splitroot('///foo/bar') == ('', '/', '//foo/bar')  ! A!U!u|eQ 1Q3!Aa&C-c1QR5  aeQqrU""TVbU hT)Returns the final component of a pathnamerfind5 ! A 1+C  qA QR5LVbUHTplTlT-Returns the directory component of a pathnameZ ! A 1+C  qA Ra5D CI %{{3 K0TVbUHTplTUmTQTest whether a path is a junction Junctions are not a part of posix semanticsIIdO VbUoT0   Z  **VȒUUVT$Test whether a path is a mount pointst_inost_devino2ino1dev2dev1 XXd^ << # 99T?D$dE"dD! f F XXf  99D 99D t| 99D 99D t| 7 Z  Z 0TTsTrTrTprT#CC(C%$C%(C:9C:VȒUU8VTUVbUT@rTrTqT؍TTHOMEOExpand ~ and ~user constructions. If user or $HOME is unknown, do nothing.getpwnampw_dirgetpwuidfindrootpwentuserhomepwdtilde 99T?D$ ??5 ! 4.C #qA1u IAv  #  << 4;; zz&)H  Aay dE ";;t$D LL&E <<CLLI5 $;;x(t$H tABx  (D(I        K  K  xTwTwTxwTHwTHE5-F F:F(5 FF FF F%$F%( F65F6VbUȋVHTwTUwT0VvT UvTtVPVxvT`VxU(fUU vTuTXU\$(\w+|\{[^}]*\})\$(\w+|\{[^}]*\})ZExpand shell variables of form $var and ${var}. Unknown variables are left unchanged.groupspansearchre 99T?D$ t K  #8"((CI!!"j$/ d?K zz"6AH** A  4O " K!vvay1wwqz ??5 !dmmC&8":D  BJJr{{4/@$AB 8D8e#DD A DLD'  A  }T}TUT&AF FFVbUT}T0VT}T0TUp}T@}TȋVPV(fUPVtV|T|TfU8|T0Normalize path, eliminating double slashes, etc.comp new_compscompsinitial_slashesdotdotdotemptyyy dE "CECFCECF 5=J#,T? ?D 3 Ds|#y "  7  & %0{s ThT8TTЂTThT VbU8TT8T T؍TTReturn an absolute path.K 99T?D ; dE "**,C))+CC D> VbUT8T8TPT0TlReturn the canonical path of the specified filename, eliminating any symbolic links encountered in the path.6yy"HXbq\8VR@HD" 4=TVbUTVȇTokis_linknewpathrest$ T{ABx s+ atv~  6>"4[ d6>ff5D tT" /'"B ll2::.GD  d?=D GT*E11W  r{{7';VTJbd#U* *W Y \ :; G  T0UUؾUTUTTD99E  E TUTVȒUU8VTUTPWU ؍TT..no path specified#Return a relative version of a pathDeprecationWarning commonprefixrel_list start_list2 ,-- 99T?D$ } %  !(!5!5c!:@!:Aaa!: @ ' 3 3C 8> 81AQ 8 >  j)45 68s:q01IabMAMXA> ~|5G H$$Ye<  UؾU@TTT<C37C)?C)C3!C.)C.-3C3!C3) C332D%VVbUVTЎTVVTTT0T @TT؍TThT5u!2A#ucommonpath.. U%Can't mix absolute and relative paths%commonpath() arg is an empty sequenceDGiven a sequence of path names, returns the longest common sub-path._check_arg_typesmaxmincommons2s1 split_pathsu @AA #bii' (E%(E"38954tzz#5 9 P5u55FEEPPKq1:1aa6k1:K P    bMDAqBqEzBQ" 3r7(((#: PDE4 O P;P ~ &$$\:E:  @ (UU`TT0TTЕTUlD,D+D,.DD, D&D! D! D! $D&)4D,$D,D,DD,!D&&D,,'EV8UPTVbUTUTpTUVVT0T TpT`XN T0TT(UTpT8TTTTUЎT]T]Tx]T@]TTUTU UhTUTPTV]T\T`TUؾUHUPoUnU oUnUTThT0TȡT /dev/null /bin:/usr/bin..Common operations on Posix pathnames. Instead of importing this module directly, import os and refer to this module as os.path. The "os.path" name is an alias for this module on Posix systems; on other systems (e.g. Windows), os.path provides the same operations in a manner specific to that platform, and is an alias to another module (e.g. ntpath). Some of this can actually be useful on non-Posix systems too, e.g. for manipulation of the pathname component of URLs. commonpathrelpathsupports_unicode_filenames _joinrealpathrealpathnormpath_path_normpath expandvars _varprogb_varprogismountlexists isjunctionbasename splitroot splitdrive _splitextsplitextisabs_get_sep genericpath            ': "7((00 #>V6)z   .j 0D "'<~"llh6!R#E9B""B-,B-+UؾU oUHUPoUnUnUV`VUTHTUTTTTpT8TTUȡTThTU0TTTTPT0VVTTxUThT0T%(TTTT@V0T`2NP3N@4Np5N7N09N:N;N=N@>N?N@NANDNHNTLNONКTPNQNUPUNPYNPV 79 H7FNN## 7v;6;a!A$#+;667A  AA A  A qUVUfn' (N!7 HHXb\ ""8NVTnUoU(nUASCIITmakedirs(name [, mode=0o777][, exist_ok=False]) Super-mkdir; create a leaf directory and all intermediate ones. Works like mkdir, except that any intermediate path segment (not just the rightmost) will be created if it does not exist. If the target directory already exists, raise an OSError if exist_ok is False. Otherwise no exception is raised. This is recursive. FileExistsErrorcdirexist_okD!JD$ ZZ% d T[[.  TH - dE ")D 4<  dD    tzz$/  0T0TThT$ B B# B B #!CC TUPlU0TUXUUUxTXTTremovedirs(name) Super-rmdir; remove a leaf directory and all empty intermediate ones. Works like rmdir except that, if the leaf directory is successfully removed, directories corresponding to rightmost path segments will be pruned away until either the whole path is consumed or an error occurs. Errors during this latter phase are ignored -- they generally mean that a directory was not empty. x $KD!JD$ ZZ% d 4  $KZZ% d 4$4$   0TT A// A;:A;VUTU T<renames(old, new) Super-rename; create directories as necessary and delete any left empty. Works like rename, except creation of any intermediate directories needed to make the new pathname good is attempted first. After the rename, directories corresponding to rightmost path segments of the old name will be pruned until either the whole path is consumed or a nonempty directory is found. Note: this function can fail with the new directory structure made if you lack permissions needed to unlink the leaf directory or file. tailheadtCJD$ T[[. 3CJD$   t t   @VU0TT& A44 B?BTUPlUVUlUUTos.walk& Directory tree generator. For each directory in the directory tree rooted at top (including top itself, but excluding '.' and '..'), yields a 3-tuple dirpath, dirnames, filenames dirpath is a string, the path to the directory. dirnames is a list of the names of the subdirectories in dirpath (including symlinks to directories, and excluding '.' and '..'). filenames is a list of the names of the non-directory files in dirpath. Note that the names in the lists are just names, with no path components. To get a full path (which begins with top) to a file or directory in dirpath, do os.path.join(dirpath, name). If optional arg 'topdown' is true or not specified, the triple for a directory is generated before the triples for any of its subdirectories (directories are generated top down). If topdown is false, the triple for a directory is generated after the triples for all of its subdirectories (directories are generated bottom up). When topdown is true, the caller can modify the dirnames list in-place (e.g., via del or slice assignment), and walk will only recurse into the subdirectories whose names remain in dirnames; this can be used to prune the search, or to impose a specific order of visiting. Modifying dirnames when topdown is false has no effect on the behavior of os.walk(), since the directories in dirnames have already been generated by the time dirnames itself is generated. No matter the value of topdown, the list of subdirectories is retrieved before the tuples for the directory and its subdirectories are generated. By default errors from the os.scandir() call are ignored. If optional arg 'onerror' is specified, it should be a function; it will be called with one argument, an OSError instance. It can report the error to continue with the walk, or raise the exception to abort the walk. Note that the filename is available as the filename attribute of the exception object. By default, os.walk does not follow symbolic links to subdirectories on systems that support them. In order to get this functionality, set the optional argument 'followlinks' to true. Caution: if you pass a relative pathname for top, don't change the current working directory between resumptions of walk. walk never changes the current directory, and assumes that the client doesn't either. Example: import os from os.path import join, getsize for root, dirs, files in os.walk('python/Lib/email'): print(root, "consumes ") print(sum(getsize(join(root, name)) for name in files), end=" ") print("bytes in", len(files), "non-directory files") if 'CVS' in dirs: dirs.remove('CVS') # don't visit CVS directories is_junction StopIterationnew_path walk_intocont walk_dirsislink followlinksUxIIigw < C[ME;; DF iik c5 !I    J    $Z 0#"&==!&e!D!`UM^M^M`I`!& KK +NN5::.6#$( /).)9)9);J )3N  !((4W1 " "  )*D ##F#$ '/*/J /IZZZ   tW$ $#D>W- fX&6LL** LL#tW- .$Y/ X&0o  TTTTTؿUTT(TVpTT0T8TTUTA3I6 E IG E+G>FAGF-'!GI E( E#I#E((I+ E74E:5G6E77E:: F FGFG F*'G)F**G- F;8G:F;;G> IG 5IA I`VPTbUT8T8UHkUUTkU0TTT@TTTos.fwalkDirectory tree generator. This behaves exactly like walk(), except that it yields a 4-tuple dirpath, dirnames, filenames, dirfd `dirpath`, `dirnames` and `filenames` are identical to walk() output, and `dirfd` is a file descriptor referring to the directory `dirpath`. The advantage of fwalk() over walk() is that it's safe against symlink races (when follow_symlinks is False). If dir_fd is not None, it should be a file descriptor open to a directory, and top should be relative; top will then be relative to that directory. (dir_fd is always supported for fwalk.) Caution: Since fwalk() yields file descriptors, those are only valid until the next iteration step, so you should dup() them if you want to keep them for a longer period. Example: import os for root, dirs, files, rootfd in os.fwalk('python/Lib/email'): print(root, "consumes", end="") print(sum(os.stat(name, dir_fd=rootfd).st_size for name in files), end="") print("bytes in", len(files), "non-directory files") if 'CVS' in dirs: dirs.remove('CVS') # don't visit CVS directories auditB *c7G_fMSkfc3=>?S%( !!%'7OTTT % \)%LU % \)%L TTTTPT<ACBBB#+CCB,CCC `VPTbUjU@jU8TpjU TT-(&DueWt^T4HI&UThT2C#AKD%ueWt^T5IJ#A_fwalk.. UTThT jUzip is_symlinkis_dirsamestatst_mode O_NONBLOCKO_RDONLYpoptoppathtopfdentriesnondirs scandir_itorig_stentrytopnamedirfdisrootactiononerrortopdownisbytesstackT   \ ! %L  | #K $$$16.w "="7E%PG#jjj?G(Z"7FE  lE*+bjj9==$u+6U^ !_$"E::D~ <<>KK%*u-NN4( & 4%/ / LL,$(GH I))GWRa[1 ? LL( 2J( ( LLC#&tDbDz74R4=#AC C_ "   8 '')t,   @@TTTTPT TTTT`TU(TؿUTTThT{A I >G; BI AH$BI ; H HI HI  I(!I  I IIIII II 8TpjUjUjUUTTUU0 VT`THkU(fU0TTT PUTxToNpNpexecl(file, *args) Execute the executable file with argument list args, replacing the current process.   $(OUTexecle(file, *args, env) Execute the executable file with argument list args and environment env, replacing the current process.  r(C 4crC hTUTexeclp(file, *args) Execute the executable file (which is searched for along $PATH) with argument list args, replacing the current process.   4PiU`Texeclpe(file, *args, env) Execute the executable file (which is searched for along $PATH) with argument list args and environment env, replacing the current process.  r(C D$s)S! iUTexecvp(file, args) Execute the executable file (which is searched for along $PATH) with argument list args, replacing the current process. args may be a list or tuple of strings.   T4PTexecvpe(file, args, env) Execute the executable file (which is searched for along $PATH) with argument list args and environment env, replacing the current process. args may be a list or tuple of strings.  T4hUTNotADirectoryErrorFileNotFoundErrormap saved_excargrest exec_func  + ' ||D$!!Ic"I t|~), 99S$'  h ) ) N"#56 H H    TTTTU:V$ BC )B00 C <CC  hTU(OUUUhU(fUPTTTU*env cannot contain 'PATH' and b'PATH' keysPATHPATHReturns the sequence of directories that will be searched for the named executable (similar to a shell) when launching a process. *env* must be an environment variable dict or None. If *env* is None, os.environ will be used. split BytesWarning simplefiltercatch_warnings path_listb path_list {  "h 5 I " ' \ ($DFF& $Iu)E$Y/ ) #, ??7 ##' I  i(   # "ThTRC B#C  B4,C # B1.C 0B11C 4CC CC  CU0TTTVhgUVtVPVPoUTHUpT@TTT'""&& _Environ.__init__( UHT8TT( UHT8TTgUN *JJt~~c23E&& *3-T ) *_Environ.__getitem__ 1AgU( UtVTputenv encodevalue7nnS!  'sE 3_Environ.__setitem__( U8TTgUunsetenv encodedkeyD^^C(  * :& *3-T ) *_Environ.__delitem__T ,A( UPTgUtV-DJJC..% %_Environ.__iter__13qUgUHT4::_Environ.__len__gU decodevalue decodekey>$ 0 U~~c"%R(8(8(?'B C0$_Environ.__repr__.. U25HTTГV}) environ({, formatted_items=))$ "jj..0$  O,C00_Environ.__repr__` TgUTNhT8T Dz _Environ.copy d?DICy_Environ.setdefault E _Environ.__ior__UVnewother,%)! !4j 5 _Environ.__or__,%)! !5k 4 _Environ.__ror__UUHhU@UV setdefault>' *& 1 UhUNЂN0NpNNNNPN0NNN0N,eS) 6e9M9M MNNL!_createenviron..check_strVV Uupper#;$$& &!_createenviron..encodekeyUstr expected, not %s:eS) 6e9M9M MNN<<*;< <_createenviron..encodeVV UUsurrogateescape<<*;< <_createenviron..decode U encodekey check_str t|  '!--/JC#(D3 *,,. = =  D6  @@` U( UVU`VpUhUNNNNGet an environment variable, return None if it doesn't exist. The optional second argument can specify an alternate default. key, default and the result are str. ;;sG $$U Ubytes expected, not %s,%'4tE{7K7KKL L VUGet an environment variable, return None if it doesn't exist. The optional second argument can specify an alternate default. key, default and the result are bytes.||C))fUXUEncode filename (an os.PathLike, bytes, or str) to the filesystem encoding with 'surrogateescape' error handler, return bytes unchanged. On Windows, use 'strict' error handler if the file system encoding is 'mbcs' (which is the default encoding). / (# h $??8V4 4O_fscodec..fsencodebUVUDecode filename (an os.PathLike, bytes, or str) from the filesystem encoding with 'surrogateescape' error handler, return str unchanged. On Windows, use 'strict' error handler if the file system encoding is 'mbcs' (which is the default encoding). / (# h &??8V4 4O_fscodec..fsdecode bUpUgetfilesystemencodeerrorsgetfilesystemencoding6((*H  * * ,F   X  @@(fUPV`VpU(UNN"argv first element cannot be emptyargv must be a tuple or a listwaitstatus_to_exitcode WIFSTOPPEDwaitpidtuplestswpid$ .<= =47AB Bf ;t$tS)%x #CO cc?-c22 c UhU B B 8UqUVVXOUPpUeUUUUHUUspawnv(mode, file, args) -> integer Execute file with arguments from args in a subprocess. If mode == P_NOWAIT return the pid of the process. If mode == P_WAIT return the process's exit code if it exits normally; otherwise return -SIG, where SIG is the signal that killed it. tT477PeU(OUU:spawnve(mode, file, args, env) -> integer Execute file with arguments from args in a subprocess with the specified environment. If mode == P_NOWAIT return the pid of the process. If mode == P_WAIT return the process's exit code if it exits normally; otherwise return -SIG, where SIG is the signal that killed it. tT377PeUhTUU8spawnvp(mode, file, args) -> integer Execute file (which is looked for along $PATH) with arguments from args in a subprocess. If mode == P_NOWAIT return the pid of the process. If mode == P_WAIT return the process's exit code if it exits normally; otherwise return -SIG, where SIG is the signal that killed it. tT488PeUPiUU\spawnvpe(mode, file, args, env) -> integer Execute file (which is looked for along $PATH) with arguments from args in a subprocess with the supplied environment. If mode == P_NOWAIT return the pid of the process. If mode == P_WAIT return the process's exit code if it exits normally; otherwise return -SIG, where SIG is the signal that killed it. tT388PeU iU"Uspawnl(mode, file, *args) -> integer Execute file with arguments from args in a subprocess. If mode == P_NOWAIT return the pid of the process. If mode == P_WAIT return the process's exit code if it exits normally; otherwise return -SIG, where SIG is the signal that killed it. dD$'' eU0$U:spawnle(mode, file, *args, env) -> integer Execute file with arguments from args in a subprocess with the supplied environment. If mode == P_NOWAIT return the pid of the process. If mode == P_WAIT return the process's exit code if it exits normally; otherwise return -SIG, where SIG is the signal that killed it. $2htT49c22dU&UWspawnlp(mode, file, *args) -> integer Execute file (which is looked for along $PATH) with arguments from args in a subprocess with the supplied environment. If mode == P_NOWAIT return the pid of the process. If mode == P_WAIT return the process's exit code if it exits normally; otherwise return -SIG, where SIG is the signal that killed it. tT4((dU((U]spawnlpe(mode, file, *args, env) -> integer Execute file (which is looked for along $PATH) with arguments from args in a subprocess with the supplied environment. If mode == P_NOWAIT return the pid of the process. If mode == P_WAIT return the process's exit code if it exits normally; otherwise return -SIG, where SIG is the signal that killed it. $2hdD"Is33dU*Ushell-U-U+popen() does not support unbuffered streamsinvalid mode %r&invalid cmd type (%s, expected string)PIPEPopen subprocesscmd#s#DtCyPQ Q z !.56 6 >Y.JK K 3;##C*.T+5??,5$7Dt{{D1 1##C*.T*4//,5$7Dtzz40 0/UH/U1U VVVH/U/U.UXcU .Up.U(.U-U-UP-Uprocstream!DLDJ_wrap_close.__init__2U1U6Up3Uwait_proc returncodeC LL   *JQt|!!!Q&_wrap_close.close3U6Up3U@3U_wrap_close.__enter___wrap_close.__exit__4<<. ._wrap_close.__getattr__6U_stream % %_wrap_close.__iter__6U   '   / & XcUNN8NNNN&invalid fd type (%s, expected integer) text_encoding\ b# @48KLL  $##H- 2772tY B4 B6 BBPUVVqUVV 9U8U7expected {}.__fspath__() to return str or bytes, not {}/expected str, bytes or os.PathLike object, not aReturn the path representation of a path-like object. If str or bytes is passed in, it is returned unchanged. Otherwise the os.PathLike interface is used to get the path representation. If the path representation is not str or bytes, TypeError is raised. If the provided path is not str, bytes, or os.PathLike, TypeError is raised. path_repr path_type$e % T I9((. )c5\*!!' (:(:(,Y(@(@"BC C 9 9l + #%.%7%789 9 9h=U0=U B/B5 VVVV;UH;U:U9Return the file system path representation of the object. "!PathLike.__fspath__R?UNotImplemented (?!(L9 9PathLike.__subclasshook__VVQ`bU(rU@UCAbstract base class for implementing the file system path protocol.abstractmethod>M"" $L1 rUBUX^VqU`bUXBUpN@Nremove_dll_directoryDI!DL)=D &_AddedDllDirectory.__init__0DUEUKU_cookie  & &t|| 4DI_AddedDllDirectory.closeKUEUK_AddedDllDirectory.__enter__ JJL_AddedDllDirectory.__exit__!yy299$))DD*_AddedDllDirectory.__repr__GUGU >    + bU`NPNXN NNOAdd a path to the DLL search path. This search path is used when resolving dependencies for imported extension modules (the module itself is resolved through sys.path), and also by ctypes. Remove the directory by calling close() on the returned object or using it in a with statement. _remove_dll_directory_add_dll_directory5 &&&t,!    $ $  KU bUKU8JUPMU eUdUdUdUeUeUeUexecvforkfUfUgUhgUxhUHhUjUiUiUiUPiU iUPlUlUkU MS_WINDOWS HAVE_LSTAT HAVE_LUTIMES HAVE_LCHOWNlchown HAVE_LCHMODchflags HAVE_LCHFLAGS HAVE_FSTATVFSfstatvfsstatvfspathconfHAVE_FPATHCONF HAVE_FUTIMES HAVE_FUTIMENSHAVE_FTRUNCATEexecve HAVE_FEXECVEHAVE_FDOPENDIR HAVE_FCHOWN HAVE_FCHMODchdir HAVE_FCHDIRHAVE_UTIMENSATrmdir HAVE_UNLINKATsymlinkHAVE_SYMLINKATrename HAVE_RENAMEATreadlinkHAVE_READLINKAT HAVE_OPENATmknod HAVE_MKNODATmkfifo HAVE_MKFIFOATmkdir HAVE_MKDIRATlink HAVE_LINKATutimeHAVE_FUTIMESAT HAVE_FSTATATchown HAVE_FCHOWNATchmod HAVE_FCHMODATHAVE_FACCESSATUؾUHUPoU oUnUnUno os specific module found oUPpUnUUؾUHUpUPoUnUlUlUlU(fUPVhU(cU oU(rUNOS routines for NT or Posix depending on what system we're on. This exports: - all functions from posix or nt, e.g. unlink, stat, etc. - os.path is either posixpath or ntpath - os.name is either 'posix' or 'nt' - os.curdir is a string representing the current directory (always '.') - os.pardir is a string representing the parent directory (always '..') - os.sep is the (or a most common) pathname separator ('/' or '\\') - os.extsep is the extension separator (always '.') - os.altsep is the alternate pathname separator (None or '/') - os.pathsep is the component separator used in $PATH etc - os.linesep is the line separator in text files ('\r' or '\n' or '\r\n') - os.defpath is the default search path for executables - os.devnull is the file path of the null device ('/dev/null', etc.) Programs that import and use 'os' stand a better chance of being portable between different platforms. Of course, they must then only use functions that are defined by all platforms (e.g., unlink and opendir), and leave all pathname manipulation to os.path (e.g., split and join). add_dll_directory_AddedDllDirectoryPathLikeABCfspath_fspathfdopen _wrap_closepopenspawnlpespawnlpspawnlespawnlspawnvpespawnvpspawnvespawnv _spawnvef P_NOWAITOP_NOWAITP_WAITfsencode_fscodecgetenvbenvironb_data _check_bytessupports_bytes_environgetenv_createenviron_EnvironMappingMutableMapping get_exec_path_execvpeexecvpeexecvpexeclpeexeclpexecleexecl_fwalk _fwalk_close _fwalk_yield _fwalk_walkfwalkscandirwalk_walk_symlinks_as_filesrenames removedirsmakedirsSEEK_ENDSEEK_CURSEEK_SETsupports_follow_symlinks supports_fdsupports_effective_idssupports_dir_fd_set_add_globalsdevnullaltsepextsepdefpathos.pathntpath_have_functions posixpath_exitlinesep_get_exports_list_exists_namesbuiltin_module_names GenericAliasintlist_check_methods_collections_abcabc0 +DI ! !  7 f DG w ) NN$U+,  V^ DG w  NN$R()  & 3 44 I     yH# 5D H%G$G$F# G$F#G$H%G$F# J'H% I&H%G$ G$O 5D H%! 5DG$G$G$ I& I&H%HHTN J'G$G$ J'ygj1 _i(K 5D H%, G$F#I&G$x ]G$F#G$F#F# G$F##     @&,445!(X'tv$x FFO2sww2$4<++" %U!               HS S+S7 TS('S(+S43S47T?TT  T nrU`VUU`rU(rUqUqUqUPqU qUpUpUpUPpU0VpUoUoUoUUؾUHUPoU oUnUnUnUXnUU(nUmUmUxmU0mUlUlUlUPlUlUkUkUxkUHkUkUjUjUpjU@jUjUiUiUiUPiU iUhUhUxhUHhUhUgUUgUhgU0gUgUfUfU`fU(fUPVeUeUeUPeU eUdUdUdUXdU(dUcUcUxUcUXcU(cUbUbUbU`bU bUaUh]UH]U\U^N_N@V`\UPpU0\U[U[UoUP[UoU aN[UZUZUhZU8ZUZUUYUYU`YU0YUXUXUXU`XU(XUWUWUWUPWUWUVUVUVUHVUVUUUUUxUU@UUUUTU(UHkUTUhTU0TUSUSUSUPSU SURURUxRUHRURUQUQUpQU8QUQU@bNdN`fNPU0hNxkUPUmNrNkUwNpxN`yN@zN0{N|N@PU|NPNPU`NhUNNOUNNOUNXOU eU(OUNUPNPN@N0N NNUNNXdU(dUdUNNcUcUXUNЯNXcUcUN@NbU@N`bU0N bU NxNU8NUMUPVMUMU" yy gCJJ'`VUVXVnormcasepaths[ '',, C ggooc"   % %%    (UUA A*)A*VVUU_frozen_importlib_external_frozen_importlibUUESet all module __file__ and __cached__ attributes to an absolute path loader_module ##% &  LL33M  S S  4AJ 77??1<<8AL!'   ! 1 1 < < !   3   3   UYB* .C*9.D* C'4 CC' C!C' C!!C'&C'*DDDDU`VVVVVUV~VpUHUK Remove duplicate entries from sys.path along with making them absolutea A%Kxx } W + % HHSM OOG $CHHQK UU(UU`VU؈UEReturn a set containing all existing file system items from sys.path.itemcase` A ww~~d#&tn 8h  H    U>A!! A-,A-U`VVUUVUimport import  Remainder of file ignored :  of Error processing line 0UU# as UTF-8. Using fallback encoding Cannot read utf-8-sigProcessing .pth file: Skipping hidden .pth file: st_file_attributesst_flagsProcess a .pth file within the site-packages directory: For each line in the file, either combine it with sitedir to a path and add that to known_paths, or execute it if it starts with 'import '. format_exceptionrstrip splitlines enumerate getencodingUnicodeDecodeErrorlstatrecorddircase pth_contentst $& ww||GT*H XXh  Z #dnn 4 )1 -0J0J J,XL9: #H< 01 \\( #q&&(K$ D"((5 [335q94 ??3   ::<2   67T ;;=D#GT2LCk)bggnnS.A$(:.  e $ #  D !((););)=> h\***0*<*<*>)AC D D,  *1Q%tH:SAzz # #44S9"--/D$t)#**50: /cjj A   UU:VUXUU(UVUnG"G7GGG+)H=A2H= G  G GG G('G(+A H:9H:= KB KK"`UVȒUUU@V V@UV`VUPUUUȋVpUФVUUU`VVVpUpU8UUUpU8UUUU8UU؍UXVU`U.pthAdding directory: TAdd 'sitedir' argument to sys.path if missing and handle .pth files in 'sitedir'sortedlistdirnames sitedircase { +,$& #G,G[ + %   $ 7#$ Ded f%dooc.BeE Du 7D+.    DUUUXU#C <+C CC@U`UU`VV(UUPVȋVU(UxU8UU,Check if user site directory is safe for inclusion The function tests for the command line flag (including environment var), process uid/gid equal to effective uid/gid. None: Disabled for security reasons False: Disabled by user (command line option) True: Safe and enabled getgidgetegidgetuidgeteuid no_user_sitek yyr8Y!7 ::<299; &r8Y!7 ::<299; &  `VUVVPU UUUhU UPUUUwasivxworks emscripten$ww!!"'',,"566_getuserbase..joinuserVU.local%d.%dLibraryPythonAPPDATAUXU(UPYTHONUSERBASEjoinuserenv_basezz~~.5H ||887 ww$zz~~i(/Ch'' ||xCNNY#"2"22A"668 8 C ""hU0UVU`VxUШU0U UȤU`NUXUU(UUȣU/site-packages /lib/python/lib/python/site-packages\site-packages\Python _frameworkwinver ver_nodotG ww$JJ&&sB/ 8I;o>> ||xCNN455Z{71:,a |> JJU8U`V0UVUxUШU UhUU UUUReturns the `user base` directory path. The `user base` directory can be used to store data. If the global variable ``USER_BASE`` is not initialized yet, this function will also set it.  N pUxUHUReturns the user-specific site-packages directory path. If the global variable ``USER_SITE`` is not initialized yet, this function will also set it. userbase7}H  $  "(+I UUUU@UUProcessing user site-packagesAdd a per user site-package to sys.path Each user has its own python directory with site-packages in the home directory. 7 *+#%IBGGMM)49k* UU@UUUVUU@UULib site-packages python%d.%dlibReturns a list containing all global site-packages directories. For each directory present in ``prefixes`` (or the global ``PREFIXES``), this function will find its `site-packages` subdirectory depending on the system environment, and will return a list of full paths. version_info platlibdirsetlibdirlibdirsseen sitepackagesL 5D4   66S=~~&G~~&u%!ww||FF$1C4D4DRa4H$H$35##D) "    '    VUO L M#$ U`U0UUUгU U UV`VhU0UUUUHUUProcessing global site-packagesAdd site-packages to sys.pathsitedirprefixes< ,-"8, 77== ! w ,- UUU@UPUVUU@UUCtrl-D (i.e. EOF)Ctrl-Z plus ReturnDefine new builtins 'quit' and 'exit'. These are objects which make the interpreter exit when called. The repr of each object contains a hint at how it works. quitQuittereofA vv~"!!))&#6HM!))&#6HMغUVUUxUVU`U UxUV'See https://www.python.org/psf/license/LICENSE LICENSE.txt _stdlib_dir Thanks to CWI, CNRI, BeOpen.com, Zope Corporation and a cast of thousands for supporting Python development. See www.python.org for more information.)Set 'copyright' and 'credits' in builtinslicensecurdirpardircredits copyright_Printerheredirsfiles&// S]]KH$--i:TUHb4E 3 t ,D GB +wwr{{+  mY/0 RWW\\$ 2D"))DE$--1 tHUؿUUUpU`V8UUVVUؾUUxU U8UUXU UUUxUhU_Helper!))+HMUUUwrite_history_file*//8Cenablerlcompleter..register_readline..write_historyU  !!`UU.python_history tab: completebind ^I rl_completelibeditregisterread_history_file expanduserget_current_history_lengthOSErrorread_init_fileparse_and_bindhistory write_history readline_doc rlcompleteratexit    xB7  # \(A  # #$9 :  # #O 4   # # %  . . 0A 5 ggll277#5#5c#:#46G **73  OOM *+ 6)       "  ,enablerlcompleter..register_readline @@xU@UUUU5CC!(C0 CC! C-,C-0 C<;C<xU@U0VhU0UUUVU@UU UU`U(UNjEnable default readline configuration on interactive prompts, by registering a sys.__interactivehook__. If the readline module can be imported, the hook will set the Tab key as completion key and register ~/.python_history as history file. This can be overridden in the sitecustomize or usercustomize module, or in a PYTHONSTARTUP file. __interactivehook__register_readline.+`0CU`VU U Nisfileconffile.0. &ww~~h' &venv..UPU+-V Uhomeinclude-system-site-packages pyvenv.cfg__PYVENV_LAUNCHER__darwinlowerstrip partition_homedirname_base_executableplatformenviron system_site virtual_confcandidate_conf conf_basename site_prefixexe_dir **C ||x$9S$@,.JJ7L,MM S)^^ ggoobggooj9:G''//'*KCI M  Wm4 [-8&   N%  , 1Q$;$(NN3$7MCE))+++-C!KKME<<&+kkm $) 2(32 S_  cjj\2 & OOAszz *  |H$  12 1 U VUUUPUUU$ H/AH HHVU`VxU8U VUVUUpU@UUXUU U VU UUUNxU UU9Error in sitecustomize; set PYTHONVERBOSE for traceback: ,Run custom site specific code, if available. sitecustomize8UVU 8U0VV`VU`UU8UxUГV9Error in usercustomize; set PYTHONVERBOSE for traceback: ,Run custom user specific code, if available.exc_infoverboseerr usercustomize/   xx?*  / 99   NNCLLN + JJ  ''. / / ,/UVU) ,'/,/ CA9B;;C U0VV`VU`UUUUГVAdd standard site-specific directories to the module search path. This function is called automatically when this module is imported, unless the python interpreter was started with the -S flag. isolated known_paths orig_path I "KCHH  {#K/1%k2K!+.K IN K 99  UU`VUUUUUUUUUxUhU8UUUpU doesn't existisdirBGGMM$$7&_script..existsVUUU --user-site --user-baseENABLE_USER_SITE: USER_SITE:  ( USER_BASE:  sys.path = [ %s [--user-base] [--user-site] Without arguments print some useful information With arguments print the value of USER_BASE and/or USER_SITE separated by '%s'. Exit codes with --user-base or --user-site: 0 - user site directory is enabled 1 - user site directory is disabled by user 2 - user site directory is disabled by super user or for security reasons >2 - unknown error dedentpathseptextwrapexistsdir user_site user_basehelpi D 88AB>?@   UHUUUUxU`VUUVUVpUUVHUxUU8UUUOUhU0UUUU Append module search paths for third-party packages to sys.path. **************************************************************** * This module is automatically imported during initialization. * **************************************************************** This will append site-specific paths to the module search path. On Unix (including Mac OSX), it starts with sys.prefix and sys.exec_prefix (if different) and appends lib/python/site-packages. On other platforms (such as Windows), it tries each of the prefixes directly, as well as with lib/site-packages appended. The resulting directories, if they exist, are appended to sys.path, and also inspected for path configuration files. If a file named "pyvenv.cfg" exists one directory above sys.executable, sys.prefix and sys.exec_prefix are set to that directory and it is also checked for site-packages (sys.base_prefix and sys.base_exec_prefix will always be the "real" prefixes of the Python installation). If "pyvenv.cfg" (a bootstrap configuration file) contains the key "include-system-site-packages" set to anything other than "false" (case-insensitive), the system-level prefixes will still also be searched for site-packages; otherwise they won't. All of the resulting site-specific directories, if they exist, are appended to sys.path, and also inspected for path configuration files. A path configuration file is a file whose name has the form .pth; its contents are additional directories (one per line) to be added to sys.path. Non-existing directories (or non-directories) are never added to sys.path; no directory is added to sys.path more than once. Blank lines and lines beginning with '#' are skipped. Lines starting with 'import' are executed. For example, suppose sys.prefix and sys.exec_prefix are set to /usr/local and there is a directory /usr/local/lib/python2.5/site-packages with three subdirectories, foo, bar and spam, and two path configuration files, foo.pth and bar.pth. Assume foo.pth contains the following: # foo package configuration foo bar bletch and bar.pth contains: # bar package configuration bar Then the following directories are added to sys.path, in this order: /usr/local/lib/python2.5/site-packages/bar /usr/local/lib/python2.5/site-packages/foo Note that bletch is omitted because it doesn't exist; bar precedes foo because bar.pth comes alphabetically before foo.pth; and spam is omitted because it is not mentioned in either path configuration file. The readline module is also automatically configured to enable completion for systems that support it. This can be overridden in sitecustomize, usercustomize or PYTHONSTARTUP. Starting Python in isolated mode (-I) disables automatic readline configuration. After these operations, an attempt is made to import a module named sitecustomize, which can perform arbitrary additional site-specific customizations. If this import fails with an ImportError exception, it is silently ignored. _scriptno_siteexecusercustomizeexecsitecustomizevenvenablerlcompleter sethelper setcopyrightsetquitaddsitepackagesgetsitepackagesaddusersitepackagesgetusersitepackages getuserbase _get_path _getuserbasecheck_enableusersite addsitedir addpackage_init_pathinforemoveduppaths abs_pathsmakepath_trace USER_BASE USER_SITEENABLE_USER_SITEPREFIXES exec_prefixprefixstat _sitebuiltinsEN   JJ (   ( &.&  ?D4@#0 K " B 7 *,90v4n/(/(> yyF4l z I (`VVUVUUXU UUUpU@UUUU`U(UUUxU@UUUUPUUUUxU8UUUUVXU(UHU NPNNNN0NN0NNNNNNPN0NNNNNNN@NNOPVMReturn the portion of the file's mode that can be set by os.chmod().  &=VVLReturn the portion of the file's mode that describes the file type.  (?VV(Return True if mode is from a directory.X"V("VV<Return True if mode is from a character special device file.X"V!VV8Return True if mode is from a block special device file.X"V!VV+Return True if mode is from a regular file.X"V!VPV0Return True if mode is from a FIFO (named pipe).X"Vh!V V,Return True if mode is from a symbolic link. $<7 ""X"V8!V V%Return True if mode is from a socket. $<8 ##X"V!V V#Return True if mode is from a door. V*Return True if mode is from an event port.H V'Return True if mode is from a whiteout.  V;Convert a file's mode to a string of the form '-rwxrwxrwx'.charbittablepermX D ICczS  D! KK  ! 774=VVPV VV V ` @oConstants/functions for interpreting results of os.stat() and os.lstat(). Suggested usage: from stat import * _statFILE_ATTRIBUTE_VIRTUALFILE_ATTRIBUTE_TEMPORARYFILE_ATTRIBUTE_SYSTEMFILE_ATTRIBUTE_SPARSE_FILEFILE_ATTRIBUTE_REPARSE_POINTFILE_ATTRIBUTE_READONLYFILE_ATTRIBUTE_OFFLINEFILE_ATTRIBUTE_NO_SCRUB_DATA"FILE_ATTRIBUTE_NOT_CONTENT_INDEXEDFILE_ATTRIBUTE_NORMALFILE_ATTRIBUTE_INTEGRITY_STREAMFILE_ATTRIBUTE_HIDDENFILE_ATTRIBUTE_ENCRYPTEDFILE_ATTRIBUTE_DIRECTORYFILE_ATTRIBUTE_DEVICEFILE_ATTRIBUTE_COMPRESSEDFILE_ATTRIBUTE_ARCHIVEfilemode_filemode_table SF_SNAPSHOT SF_NOUNLINK SF_APPEND SF_IMMUTABLE SF_ARCHIVED UF_HIDDEN UF_COMPRESSED UF_NOUNLINK UF_OPAQUE UF_APPEND UF_IMMUTABLE UF_NODUMPS_IXOTHS_IWOTHS_IROTHS_IRWXOS_IXGRPS_IWGRPS_IRGRPS_IRWXGS_IXUSRS_IWUSRS_IRUSRS_IRWXUS_IEXECS_IWRITES_IREADS_ISVTXS_ENFMTS_ISGIDS_ISUIDS_ISWHTS_ISPORTS_ISDOORS_ISSOCKS_ISLNKS_ISFIFOS_ISREGS_ISBLKS_ISCHRS_ISDIRS_IFWHTS_IFPORTS_IFDOORS_IFSOCKS_IFLNKS_IFIFOS_IFREGS_IFBLKS_IFCHRS_IFDIRS_IFMTS_IMODEST_CTIMEST_MTIMEST_ATIMEST_SIZEST_GIDST_UIDST_NLINKST_DEVST_INOST_MODE                     ######$                               ss s s s s s s s gos s ss s gos s ss s gos s s/8    "'%)"%#     DDDU$VX$V($V#V#V#V`#V(#V"V"V"VX"V("V!V!V!Vh!V8!V!V V V` V0 V VVVhV8VVVV`V0VVVVpV8VVVVxVHVVVVVXV(VVVVXV VVVxV@VVVV`V(VVVxV0VVV`V VVVHVVVV8VVVhV(VV0V=`V O O@V VVVVVVP O@ O0 O OOOOOOhO`V@V VVVVVV`V0O@VBReturn the hash of *source_bytes* as used in hash-based pyc files. source_bytes   -| <<h-VhdVdVeV,V% (required for relative module names)no package specified for 2Resolve a relative module name to an absolute one.repr characterw ??3  5d4j\BAAB B E      efw 66;V/VȋV0Vp/VfV/V.Vx.VReturn the spec for the specified module. First, sys.modules is checked to see if the module was already imported. If so, then sys.modules[name].__spec__ is returned. If that happens to be set to None, then ValueError is raised. If the module is not in sys.modules, then sys.meta_path is searched for a suitable spec with the value of 'path' given to the finders. None is returned if no spec could be found. Dotted names do not have their parent packages implicitly imported. You will most likely need to explicitly import all parent packages in the proper order for a submodule to get the correct spec.  3;;$%%T" > ??D| D6):!;<<K  Fv%9:; E FV AA-`VfVVVh1V(6V5V.__spec__ is not set.__spec__ is None while trying to find __path__ attribute not found on Return the spec for the specified module. First, sys.modules is checked to see if the module was already imported. If so, then sys.modules[name].__spec__ is returned. If that happens to be set to None, then ValueError is raised. If the module is not in sys.modules, then sys.meta_path is searched for a suitable spec with the value of 'path' given to the finders. None is returned if no spec could be found. If the name is for submodule (contains a dot), the parent module is automatically imported. The name and package arguments work the same as importlib.import_module(). In other words, relative module names (with leading dots) work. ModuleNotFoundError parent_path parent_namefullnamepackage"/3ooc.B|D'*Hs{{"))#.q1  zlCF P$oo K(K00X& > ??D| D6):!;<<K%" P)6{oF,,4<9?GINOP P Fv%9:; E F ;V:V:Vp:VV$ B' C ' C 0CC  C% ȋVcV`VVV0:VfVV X7V87V6V6Vx6V(6V5Vbool!-04_incompatible_extension_module_restrictions.__init__8BVP>V8BV?? N 5_incompatible_extension_module_restrictions.__enter__hdVh@VIV@V'_override_multi_interp_extensions_checkoldhh H 44S94_incompatible_extension_module_restrictions.__exit__ @V@VhdVh@V disable_check''r.Q.4_incompatible_extension_module_restrictions.override8BVgA context manager that can temporarily skip the compatibility check. NOTE: This function is meant to accommodate an unusual case; one which is likely to eventually go away. There's is a pretty good chance this is not what you were looking for. WARNING: Using this function to disable the check can lead to unexpected behavior and even crashes. It should only be used during extension module development. If "disable_check" is True then the compatibility check will not happen while the context manager is active. Otherwise the check *will* happen. Normally, extensions that do not support multiple interpreters may not be imported in a subinterpreter. That implies modules that do not implement multi-phase init or that explicitly of out. Likewise for modules import in a subinterpeter with its own GIL when the extension does not support a per-interpreter GIL. This implies the module does not have a Py_mod_multiple_interpreters slot set to Py_MOD_PER_INTERPRETER_GIL_SUPPORTED. In both cases, this context manager may be used to temporarily disable the check for compatible extension modules. You can get the same effect as this function by implementing the basic interface of multi-phase init (PEP 489) and lying about support for multiple interpreters (or per-interpreter GIL). overrideproperty*>1: // @IVIV0cVxCV@O0 O@!OP"O. substituted in sys.modules during a lazy loadmodule object for 8Trigger the load of the module and return the attribute. attrs_updated attrs_now attrs_then original_name**4<,, & !&&t[9[H  -!224>" !.2 \*!224D !) **5 $ " "+//"3JC*,-2 c*IcN+r*S//BB-2 c* #4++D1!CKK/$x2ckk-&@#AA(+=m=NO1*122  .!&!1!1W"ZtT""[" !_LazyModule.__getattribute__ PV [VHLVLVKVKV8E=*A-E=BE==F [VbVV]V`VVV8dVPV 8KVxZV@ZVJVJV/Trigger the load and then perform the deletion.delattrattr d#d_LazyModule.__delattr__PVPVXPVKA subclass of the module type which triggers loading upon attribute access.U1#fbV8RV@$O (O loader must define exec_module()v}->? ?.LazyLoader.__check_eager_loader__check_eager_loaderVVV]VSVkwargss64+B6+B'C$LazyLoader.factory.. PUVVVV>Construct a callable which returns the eager loader made lazy.cls   (CCLazyLoader.factory``VVV^VxVV+O !!&) LazyLoader.__init__V^VV{{((..LazyLoader.create_moduleVV ^V is_loadinglockMake the module load lazily.RLock loader_state !% KK  #)??#7#7#9 Z $*$4$4 [!(0 V%* \"'3$&LazyLoader.exec_module [V VZV [VbVZVxZV@ZVKA loader that creates a module which defers loading until attribute access. exec_module create_module classmethod_LazyLoader__check_eager_loader staticmethod>U@@DD /' ^V^VX^V ^V]VbVp]V*O+O,O-O.OdVdVeVPeVeVeVfV@fVfVfVfV-Utility code for constructing importers, etc. LazyLoader _LazyModule+_incompatible_extension_module_restrictions_find_spec_from_path resolve_name source_hashtypes_impspec_from_file_locationsource_from_cache decode_sourcecache_from_source_RAW_MAGIC_NUMBER MAGIC_NUMBER _find_specspec_from_loader _resolve_namemodule_from_specLoader_abcq3(%("-22.28 = 7>*b././b<%""<~''''(gVfVfVfV@fVfVqVeVeVPeVeVdVdVhdV`V8dVdVcVcVV0cVPVbVbVhbVHbVbVaVaVaVXaV(aV`V`V`Vh`VOOOO@#O0cV )ObV0ObVPVAReturns a list of all recognized module suffixes for this process . .1C CCpVpVoV(jVnVPnVnVnVoVHoVoVpVpV@pVpVoV@qVxqVqV9The machinery of importlib: finders, loaders, hooks, etc. all_suffixesNamespaceLoaderExtensionFileLoaderSourcelessFileLoaderSourceFileLoader FileFinder PathFinderWindowsRegistryFinderEXTENSION_SUFFIXESBYTECODE_SUFFIXESOPTIMIZED_BYTECODE_SUFFIXESDEBUG_BYTECODE_SUFFIXESSOURCE_SUFFIXES_bootstrap_externalFrozenImporterBuiltinImporter ModuleSpec8?"'&))7++1540DqVxqV@qVqVpVpV@pVpVoVoVHoVoVnVnVPnVnVmVxmVXmV(mVlVlVxlVHlVlVkVkVkVXkV3O   * _TempModule.__init__VPVvVKeyErrorZ==     % %ckk(&; <!%  H    _TempModule.__enter__V,A A%$A%VvV`VtV _saved_moduleL   )-););A)>CKK &  DMM*_TempModule.__exit__vV`VVCTemporarily replace a module in sys.modules with an empty namespaceM  VwV 6O 7O8O -3X5DN_ModifiedArgv0.__init__(|V`|VAlready preserving saved value RuntimeErrorA   DNN 2?@ @HHQKjj _ModifiedArgv0.__enter__(|V`|VxzV`V0zV _saved_value _sentinel ^^ '' _ModifiedArgv0.__exit__ `|V(|V`V6! (V0;O0X0Execute code located at the specified filesystem location. path_name -- filesystem location of a Python script, zipfile, or directory containing a top level __main__.py script. Optional arguments: init_globals -- dictionary used to pre-populate the module s globals dictionary before the code is executed. run_name -- if not None, this will be used to set __name__; otherwise, '<run_path>' will be used for __name__. Returns the resulting module globals dictionary. ValueErrorremoveinsertfsdecodepkgutil rpartition mod_globals temp_modulemod_specmod_nameimporter get_importerpkg_namerun_name init_globals path_name{""3'*H$I&H I&I(DJ'#9-lH)1yJ J 9% (@'A $HhX&+ *)0099  {L$,hBBF$&+*'&   *  +**'&&   *    *   VVxV@VVЯVV`V(VV E:& D>24D(& D>/ E:9D D%$D%(D1 -D>5 E:>EE: E++ E76E7:F+<FF+ F(%F+'F((F+VVVVPVVhV`V VȸVVVVVVXV VVȨV!No module specified for executionZrunpy.py - locating and running Python code using the module namespace Provides support for locating and running Python scripts using the Python module namespace instead of the native filesystem. This allows Python code to play nicely with non-filesystem based PEP 302 importers when locating support scripts as well as when importing modules. run_path_get_code_from_file_get_main_module_details run_module_run_module_as_main_Error Exception_get_module_details ImportError_run_module_code _run_code_ModifiedArgv0 _TempModule ModuleTypeosioimportlib.utilimportlib.machinerysys  *  #Y  & . (V ( /3&*)-4)-,0/3 )4; zMYM+8'+(-E<$/,& 0f z 388}q 1 C HHQKCHHQK( `V VVVVPVVVVhV0VVVVHVVȸVVPVVȶVVPV@:OV>OV?O`AOPCOHOVIOKOLONOQOxVXVVصVV`VHVp0V0Vx0VVTestFrozenUtf8_4TestFrozenUtf8_2TestFrozenUtf8_1A  zFVHVVVV `WOHV0XOVYOVYO[O  .mainVXV#  zFVV@_O Hello world!print initialized nVVXV884`T.2Gt3S.@PFXHFXA:B884TT.2xGԚ3S.@FXHFXAd:B,8P842G43S.@ GXA:BW/0D1\M 1814 v,B2@t,:E8p8G@,3v,@@VH PXIVAo,J4H24:G3S.CH8QXW/4%(B@]X/A4'H`]XG0(P..,`8 1`8/,08X'08 1@8 1p(-@8[0 8 1##8 181R.81pR.8 1818/P,8.p,@8Є1,8X=0$p8p 1`-8`18p1`81R.@81R.8 1814:88G>?/AJ40:88G>?Y/AJ4:8p8G>?8[@0iXA|J4:G<>?h'@iXAJ44:88G@3`@iXA%J4L(8p8G3'>?p$@`jXHjXAH!J4В:88GL>?l@jXA$ J4̒:808GȒ>?%@@kXA$J4h:88GD>?%@kXAJ4 :8p8GH>?h@lXAd J4,:8@8G>?t%@`lXAJ1`80o818 1814:8p8G$>? @VAJ4$,:8`8G(>? ,@lXA,J4:8@8G>?8@ mXA(J4:88G >?X:@mXA,&J4 ,:8@8G$>?,@ nXA$,J44:88G>?@nXAJ4(:8p8GD>? @oXAJ4Đ:8@8GH>?#@@oXAJ4+Bn:88G`+>?@oXA@\+J4dB(:88GL>?P@oXAطJ4:88G>?X@ pXA|J4y8%9G38>?hZ@XHxXI(X<A[W//h1`f91hPf91 f91e91e9`0 e91X`e9 1(e9/d9x/`d9/(G0d901Fd90pg981dc9@1c9P1XPc9X1Hb91xb9 1814+BP;:8f9G@+3+C >tIX<`e+/Ad+J@VHX-d"(8.P,E')G*+4x:G3>? E@0XA4x:G3>?pD@0XAp1-g91̒g91̒g90Ѕpg9 1814p-B0[:8h9G,3@VHX<,/J!10,9"1 9"1,9"1I`9F/9P1~9("14`9 1814-P@->?,@HX C1( @Q:${XX(X`h/:.:1: 181 181\1T#\10:@p|XWX?TW/40":EG"3@T.HX@XI`W<HK/AJ 181a1@\8XXX0 hz@pR ؄\a1@\8XXX0 hz@pR ؄\pXa1@0%82T)LpR68W X&`&P ")Pe1 PG(@$e-X@/@P"XXWX 24 @ <F(pX(8@<@(X$A,4+./JG,3-.BlH`XIX8`<@XA 4/JGQ.34T.B HXC78<@8XAh4/JGQ.34T.BHXC78<HX@XIxX$A4+/JG3B8 <H X@XAI> B]4*/JG38`<@X4/JGQ.i1 ȮX@Q..(4*{XXS 'L< T*pXX@X`X$$``$Xj1@hk0pj1@hk0/Hhk0h/Hhk0j1X,D\j1j1x,Pj1k1:,]k1Xk1%.D\`k1Xj1,,k1pj1,hk0/,D,k1h/,, l1`l1#[hl1l1#[l1l1#-l1m1#[m1@m1#[Hm1xm1#[m1m1,D\m1m14K<n10n1p=,T^8n1n1JOn1n1Jt[o1p/(` p'Po1h/8'o1(p1/[hk00p1HHTC@p1p1P@tp1@q14.D\Pq1q1d-D\q1r1,D\r1`r1"dT.hr1r1"\r1r1$dT.r1s1$\(s1`s1&dT.hs1s1&\s1s1*dT.s1t1*\(t1`t1,dT.pt1t1,\t1u1.Pu1Pu1.HP`u1u1 SD\u1u1RD\u1u1PRD\v1 v1/]0v1`v1QD\pv1v10dT.v1v10\v1 w1 2dT.0w1hw1 2\xw1w1(`>,dT.w1w1(`>,\w10x104dT.8x1hx104\xx1x18p7,dT.x1x18p7,\x1 y1@Ц-D\(y1Hy1PQD\Xy1y1XP,y1y1`@P,y1z1hO, z1Xz1pN,hz1z1xNPz1z1$N,z10{1M,@{1x{1LM,{1{1L,{1|1tL,|1H|16dT.X|1|16\|1|1-dT.|1 }1-\0}1h}1L,x}1}1K,}1}1QD\~1~1(dT.~1~1(\~11hO, 1X1,`11*,11 ++1 1 +\01X1,`1`r1,hr1`s1{hs1s1{s110I,z11 S{1 1 Sz01h10 *T]x1y18,1z1@{1 .(t$xd$D@< ]X`$P]00QxzP<.T?< 181h1+H<1:p<1,G<1A<1 4P<1)<(1P-<0`<10<81h9<p1>P< 181x1 <10&@p[*!Y.,!t- Y@YD@<`Yp)`)&JW?6`&Ȓ.,!t-Y@Y(D@<`Yp)`)&`MW;$1(4)hY1(P+Y.0)|`YYY <=)XYY)1XWT Y Y4c(1LW- Y!`[)cX1`%,D<'%0T.7` Y YT[&$@//8p*\@p D<&%*(@Y Y Y''1h1@Ѓ184~0)@ HJt,(YpYYx.L)XpYXYPsHY @p<4) <YY)1pZ)@T)xW/1DWY1 WXY1VY1p+̡YYD <P8$ih`WY`jW`(1@p@$Q[Yh1p,H<1$Hp<1@<h/&</+</R&0<1l<X/D)@<X/%<.0p)<.P%< /@, <1P-<1 -<@1U< 181I@`1d%`Y@t-) YYp1d%PvWY@t-"D% YY1d%PvWY@t-"P)pYY18 b&@+@ +Y18 b&@+Pw,Y18 b&@+%Y؅18 b&@+Y18 b&@+Y18 b&@+Y@/06F#YvWY@D@ <L(4. +sW+4P++. !=!XY@< xYY@(1&H`1@1D)<1~<1@`<1 <1`&<x/`,<1!0</0"(<814'0</<`0HP<P1- <1D ,< 181p/(`-YY D@0<5@& 'p'W'+1 )@Q.[* Y1  '@`F,!0 Y؉1 0#@Q.@)#!Y(40 O,@O`H,0!Y1~p"Y=܇~`?/H(!/ ,XC0  `/S%*W//S%`%PB0S%%B0**(1)W/(1)W/. * D=&%S.$YWd&]%. P*Dp=%%a+$YWJ&=%.@,H=^`#YW Xt 870xĬ @Pq4P'Y'Yp%YH)0P(*Y+@=((Yp(Yfxe1H,Y+Y 16=1T=؏1`6=10p= 181661 !.Y8@-@!H.Y`-Y1<@Q.1(`W@8M7@3Y(1@@1M6X1Yx1(W@MC3Y1 !@W@pW2Y1Y1 !81Y$@-0YH0Y/Y 1@`)8Xp6YX6Y,{,LP=4,`,(5Y4Y4Y`W/hW/TH)81* H1|HX1p1H1 181P0 [0X0(1H0k'LXD@(1G7Y7YW4!p0= 181.8Y+D`=,"гW4U+. ,D`=|G,(Y0)h/`,`1X/4+1.01X/|)11X1 181@1$x118d(@QPYحY8Y'ؤ10@QحYY! %10(@QPYحYHYn%184@QحYY@$ 1804HQPYحYYpؒ.@:%D= (S.YYY@;&9&2%81)xY(YYt\@@-08й,W,H1 ''@4a+FЯYYY. hYiP=ȳYPYf1$l @p>" =+YYY*P10 (|8H"=D(& YYYXKx40S.(|@P"= Q.%YYJL40"@"='% "88`YXM10P'#=1 T"@E"Y.!-YxY`Y5"PY@ ==("Yt-t"t-1 )@DY.8)0pYWXY\HY@]=4)hYP)p.<p-Ym=xQ&P10&0*0&0h10/000''0/0P&H/ & 0@ 'x<04x<0@R.Y1Y1Y1g1D%Wpg1@A0!WXg1AP$W@g1(A#W(g1A"Wg1A"WP1<xYxe1@0X1='Y P\10:XБ.u:XxK1R:X 2Y1@`K1u:XPK10u:hX@K1`R:XZ1X@.:Xh/'i10OWC1R:XXP1[`1W/,(1P1[`1W/,(1KKPYY`YYY`Y0Y1X.P..`Cؒ.W.:XpX/H1` 18 `XbX(0** 1(A\X 10EV 1 @_X 1@E_Xh 18``X8B1:XpX1 1VXUXqpC8-/WPC@//p_W C81/W/Z9XX0 (*p*1(EvX1AX1 E0Xh1uXx1h}X1X1@ExV1EX1EX10EX1ExX`10EX01EsX1E{XB10:pX@Xx.<:hXȬX`](t*p*`.1 p.1.1 .1.1.1.1.1.1.1/1 /1 (/1 8/1H/1`/1x/1/1/1/1+1+1+1+1+1,1,1(,18,1H,1`,1h,1L,1M,1N,1O,1P-1Q(-1RH-1Sh-1T-1U-1V-1W-1X.1Y .1Z@.1[/1_/1//1001`011 0120014@013P01a`01.p0101010101 01W01V01$11%11&(11'@11-X11eh11fx11g111111(1111)11*2121E021FH21hX21ih21<x2121+21G21j2121l212131 31831H31X31h31wx31x31y31z31{31|31S31T31m4141(41841XH41UX415`418p41>41=41941@41?41A41741651:51 51 851 P51,`51p5151o51p51;5151 51!5161q 61r061"@61nP61`61x61C61M61N61I61J71O 71P871QP71Rp71D71K71L71 71#71H7181B81s 81t081<@81uP81v`81p81k81}81~818181\81]9191091P91^`91[p91Y91Z91b91c91d91=/9X=/9X =/9PX >/9ЪXH+1 9PX0+1x V +1HXh>/9X+19pXC?/0WC0@/WC.W@D08XXWX[)d**@1X1WX @.\1]1ؾ.`]1|p]1.]1]1 /@^1`^1/^1_1_1_18_1..h//CF/W(0.///@C"1hWC0'1V`C@/WC.WCM/8V C8/hVpCO/xVC1VpCx.(fWPCP.HW a1DW1X0K/@9 X`X)p**19X108TXTX)**10@ TX1PM.PC /8V C(1V0Pl8@DXDX@C.PW@.pC&1`VC80W C(0W@C8/VC.HVC"1V@1@1@1@1 @118pXpXp*+@+18EV1 E@Vx1 EV`18EVH1 EpV81(EV18EV10EV1(EV1 EV1HEV1 A V18EVp1 EVX1@E0V@10EPV(1 E`V1 EpV1(E0V10A@V1AV18EV0`8GX`GX`*t++1(IV10IV0(APV1j9(XPX*P+D+1 E@Vh18EVH18AV 18A`V1 ApXh1@8 SXSX_++p+(1@MV1ARX1 AV18QX C I1W C`0hVC0#1(VC[0W C"10WC/WC1W1(hXiX ,P-`-1`AcX1XAfX1A`gX1(AgXPC81WCP.V`CP.V@1P.P1X1`C81W B1@XC`1(W(B1`X,`--a1@WCh1VH18VXVXC@/%WCH1V/Pd1XpK C/8VC('1(VC!1V`C.WC /fWC 1VCb1WC 1xVA1A:XPK1`9``XPCp 1V`<0P8NXPNX-(.D(.0C1(GWCb1XWH 1FC.8W/x0CXCX`1P9X0 /=:XXK./M:XXX0pd8BXpCXL.N.N.`0c8pBXH1C1C1P]0.hk0.P]01 C1V@C`1`VC[0@V@C 1xV@C1VCx1HVC`1VC(1VCX1V0C(0V`C1HVC >/ V C'1VC`&1VCP&1(VC@&1XVC0&1VC &1VC&1VC&1V C@%1PV0C #1VCxR0WCK1pWC(J1W0CH1W@CG10WPCS0`WCP/WCb1(WC8S0'WCe1'WPCg1@&W@Cg1&WCx1XfWC``1fW`C /kWC.W0C.WCئ1WC``1 WCb1XWCb1WC81PWC``1`WCb1WCb1WC@10V`C01VCA1XWCA1(WC(Y0('WCpf1X'WCpf1&WCe1&W0Ce1%W`C[0p&W C%1HV0C%1xV@C%1VCp%1Vhk0 1C"1VC"1xVCH#1VC`#1V`+1CVCX%1V0Cph0V+1pCV`CX'1PVPC`'1 V0Cp'1VC'1VC'1PVCȄ1jWC1jW C/(kWC1V@C81PV@18/p@1`,08/p@1@ 1H/8/x^08/p@1CP"1WCX"1XWC"10VpC"1VC`%1VC8'1VC$1hVp+1C0V@C/`kWpC(0VC80VC08WC80gWC(0WCH'1VCH 1VCF/VC"1VC&1VC&1VPC8&0VCh"1WPCH"1hWC0XVC0V CH0VPCp0 VpC%1VC%1XVC#1VC"1V@Cx0VpC81(VC#1`VC"1V@C(/VPC"1W C0 W`C8"1WC`"1WCX0WCb1WC[0WCb1(WC[0WC.0W0Cx<0WC00W`C 1VC(#1hVC@0V`CP0V01C`1XW0Cp10VC 1VCX'0V CCC0000000000000(080 `g80f8H0H f8(6'0sh8)0ȁl80pk80`k80D+k80j80+pj80h0j80di80`i80 `i80i80Ċh80(~h8P.(0[ 8P. 0xp 80 8p*0PT8@Q0080Q0~88Q0$~88/`~80/( ~8/d}8'0}8X'0Ч}8'0 `}8'0(0}8'0|}8'0Щ|8Z/$|80Xp|80L@|80Z.|80{80T{8'0{8P'0|P{80S {8'0Xz8H'0(z8@'0z8('0`z8&00z88'04z8&0xy8&0y8'0H`y8 '00y8&0Ty8&0x8&0x8&0px8(0@x8N0(w88N0`w80pw8HO00w8O0w8P/x v8H/ v805pv8i1h5@v8@15v8.4u80`4u8 (/4u8(0s88P0pr8F0 r8-0A8018P$0d08e08@1p?P8x0@8h0>8X0@= 8H0(<8@0`800:8P1@8`X/x1hW/1X/ 1(.0@.(P.8H1P14`+.@.(.x1081801R.1R.4P-2,8p8G@E,3-@ RXHQXI V6 KA4,L0`81 p8d+88A)4T*G)3*r)x1~ 81s)81 81(81@8ȃ/)8h0lcp8 /D)80}&1X 8H,/'81 @8(0<p8,@18P1X1p1x111111111 1(1P1X1x111111`k(@D0-81<8 1H`80108H1(8X1xP8p18181<81A81TBp8d0l 81 8181P 81081880 >81>P8081@80H 8180=p8 1$> 801X_Ж8(. 1g+8 1g+8 1k+8( 1k+80 1+088/+08@ 1g+8P 1k+8` 1@4&(B8`8@[XG(H`[X(.( 1P' 8( 1'p8p 1p08 1p8 1t8 1<@8@ 1P' 8P 1'p8` 1H@(.478 1H^X(.(4D7:E8 1G-.3N.AH_X 1 1 1 10 1@ 1B0X 1A0l8` 1l8p 108 1'8 1'8 1 ;08x^0 ;08 1t8 1'8 1@l+08/d8 18 1f+л8 1 p8 18 n& 1 1(/0 1T/8P 1p 1x 1(.@4-,Bp;88C"@ VH0cXIbXG0q,3P., 1 1(181h10p1.(100118143,BV808@VHHeXIdXG304,@W(/P.Ԣ8/,#84.#@gXHfXG3/#4GP3P.#,8808x181P,`81P,081,81D-8 ,0p81Ht8080tq8(. 1$@80p81,s8081(r80p81u804p81pu8081{80o80~81pz8180~81(y8180}81w8180L|81u818081m80o80Do80n8180Tn80pm81l8*P0"8/A1ؘ1@(.@.ph0 81@58h'1,38/(81`88&0p8/pP8x'181Ap81A 81A8 1O1W4(88G3?e@rXHqXIpX<PAh"0PR.@81`R.8]14R.p8x0C8h'18/P8x'1LC888@uXIxtX1(08x1 -81`81@m@84,88@HvXIuXGp-3,<д,/\/"1lB]1B1Lx"0(1 1X1Y1`(.@.x0Pl`91n9x'1p"`9h'10-@9/,91i*9ph0*90`-91hi91hp91gP914g09/91898&0$j9004d*B̘89G )3*? #@yXHXxXIhwX<)x04C9h'1`9Ȼ/ 9ؕ/P` 9]0D0 9x'10 989@|X/|"// 11((.@.x0s91(9ph0 (91)`91)@90 -91(s910*9h'1@(9j0$w09Ȼ/,9ؕ/l}9]0`|9/P9/,*`91t)@98&0t919004)B89G)3p)?@XH8~XI}X<(/|"// 11((.@.ph0 (9x0s91)`91) 90 -91(s910*9x'1+98&0t91Pk*9/,*`91t)@919004)B809G)3p)@XHXIPX<0)/ؙ(.(@. h'1j0Ȼ/ؕ/]0xx'1\1@1$1ph0,14()809Gt3@ XHXIXX</|"// 11((.@.ph0 (9x0s91)`91)@91) 90 -91(s910*91Pk*9/,*`91t)@98&0t9h'1@(9Ȼ/,9ؕ/l}9]0`|9/P9j0$w09x'1+919004)B89G)3p)?@XHЉXI0X</H1(.0@.(1$91p$91 $9ph0@#91#91ܾP#91#9x'18"9h1\!9Ȼ/X!9ؕ/` 9/Z`9H/8]P9h'1Y9x1>09149/D98&049 1xP1Y14G\/|"111/(1H1 1(. @.(h'1,9X1(,9ؕ/7*+9x'1P_**9/2*(91$(`(98&0p'9ph0)&91D)&91(P&91 )&90Դ-%91(p%91p*004(Bh8-9GD)3(@hXHXIX<(AP((.@./891\@898&07914)79ph0)691h591t)p591)59x1 D181x10Cp491C49@ 10(P 1(/29H/ 19h10#0194(98:9G3DT.>,?x~@XH8XIVP0(h'1$?9X18?9ؕ/`=x'1D;8@9@X(8/(B90,A9M/( @90--(.`1h110g90pg9101W/04+B|G``+3p+@0XHX6,70DAX+h^0j90*1g)Pz91y90s y980q`w9(0pu90\m`u90`k u90t9/,t9h0it90@t90Pt90(s90s9X0g@s9@0er9(0\cr90`@r90r90Xq9 0q90^@q90\p9к0Zp90(X@p90Vp90\To9`0Rpo9@0P o900On9 0TMn90Kpn90 J0n90LHm90hFm9<0hpm9ȹ0D0m90Pk9/f) k9191l91918p9. ~9.P~91}9 1d|981@|9P1{9p1111111111(181P1X1l)/h;9p1P9(b09x1,9>0@9191lЋ91Ժ919e091p9e0(9r09r0d 91`9191`9c0@919>/81H1P1X1`1h1x11111111181X11h11x1@111111181H1h1x11111111111 1(18111p1(11@1H1`1p1( 11.111 1 10 18 1H 1P 1` 1p 1 1 1 1 1 1 1؊1(!1/X!1/!14-B@VHX@ 1,P 1-ph0V.d'(F/(9:8"1 5:@"14:H"13:0.:P"10-:X0':X"1P':`"1 p&:h"1x0&:p"1%:x"1p*p%:"1%:"1P`":"1(:"1+:"1t* :"1:"18`:"1d:P0l`:@0j:"10:"1p:"1 :(/P :.b*` :"1 :#1:H 10:#1:#1+:#1:818@:x0` 9109 #1980|9(#1TG98090#1Tl+`9H#19`#19x#149#1 9#19#1l&9#1%9#19#14'9$109 $1 9($1 9x098$1)*09@$1'*9H$1)*90t9P$1@9`$1 P9h$19p$1@9x$1'*9$19r0$9$1#09$1!9$1D"9e0"@9$1#9$1l$9f0%P9$1D90į9$1%9$1&@9c09$19$1`9$1)9$1"9$159%1\9%1 )p9%1d" 9 %1T)90%1!@98/p\*9ph04p909@%109P%19X%1)9(f0+p9Hf0 -`9h'1d.9 s0`9Ps0`P9Xs0t9x'1 @9s0p9s0P`9s0`9`%19p%1 @919x%1/9%11 9%19%19%1P9%1t9$0l9t098&09t09 t0 9049%1t9%1?09%19%1P9%1<9%149%1p@9&1p9&19 &1,90&1L 9@&1л9P&1`9`&19p&19&1Pp9&19&1"9Pf01 9&19&1L09&1)е9&1д9&10`9`f029pf039&19&1\9p0 9H0890$ 90,p9/-`9&1tP9'19c0L9'19Pd0 9('1,90'1 (Ф98'19H'1@9X'1X6У9`'179p'18P9'1@9'199'1;95( /D918:1@:1x:1:1:1:1;1،;1<1<11=11|J=1X>1xh>1>1>1(?1@?1?1$?1?18?1@18 @11 ?:@1?:1#>:@1LP>:A10>:,5( /L:8:1L: A1T L:0A1PqJ:@A1I:PA1PI:`A1H:pA1xpH:A11@G:A12F:A1$E:A1 E:A1|D:A1PD:A1C:A1B:A1 B:B1`A:=0z@=0=0=0 //0C1/XC1.xC1C1C1C1C1D1 D1PD1XD1/D1/D1E1E1HE1XE1E1E1E1E1F1F1/0F1/8F1/8F1@F1PF18&/`F1hF1xF1F1F1F1F1P/F1/F1X/F1F1F18/F1X/F1<0F1/G1h/ G1/(G1%1@G1%1XG1pG1xG1G1G1G1G1G1t:H1,t:.0t:H1s: H18Q0s:0H1hpr:X.r:.S q:HH1H@p:x.t o:x^0`n:XH1':?/@:0`1\r:8`10#:`E/@7,@:H`1,:P.):`/+: &/)`:(/-:U/+:81/p(`:pr0d:.1 :P`1):.f%P:X`1,:``1Pr:0\*`:P0:.&к:/@ ,:X/@):h`1<P:p`1"(:x`1-:G/Tq":G/",`:/":40G:`1Dr :`0,:P/tа:/+@:[0#:`1,:.Tn%: / ,:`1x,Ъ:HL1O&0:,0|J@.`a,{&x<0P:00:(a1&.:a1a1|@1t tpcdefh$i` j\,kPltmnocpr(sLtpuv xDyhz{|}~@ b1 b1Hb18*/hn<80 * <.'<[0o+0<b1-0<b1a"@<b1-<b1-@<b1-p<0&Б<`0<b1PP<(/P*`<?0+</Ќ<0$ <1Ћ+Ћ</$- <XH/(0<0 <0#p<I/D(<?0<& <b1p-P</0,<b1-0<81,<Y/Й,0<x./' <(J/(<@/@&.0<0*0~<c1i)p}<c1@F|<c1&.{< c1Ez<(c14Ay<0c1By<@c1-0x<Hc1tC`w<Xc1Qv<`c1dh)u<hc1+t<xc1@Dt<c1!s<pr0-r<c1h0r<.Toq<`/Ь-`o<1ho<c1<P f"*1H0<0@<1xtО<c1pWc1c18qd1e1le1/e18e19e1:e1І<0]<f1Zf1Zf1f1ZhW/ f1Hf1Pf1e1p<pf1L0<0]<f1`Z/e1e1 e1!e1"e1<pf1<0]<f14Z/b1 B0̬f10W/P/0]@< * 1P,<f1,f1/4),PB0p)  g0})Dg1)0W/))g1 ~)~)W/z)W/)-g1X`/)LGB0,2D h1 h1( h1 0h1Hh1@. Xh1 s)p</) <`h1/%ph1h1T<,к<h1 ,</_0<1,<*H." h108@<0< 1<i1)<f1$<.$,<1@</]< i10i1Pi1`i1i1 i1g(A&g(G(-C& &14i-<0`<1t0<00..Y/ 1<0<1p<0T`<xF +9P,B@8*!'(xF +9P,W..Y/ @1<0@`0$</#@<v,v$%X1l0<0P<1p<1X[0<0<1t<1?<( 1p<bT[Ȃ1h+Y@14[`YPW0HW/0`<`/W//)p1W/@-/Х-PB0-Pi1Vg1X0W/ 0,H1e<1`<1|h <x/-<pr0h<1t <1<<1P< 1<01h<@1g<P1dgP<( 1f<80`<``1 `<`1d-< /-<h1d>`<x1 <@ 1eP 1fT)PY)-)(7-( / <1<0p</X</|Z<1X <X/<.0<X/<.<1<1<@1hWp<Ȅ1PV<DVh(0P<@1(W@1V@1V,$ $r@o+1})<0<1`<@1U<, .1`<@1U0<,1/J81@1`U<,01T81E1P`11T1І1P11T(1X1t,<h14P<?/I(<0@/O(<x1T<1T1ȇ1T؇11T1p)0d<c1X<.Q#<1P<81O<(`&w"D-$4+d&-$-  '9!- x";,"-@)-H1X1p111Ј11 1m'&t)m'+",&'"PO,81p%.@<0<1w<1$@<0<1v<1 n,<0<1xw<0$<h0pb@=xh0`b`=ph0Pb =dd1HW/P10W/h /@1P1@1P1h1DIp1T1 _1dO11N1OC0 14OЊ1,18=1p=G/111`1p1G/111@1P111110181111101п81E1`11Կ@=1P=ȇ1D=1Xp=p)0 =x1R` =G0ԃ =``1p =818 =c1x =`0  =. =ؿM((/Q.1"0ا1/`(1ph0Q.hk01Q.hk00<hk01hk0x'1hk0/LХ(1PB0Ll@1`1Mp11LH08I1C0Xh0C=xh0==ph0`O'=10p=6/LХ1PB0Ll؎11M101H0,IC0L@1LP18h0C=xh0=0=ph0`O'=10p=hI6h07=xh0@0=ph07=/LХ`1PB0Ll11M1H0 IC0@1Hȏ1Bh06=xh0 @=ph0M=h0@=xh0>=ph0=0b1,1ؐ1hLf1Hb110f1Ph1h1l08/*1@0|R1}10=1|=0W0Y}.Hȑ1YY1H1PY@a1H11P1YY/H1/P01/X@1/`P104QYPTY0Ht1Hp1%1P1~/X11`Ȓ10=1Ƞ\=0 @_=0t `\=1~\=1[=b1xe=0@NZ=1Z=1Z=`0 j=(0pX=(J/l=b1W=1`P*W=(/O,f=G07@V=``1d@T=/g=x/`S=`c1E`=Xc1DP`=c1Dpa=@c1Da=c1`b=(c1D_= c1\c=c1|b=b1R=0LQR=1pd=/dpQ=`/W.`P=?0N=/_M=810M=.DK=@/K=0lI=P1CI=XH/h=0i=0OI=?00G=b1R@E=I/D=[0XC=b10B=x./`k=/A=b1Pf=b10e=81O,0@=Y/Hd=c1PM?=pa*b*t"$T,I,ԥ1_=0<@_=1Hx_=:;D;ا11 1y1p(/_11 1}/X 1 (1=01P.81`.[h1`@1H1gP1X100Zh.Y8.\8.`1h1pH/?p1Ex1018/.>1FT(0*)(T:~ T:~ rT(0*)(mT:~ oT:~ P$@*           !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~    }}{{%% .defaults . .generic_base json.decoder .kwdefaultslist index out of range .type_paramsutf-8 CANCELLEDFINISHEDFalseJSONDecodeErrorPENDINGPy_Repr TextIOWrapperTrueWarningMessage_WindowsConsoleIO__IOBase_closed__abc_tpflags____abs____abstractmethods____add__ __aenter__ __aexit__ __aiter____all____and__ __anext____annotations____args____asyncio_running_event_loop__ __await__ __bases____bool__ __buffer____build_class__ __builtins__ __bytes____call__ __cantrace__ __class____class_getitem__ __classcell__ __classdict____classdictcell__ __complex__ __contains____copy____ctypes_from_outparam____del__ __delattr__ __delete__ __delitem____dict____dictoffset____dir__ __divmod____doc__ __enter____eq____exit____file__ __float__ __floordiv__ __format__ __fspath____ge____get__ __getattr____getattribute____getinitargs__ __getitem____getnewargs____getnewargs_ex__ __getstate____gt____hash____iadd____iand__ __ifloordiv__ __ilshift__ __imatmul____imod__ __import____imul__ __index____init____init_subclass____instancecheck____int__ __invert____ior____ipow__ __irshift____isabstractmethod____isub____iter__ __itruediv____ixor____le____len____length_hint__ __lltrace__ __loader__ __lshift____lt____main__ __matmul__ __missing____mod__ __module____mro_entries____mul____name____ne____neg____new__ __newobj__ __newobj_ex____next__ __notes____or____orig_class__ __origin__ __package____parameters____path____pos____pow__ __prepare__ __qualname____radd____rand__ __rdivmod__ __reduce__ __reduce_ex____release_buffer____repr__ __reversed__ __rfloordiv__ __rlshift__ __rmatmul____rmod____rmul____ror__ __round____rpow__ __rrshift__ __rshift____rsub__ __rtruediv____rxor____set__ __set_name__ __setattr__ __setitem__ __setstate__ __sizeof__ __slotnames__ __slots____spec____str____sub____subclasscheck____subclasshook__ __truediv__ __trunc____type_params__#__typing_is_unpacked_typevartuple____typing_prepare_subst____typing_subst____typing_unpacked_tuple_args____warningregistry____weaklistoffset__ __weakref____xor__ _abc_impl _abstract__active _annotation _anonymous_ _argtypes__as_parameter__asyncio_future_blocking_blksize _bootstrap_check_retval_ _dealloc_warn_feature_version_fields_ _finalizing_find_and_load_fix_up_module_flags__get_sourcefile_handle_fromlist _initializing_io_is_text_encoding_length__limbo_lock_unlock_module_loop_needs_com_addref__only_immortal_pack_ _restype_ _showwarnmsg _shutdown _slotnames_strptime_datetime_swappedbytes__type__uninitialized_submodules_warn_unawaited_coroutine _xoptionsabs_tolaccessaddadd_done_callbackafter_in_childafter_in_parentaggregate_classaliasappendargargdefsargs argumentsargvas_integer_ratioast attributeauthorizer_callback autocommitbacktickbasebeforebig binary_formblockboundbufferbuffer_callback buffer_size bufferingbuffersbufsizebuiltins byteorderbytes bytes_per_sepc_call c_exceptionc_returncached_statementscadatacafilecallcall_exception_handler call_sooncancelcapathcategorycb_typecertfilecheck_same_threadclearcloseclosedclosefdclosure co_argcount co_cellvarsco_code co_constsco_exceptiontable co_filenameco_firstlinenoco_flags co_freevarsco_kwonlyargcount co_linetableco_nameco_names co_nlocalsco_posonlyargcount co_qualname co_stacksize co_varnamescodecommandcomment_factory compile_modeconstscontext contravariantcookiecopycopyregcorocount covariantcwddatadatabasedecodedecoderdefault defaultactiondeletedepth detect_types deterministicdevicedictdictcompdifference_updatedigest digest_size digestmoddir_fddiscarddispatch_table displayhookdklendoc dont_inheritdst dst_dir_fdduration eager_start effective_idselement_factoryencodeencodingend end_lineno end_offsetendpos entrypointenverrorsevent eventmaskexc_type exc_value excepthook exceptionexisting_file_nameexpextend extra_tokensfacilityfactoryfalsefamilyfanoutfdfd2fdelfgetfile file_actionsfilenamefilenofilepath fillvaluefiltersfinal find_class fix_importsflagsflushfollow_symlinksformat frequency from_paramfromlist fromtimestampfromutcfsetfuncfuture generationgenexprget get_debugget_event_loopget_loop get_sourcegetattrgetstategidglobals groupindexgroupshandle hash_nameheaderheadershihookididentignoreimag importlibin_fdincoming indexgroupinfinfer_variance inheritableinitial initial_bytes initial_valueinitval inner_sizeinputinsert_comments insert_pis instructionsintern intersection is_runningisatty isinstance isoformatisolation_levelistextitemitemsiteriterable iterationsjoinjumpkeependskeykeyfilekeyskindkwkw1kw2lambdalastlast_exc last_nodelast_traceback last_type last_valuelatin1 leaf_sizelenlengthlevellimitlineline_bufferinglinenolistcomplittlelolocalelocals logoptionloopmappingmatch max_length maxdigits maxeventsmaxmemmaxsplitmaxvaluememLevelmemlimitmessage metaclassmetadatamethodmodmodemodulemodule_globalsmodulesmromsgmycmpn_argn_fieldsn_sequence_fieldsn_unnamed_fieldsname name_fromnamespace_separator namespacesnargndigits new_file_name new_limitnewlinenewlinesnextnlocals node_depth node_offsetnsnstypentnullnumberobjobjectoffset offset_dst offset_src on_type_read onceregistry only_keysopargopcodeopenopener operationoptimizeoptionsorderoriginout_fdoutgoing overlappedownerpagesparentpasswordpathpatternpeek persistent_idpersistent_loadperson pi_factorypidpolicypospos1pos2posixprint_file_and_linepriorityprogressprogress_handlerprogress_routineprotoprotocolps1ps2query quotetabsrawreadread1readablereadallreadinto readinto1readlinereadonlyrealreducer_overrideregistryrel_tolreleasereloadreplreplacereservedresetresetidsreturnreversereversedsaltsched_priority schedulerseekseekable selectorsselfsendsepsequenceserver_hostname server_sidesessionsetcomp setpgroupsetsid setsigdef setsigmasksetstateshapeshow_cmdsignedsizesizehintskip_file_prefixessleepsocksortsoundsourcesource_tracebackspamsrc src_dir_fd stacklevelstart statementstatusstderrstdinstdoutstepsteps store_namestrategystrftimestrict strict_modestringsub_keysymmetric_difference_updatetabsizetagtargettarget_is_directorytasktb_frametb_lasti tb_linenotb_nexttelltemplatetermtext threadingthrowtimeouttimes timetupletoptrace_callback tracebacktrailers translatetruetruncatetwicetxttype type_paramstztznameuidunlinkunraisablehookuriusedforsecurityvaluevaluesversionvolumewarnings warnoptionswbitsweekweekdaywhichwhowithdatawritablewrite write_throughyearzdict      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~U1U1U1 U1(U10U18U1@U1HU1PU1XU1`U1hU1pU1xU1U1U1U1U1U1U1U1U1U1U1U1U1U1U1U1U1V1V1V1V1 V1(V10V18V1@V1HV1PV1XV1`V1hV1pV1xV1V1V1V1V1V1V1V1V1V1V1V1V1V1V1V1V1W1W1W1W1 W1(W10W18W1@W1HW1PW1XW1`W1hW1pW1xW1W1W1W1W1W1W1W1W1W1W1W1W1W1W1W1W1X1X1X1X1 X1(X10X18X1@X1HX1PX1XX1`X1hX1pX1xX1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1X1Y1jOW 8nOPYGCC: (Debian 12.2.0-14) 12.2.0.shstrtab.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.tbss.init_array.fini_array.data.rel.ro.dynamic.got.got.plt.data.PyRuntime.bss.comment $o(( 3( H5H5P0c8o\EoXXTHHX!^B"h88cPP@n~t\|.\|.zp|.p|.xq=xq=ܿX1>X1>~CCCCCCCC@RPJPJ`J`JJJ  K K YY ``0``